BAB I PENDAHULUAN

1.1

Latar Belakang Disebut logam berat berbahaya karena umumnya memiliki rapat massa

tinggi(5 gr/cm3) dan sejumlah konsentrasi kecil dapat bersifat racun dan berbahaya. Diantara semua unsur logam berat, Hg menduduki urutan pertama dalam hal sifatracunnya, kemudian diikuti oleh logam berat antara lain Cd, Ag, Ni, Pb, As, Cr, Sn,dan Zn. Logam berat merupakan komponen alami tanah. Logam berat masih termasuk golongan logam dengan kriteria-kriteria yang sama dengan logam-logam lain. Perbedaannya terletak dari pengaruh yang dihasilkan bila logam berat ini berikatandan atau masuk ke dalam tubuh organisme hidup. Sebagai contoh, bila unsur logambesi (Fe) masuk kedalam tubuh, meski dalam jumlah agak berlebihan, biasanyatidaklah menimbulkan pengaruh yang buruk terhadap tubuh. Karena unsur besi (Fe)dibutuhkan dalam darah untuk mengikat oksigen. Sedangkan unsur logam berat baik itu logam berat beracun yang dipentingkan seperti tembaga (Cu), bila masuk kedalam tubuh dalam jumlah berlebihan akan menimbulkan pengaruh-pengaruhburuk terhadap fungsi fisiologi tubuh. Jika yang masuk kedalam tubuh organismehidup adalah unsur logam berat beracun seperti hidragyrum(Hg) atau disebut juga airraksa, maka dapat dipastikan bahwa organisme tersebut akan langsung keracunan.Sehingga dengan kata lain elemen ini tidak dapat didegradasi maupun dihancurkan. Logam berat dapat masuk ke dalam tubuh manusia melalui makanan,air minum, atau udara. Logam berat seperti tembaga, selenium, atau seng dibutuhkantubuh manusia untuk membantu kinerja metabolisme tubuh. Akan tetapi, dapatberpotensi menjadi racun jika konsentrasi dalam tubuh berlebih. Logam berat menjadi berbahaya disebabkan sistem bioakumulasi, yaitu peningkatan konsentrasiunsur kimia didalam tubuh manusia. 1.2 ; Rumusan Masalah Apa yang dimaksud dengan pencemaran logam berat ?

KIMIA LINGKUNGAN

1

; ; ;

Apa penyebab terjadinya pencemaran air oleh logam berat ? Bagaimana proses pencemaran air oleh logam berat? Bagaimana dampak dan cara pengendalin pencemaran air oleh logam berat ?

1.3 ; ; ; ;

Tujuan Mengetahui pengertian pencemaran logam berat. Mengetahui sumber pencemaran air serta indikator terjadinya pencemaran air oleh logam berat Mengetahui proses pencemaran air oleh logam berat. Mengetahui dampak dan cara pengendalin pencemaran air oleh logamberat

1.4

Ruang Lingkup Makalah “Logam Berat” ini merupakan ruang lingkup Pengendalian

Pencemaran Lingkungan Fisik. 1.5 Manfaat Makalah ini dapat menambah pengetahuan tentang pengendalian pencemaran lingkungan “Logam Berat” terhadap manusia dan lingkungan.

KIMIA LINGKUNGAN

2

BAB II PEMBAHASAN

2.1

Pengertian Logam Berat Logam berat (heavy metal) adalah logam dengan massa jenis lima atau

lebih, dengan nomor atom 22 sampai dengan 92. Logam berat dianggap berbahaya bagi kesehatan bila terakumulasi secara berlebihan di dalam tubuh. Beberapa di antaranya bersifat membangkitkan kanker (karsinogen). Demikian pula dengan bahan pangan dengan kandungan logam berat tinggi dianggap tidak layak konsumsi. Kasus-kasus pencemaran lingkungan menyebabkan banyak bahan pangan mengandung logam berat berlebihan. Kasus yang populer adalah sindrom Minamata, sebagai akibat akumulasi raksa (Hg) dalam tubuh ikan konsumsi. Di Indonesia, pernah dilaporkan bahwa ikan-ikan di Teluk Jakarta juga memiliki kandungan raksa yang tinggi. Udang dari tambak Sidoarjo pernah ditolak importir dari Jepang karena dinilai memiliki kandungan kadmium (Cd) dan timbal (Pb) yang melebihi ambang batas. Diduga logam-logam ini merupakan dampak buangan limbah industri di sekitarnya. Kakao dari Indonesia juga pernah ditolak pada lelang internasional karena dinilai memiliki kandungan Cd di atas ambang batas yang diizinkan. Cd diduga berasal dari pupuk TSP yang diberikan kepada tanaman di perkebunan. Logam berat adalah unsur-unsur kimia dengan bobot jenis lebih besar dari 5 gr/cm3, terletak di sudut kanan bawah sistem periodik, mempunyai afinitas yang tinggi terhadap unsur S dan biasanya bernomor atom 22 sampai 92 dari perioda 4 sampai 7 (Miettinen, 1977). Sebagian logam berat seperti timbal (Pb), kadmium (Cd), dan merkuri (Hg) merupakan zat pencemar yang berbahaya. Afinitas yang tinggi terhadap unsur S menyebabkan logam ini menyerang ikatan belerang dalam enzim, sehingga enzim bersangkutan menjadi tak aktif. Gugus

KIMIA LINGKUNGAN

3

dan akan membahayakan kesehatan manusia yang mengkomsumsi organisme tersebut. Cu. maka tingkat atau daya racun logam berat terhadap hewan air dapat diurutkan (dari tinggi ke rendah) sebagai berikut merkuri (Hg). dan kobalt (Co) (Sutamihardja dkk. 1982). dan Co. seng (Zn). sehingga konsentrasinya selalu lebih tinggi dari konsentrasi logam dalam air. c Mudah terakumulasi di sedimen. sehingga mudah terakumulasi dalam lingkungan perairan dan keberadaannya secara alami sulit terurai (dihilangkan). dan Zn. timah hitam (Pb).karboksilat (-COOH) dan amina (-NH2) juga bereaksi dengan logam berat. yaitu : a Bersifat toksik tinggi yang terdiri dari atas unsur-unsur Hg. timbal. 1982) yaitu : a Sulit didegradasi. nikel (Ni). Cd. krom (Cr). Hal ini berkaitan dengan sifat-sifat logam berat ( PPLH-IPB. Disamping itu sedimen mudah tersuspensi karena pergerakan masa air yang akan melarutkan kembali KIMIA LINGKUNGAN 4 . 1997. Bersifat tosik rendah terdiri atas unsur Mn dan Fe. Ni. b Dapat terakumulasi dalam organisme termasuk kerang dan ikan. Berdasarkan sifat kimia dan fisikanya. Kadmium. dan tembaga terikat pada sel-sel membran yang menghambat proses transpormasi melalui dinding sel. b c Bersifat toksik sedang terdiri dari unsur-unsur Cr. Sedangkan menurut Kementrian Negara Kependudukan dan Lingkungan Hidup (1990) sifat toksisitas logam berat dapat dikelompokan ke dalam 3 kelompok. Logam berat juga mengendapkan senyawa fosfat biologis atau mengkatalis penguraiannya. berbahaya baik secara langsung terhadap kehidupan organisme. Menurut Darmono (1995) daftar urutan toksisitas logam paling tinggi ke paling rendah terhadap manusia yang mengkomsumsi ikan adalah sebagai berikut Hg2+ > Cd2+ >Ag2+ > Ni2+ > Pb2+ > As2+ > Cr2+ Sn2+ > Zn2+. maupun efeknya secara tidak langsung terhadap kesehatan manusia. Sutamihardja dkk. Pb. Adanya logam berat di perairan. kadmium (Cd).

Mempunyai respon biokimia khas (spesifik) pada organisme hidup. Istilah logam berat sebetulnya telah dipergunakan secara luas. Nierbor dan Richardson menggunakan istilah logam berat untuk menggantikan pengelompokan ion-ion logam kedalam 3 kelompok biologi dan kimia (bio-kimia) pengelompokan tersebut adalah sebagai berikut : a b Logam-logam yang dengan mudah mengalami reaksi kimia bila Logam-logam yang dengan mudah mengalami reaksi kimia bila bertemu dengan unsur oksigen atau disebur juga dengan oxygen-seeking metal. bila masuk kedalam tubuh dalam jumlah berlebihan akan menimbulkan pengaruh-pengaruh buruk terhadap fungsi fisiologi tubuh. KIMIA LINGKUNGAN 5 . Sedangkan unsur logam berat baik itu logam berat beracun yang dipentingkan seperti tembaga (Cu). 2004). Sebagai contoh. biasanya tidaklah menimbulkan pengaruh yang buruk terhadap tubuh. bertemu dengan unsur nitrogen dan atau unsur belerang (sulfur) atau disebut juga nitrogen/sulfur seeking metal.logam yang dikandungnya ke dalam air. terutama dalam perpustakaan ilmiah. Karena unsur besi (Fe) dibutuhkan dalam darah untuk mengikat oksigen. Logam berat masih termasuk golongan logam dengan kriteria-kriteria yang sama dengan logam-logam lain. sebagai suatu ilmiah yang menggambarkan bentuk dari logam tertentu. Karakteristik dari kelompok logam berat adalah sebagai berikut : a b c Spesifikasi graviti yang sangat besar (lebih dari 4). Jika yang masuk kedalam tubuh organisme hidup adalah unsur logam berat beracun seperti hidragyrum(Hg) atau disebut juga air raksa. bila unsur logam besi (Fe) masuk kedalam tubuh. meski dalam jumlah agak berlebihan. Perbedaannya terletak dari pengaruh yang dihasilkan bila logam berat ini berikatan dan masuk ke dalam tubuh organisme hidup. sehingga sedimen menjadi sumber pencemar potensial dalam skala waktu tertentu. Mempunyai nomor atom 22-34 dan 40-50 serta unsur-unsur lantanida dan aktinida. maka dapat dipastikan bahwa organisme tersebut akan langsung keracunan (Palar.

dan nikel (Ni). di antaranya adalah unsur-unsur logam. makaakan berubah fungsi menjadi zat racun bagi tubuh. kadmium (Cd). yang bisa merusak lingkungan khususnya perairan.yang masuk ke dalam perairan. limbah pertanian dan perumahan. Tetapi bila kebutuhan dalam jumlah yang sangat kecil itutidak terpenuhi. maka akan berakibatfatal terhadap kelangsungan hidup dari setiap makhluk hidup.Berbeda dengan logam biasa. dan khrom (Cr). sebagian dari logam-logam berat tersebut tetap dibutuhkan oleh makhluk hidup. logam berat biasanya menimbulkan efek-efek khusus pada makhluk hidup. seng (Zn). meski semua logam berat dapat mengakibatkan hidup. 2. limbah industri.c Logam antara atau logam transisi yang memiliki sifat khusus (spesifik) sebagai logam pengganti (ion pengganti) untuk logam-logam atau ionion logam dari kelas A dan logam dari kelas B. timah (Pb). Ternyata kemudian. unsure ini berkaitan dengan Hb darahmembentuk haemoglobin yang berfungi sebagai pengikat oksigen (O2) dalam darah. pertambangan (emas). maupun KIMIA LINGKUNGAN 6 . Karena tingkatkebutuhan sangat dipentingkan maka logam-logam tersebut juga dinamakan sebagailogam-logam atau mineralmineral esensial tubuh. Material berbahaya tersebut memiliki dampak yang bermacam-macam dalam perairan. keracunan atas makhluk hidup.kebutuhan tersebut berada dalam jumlah yang sangat sedikit. industry bahan kimia. Sebagai contoh adalahlogam air raksa (Hg). Contoh dari logam-logam beratesensial ini adalah tembaga (Cu).Sebagai contoh adalah unsure logam besi (Fe). Beberapa unsurelogam sangat dibutuhkan oleh makhluk hidup untuk mempertahankan kehidupannya. Namun demikian. Ada yang berdampak langsung. bila jumlahdari loga-logam esensial ini masuk ke dalam tubuh dalam jumlah berlebihan. Kimia dapat diartikan sebagai peranan kimia (unsure-unsur kimia) dalam kehidupan makhluk hidup. Dapat dikatakan bahwa semua logam berat dapatmenjadi racun yang akan meracuni tubuh makhluk hidup.2 Sumber Pencemaran Sumber pencemaran logam berat adalah masuknya material pencemar seperti partikel kimia.

Contoh logam berat yang sering mencemari adalah air raksa. mereka segera diserap ke dalam jaring makanan di laut.tidak langsung. Adapun aspek kimia-fisika pencemaran air itu adalah sebagai berikut : KIMIA LINGKUNGAN 7 . timah. pestisida ini dapat menyebabkan mutasi. Kelompok limbah kimia ini terbagi dua.Limbah kimia yang bersifat toxic (racun) yang masuk ke perairan laut akanmenimbulkan efek yang sangat berbahaya. seluruh penyusun rantai makanan termasuk manusia.Bahan kimia anorganik lain yang bisa berbahaya bagi ekosistem laut adalah nitrogen. Dalam jaring makanan. furan. Racun semacam itu dapat terakumulasi dalam jaringan berbagai jenis organisme laut yang dikenal dengan istilah bioakumulasi. dan fosfor. Senyawa kimia ini dapat menyebabkan eutrofikasi. apakah airtersebut termasuk air yang tercemar ataukah tidak tercemar. Sumber dari limbah ini umumnya berasal dari sisa pupuk pertanian yang terhanyut kedalam perairan.pertama kelompok racun yang sifatnya cenderung masuk terus menerus sepertipestisida. arsenik dan cadmium. nikel. dioksin dan fenol. Terdapat pula logam berat. ketika pestisida masuk ke dalam ekosistemlaut.3 Indikator Pencemaran Logam Berat Dalam Air Aspek-Aspek Pencemaran Air ada beberapa aspek sebagai pengukuran tingkat pencemaran air. suatu unsur kimiametalik yang memiliki kepadatan yang relatif tinggi dan bersifat racun atau beracunpada konsentrasi rendah. yang dapat berbahaya bagihewan laut. karena senyawa ini merupakan nutrien bagi tumbuhan air seperti alga dan phytoplankton. Tingginya konsentrasi bahan tersebut menyebabkan pertumbuhantumbuhan air ini akan meningkat dan akan mendominasi perairan. juga dari limbah rumah tangga berupa detergent yang banyak mengandung fosfor. serta penyakit. Bahan-bahan ini dapat menyebabkan mutasi keturunan dari organisme yang tercemar serta penyakit dan kematian secara massal seperti yang terjadi pada kasus yang terjadi di Teluk Minamata. Racun ini juga diketahui terakumulasi dalam dasar perairan yang berlumpur. Aspek-aspek pencemaranair yaitu terdiri dari aspek kimia-fisika pencemran air dan aspek biokimiapencemaran. sehinggamenganggu organisme lain bahkan bisa mematikan. 2.

Air akan bersifat asam atau basa tergantung besar kecilnya pH. bergantung kepada oksigen terlarut.5– 7. Jada kadar oksigenterlarut dapat dijadikan ukuran untuk menetukan kualitas air. d Karbondioksida Dalam AirKepekaan oksigen terlarut dalam air bergantung kepda kepekaankarbondioksida yang ada. Air buangan lebih tingi dari pada air asalnya.Meningkatkan kecepatan reaksi kimia. baik tumbuhan maupun hewan. makhluk yang tinggal di dalam air. Keasaman dan Alkhalinitas. dan terurainya zat tertentu. Jika udara (yang mengandung 0. yang mengakibatkan pembiasan cahaya ke dalam air. Air pendingin tersebut setelah digunakan akan mendapatkan panas daribahan yang didinginkan. ayitu sungaiatau sumber air lainnya. Air limbah dan bahan buanganindustri akan mengubah pH air yang akhirnya akan mengganggu kehidupan biotaakuatik. bahan tersuspensi diantaranya yang bersifat koloid. Naiknyasuhu air akan menimbulkan akibat sebagai berikut :Menurunya jumlah oksigen terlarut dalam air. kemudian dikembalikan ke tempat asalnya. sedangkan air yangmempunyai pH di atas pH normal bersifat basa.Bila pH di bawah pH normal. Warna air dibedakan menjadi dua macam yaitu warna sejati (akibat bahan-bahan terlarut) dan air semu (akibat bahan terlarut. b SuhuAir sering digunakan sebagai medium pendingin dalam berbagai prosesindustri.Mengganggu kehidupan ikan dan hewan air alinya. c Oksigen Terlarut untuk mempertahankan hidupnya. yan merupakan salah satu sifat air. jasad KIMIA LINGKUNGAN 8 .a Nilai pH. seperti bahan organik. Kekeruhan menunjukan sifat toptis air. ikan dan hewan air lainnyamungkin akan mati.Jika bata suhu yang mematikan terlampaui.Alkalinitas berkaitan dengan kesadahan air.03% karbondioksida)bersentuhan dengna permukaan air pada tekanan standar maka kelarytankarbondioksida terhadap perubahan suhu. Kekeruhan membatasi masukannya cahaya ke dalam air.Adanya ion kalsium (Ca) dan magnesium (Mg) di dalam air akan mengakibatkansifat kesadahan air tersebut.5. e Warna dan kekeruhan warna air yang tidak normaal biasanya merupakan indikasi terjadinya pencemaran air.Air normal yang memenuhi syarat untuk suatu kehidupan mempunyai pHsekitar 6. Kekurahan ini terjadi karena adanya bahan terapung. maka air tersebut bersifat asam.

sisapertanian.Aspek ini menggunakan dua pengujian yang berhubungan dengan kandunganoksigen dalam air yaitu : a. terutama kelarutannya.4 Proses Pencemaran Logam Berat Dalam Air Air laut adalah suatu komponen yang berinteraksi dengan lingkungan daratan. rumput laut dan lain-lain). polutan tersebut yang masuk ke air diserap Uji BOD (Biochemical Oxygen Demand Test = uji kebutuhan Uji COD (Chemical Oxygen Demand = uji kebutuhan oksigen oksigenbiokimia). udang. kerang. di mana buangan limbah dari daratan akan bermuara ke laut. kotoran hewan dan sisa tumbuhan dan hewan yang mati. Semakin keruh air. NitratJika kandungan nitrat tersebut akan berubah menjadi nitrit di perut. Selain itu ada juga yang disebut dengan aspek biokimia pencemaran air. 2.Keracunan nitrit akan mengakibatkan wajah membiru dan kematian.renik. Limbah tersebut yang mengandung polutan kemudian masuk ke dalam ekosistem perairanpantai dan laut. ikan. semakin tinggi daya hantar listriknya dansemakin banyak pula padatannya. lumpur tanah liat dan benda yang terapung dansangat halus sekali.Padatan terlarut total. Pencegahanpencemaran posfor dapat dilakukan dengan melarang penggunaan ditergen yangmengandung posfat. Sebagian larut dalam air. sebagian tenggelam ke dasar danterkonsentrasi ke sedimen. Kemudian.Padatan tersuspensi dan koloid. cumi-cumi.Minyak dan Lemak g.. limbah. b. g PosforPosfor memasuki air melalui berbagai jalan yaitu kotoran. KIMIA LINGKUNGAN 9 . f Padatan pada dasarnya air yang tercemar selalu mengandung padatan yang dapatdibedakan menjadi empat kelompok berdasarkan besar partikelnya dan sifatsfatlainnya. dan sebagian masuk ke dalam jaringan tubuh organismelaut (termasuk fitoplankton. Selain itu air laut juga sebagai tempat penerimaan polutan (bahan cemar) yang jatuh dari atmosfir.Padatan terendap (sedimen). yaitu :. kimia). Juga dengan mewajibkan pengolahan limbah industridengan memberikann air kapur atau aluminium sulfat agar posfatnyamengendapa dan dapat dibuang.

WHO (World Health Organization) atau Organisasi Kesehatan Duniadan FAO (Food Agriculture Organization) atau Organisasi Pangan Dunia merekomendasikan untuk tidak mengonsumsi makanan laut (seafood) yang tercemarlogam berat. Fitoplankton danzooplankton dimakan oleh ikan-ikan planktivores (pemakan plankton) sebagai tropik level kedua. selanjutnya dimangsa oleh ikan predator sebagaitropik level tertinggi.Fitoplankton adalah produsen dan sebagai tropik level pertama dalamrantai makanan. Konsentrasi polutan dalam tubuh zooplankton lebih tinggi dibanding dalam tubuh fitoplankton karenazooplankton memangsa fitoplankton sebanyakbanyaknya. kemudian dijadikan sebagai bahan makanan maka akan berbahaya bagi kesehatan manusia. Bila polutan ini berada dalam jaringan tubuh organisme laut tersebut dalam konsentrasi yang tinggi. Polutan tersebut mengikuti rantai makanan mulai dari fitoplankton sampai ikan predator dan pada akhirnya sampai ke manusia.5 Beberapa logam berat yang berbahaya a.Kerang juga mengandung logam berat yang tinggi karena cara makannya denganmenyaring air masuk ke dalam insangnya setiap saat dan fitoplankton ikut tertelan.langsung olehfitoplankton. Mercury KIMIA LINGKUNGAN 10 . 2. Makanan yang berasal dari daerah tercemarkemungkinan besar juga tercemar. Kemudian fitoplankton dimakan zooplankton. Ikan planktivores dimangsa oleh ikan karnivores (pemakan ikan atauhewan) sebagai tropik level ketiga. Logam berat telah lama dikenal sebagai suatu elemen yang mempunyaidaya racun yang sangat potensil dan memiliki kemampuan terakumulasi dalam organtubuh manusia. Demikian juga makanan laut (seafood) yangberasal dari pantai dan laut yang tercemar juga mengandung bahan polutan yangtinggi. Bahkan tidak sedikit yang menyebabkan kematian.Ikan predator dan ikan yang berumur panjang mengandungkonsentrasi polutan dalam tubuhnya paling tinggi di antara seluruh organisme laut. Karena kesehatan manusia sangat dipengaruhi oleh makanan yang dimakan. Salah satu polutan yang paling berbahaya bagi kesehatan manusia adalahlogam berat.Polutan ikut masuk ke dalam tubuhnya dan terakumulasi terus-menerus dan bahkan bisa melebihi konsentrasi yang di air.

crustacea dan ikan yang merupakankonsumsi sehari-hari bagi masyarakat Minamata. udang dan makanan laut lainnyayang mengandung mercury. Kemudian mencapai konsentrasiyang tinggi pada daging kerang-kerangan. kerang. Dewasa ini mercury telah digunakan secara meluas dalamproduk elektronik. lumpuh. KIMIA LINGKUNGAN 11 . Methyl mercury ini masuk ke dalam tubuh organisme laut baik secaralangsung dari air maupun mengikuti rantai makanan. pembungkus makanan juga kadang mencemari makanan tersebut. industri pembuatan cat.sebagai katalisator. Penggunaan mercury sebagai elektroda dalampembuatan soda api dalam industri makanan seperti minyak goreng. Pada saat itu banyak orang mengalami penyakityang mematikan akibat mengonsumsi ikan. dan lain-lain. Masyarakat Minamata yang mengonsumsi makanan laut yang tercemar tersebutdalam jumlah banyak telah terserang penyakit syaraf. Manusia telah menggunakanmercury oksida (HgO) dan mercury sulfida (HgS) sebagai zat pewarna dan bahankosmetik sejak jaman dulu.Air Raksa atau Mercury (Hg) adalah salah satu logam berat dalam bentuk cair. Industri Kimia Chisso menggunakan mercury khlorida(HgCl2) sebagai katalisator dalam memproduksi acetaldehyde sintesis di mana setiap memproduksi satu ton acetaldehyde menghasilkan limbah antara 30-100 gr mercurydalam bentuk methyl mercury (CH3Hg) yang dibuang ke laut Teluk Minamata.kertas tima. Konsentrasi atau kandunganmercury dalam rambut beberapa pasien di rumah sakit Minamata mencapai lebih 500ppm. Meskipun pencemaran mercury dapat terjadi secaraalami tetapi kadarnya sangat kecil.Terjadinya pencemaran mercury di perairan laut lebih banyak disebabkan oleh faktormanusia dibanding faktor alam. produk susu. Pencemaran mercury secara besar-besarandisebabkan karena limbah yang dibuang oleh manusia. kehilangan inderaperasa dan bahkan banyak yang meninggal dunia. peleburan emas. Kasus minamata yang terjadi dari tahun 1953 sampai1975 telah menyebabkan ribuan orang meninggal dunia akibat pencemaran mercurydi Teluk Minamata Jepang. pembuatan gigi palsu.Pencemaran logam mercury (Hg) mulai mendapat perhatian sejak munculnya kasusminamata di Jepang pada tahun 1953.

penciuman. Gejalanya ditandai dengan ketidak normalan tulangdan beberapa organ tubuh menjadi mati. batubaramengandung Cd sampai 2 ppm. baterai. Pencemaran kadmium pada air minum di Jepang menyebabkan penyakit “itai”. Konsentrasi Cd pada air laut yang tidak tercemar adalah kurang dari 1 mg/l ataukurang dari 1 mg/kg sedimen laut.Bahan bakar dan minyak pelumas mengandung Cd sampai 0. pupuk superpospat juga mengandung Cd bahkan adayang sampai 170 ppm. pewarnaan.5 ppm. Pb dapat diakumulasi langsung dari air dan dari sedimen olehorganisme laut.95 mg/kg.01.b. anemia dan mempengaruhi anggotatubuh lainnya.Konsentrasi Cd maksimum dalam air minum yangdiperbolehkan oleh Depkes RI dan WHO adalah 0. Kadmium telah digunakan secara meluas pada berbagai industri antara lainpelapisan logam. ginjal. Sebaliknya Dirjen Pengawasan Obat dan Makanan merekomendasikan tidak lebihdari 2. Keracunan kronis yang disebabkan oleh Cd adalah kerusakan sistem fisiologis tubuh seperti pada pernapasan. c Timbal Timbal (Pb) juga salah satu logam berat yang mempunyai daya toksitas yangtinggi terhadap manusia karena dapat merusak perkembangan otak pada anak-anak. sirkulasi darah.mg/l. Kadmium Kadmium (Cd) menjadi populer sebagai logam berat yang berbahaya setelahtimbulnya pencemaran sungai di wilayah Kumamoto Jepang yang menyebabkankeracunan pada manusia. Limbah cair dari industri dan pembuangan minyak pelumasbekas yang mengandung Cd masuk ke dalam perairan laut serta sisa-sisa pembakaranbahan bakar yang terlepas ke atmosfir dan selanjutnya jatuh masuk ke laut. peleburan logam. Dewasa ini pelepasan Pb ke atmosfir meningkat tajam akibatpembakaran minyak dan gas bumi yang turut menyumbang pembuangan Pb keatmosfir.menyebabkan penyumbatan sel-sel darah merah. Selanjutnya Pb tersebut jatuh ke laut mengikuti air KIMIA LINGKUNGAN 12 . bahan bakar. minyak pelumas. jantung dan kerapuhan tulang. serta merusak kelenjar reproduksi.0 mg/kg. Sementara batasmaksimum konsentrasi atau kandungan Cd pada daging makanan laut yang layak bagikesehatan yang direkomendasikan FAO dan WHO adalah lebih kecil dari 0.

gamma GT). Pada sistem reproduksi. infeksi kulit (dermatitis) dan mempunyai efek pencetus kanker (carcinogenic). Pada sistem immunologi. d Arsen Intoksikasi tubuh manusia terhadap arsenik (As). logam berat Arsen dapat menganggu fungsi pembuluh darah. Pada darah. kulit. portal hypertention (hipertensi oleh karena faktor pembuluh darah potal). Pada saluran laryng). Pada pernafasan. Dengan kejadiantersebut maka banyak negara di dunia mengurangi tetraeil Pb pada minyak bumi dangas alam untuk mengurangi pencemaran Pb di atmosfir.hujan. menyebabkan timbulnya laryngitis (infeksi renal damage (terjadi bronchitis (infeksi bronkus) dan dapat pula menyebabkan kanker paru. Arsen (As) akan menyebabkan kerusakan ginjal berupa ichemia and kerusakan jaringan). penebalan kulit (hiperkeratosis). mempunyai efek yang signifikan pada paparan yang cukup lama (paparan kronis). menyebabkan kegagalan fungsi sungsum tulang dan terjadinya pancytopenia (yaitu menurunnya jumlah sel darah perifer). lazim disebut effek malformasi. liver cirrhosis (jaringan hati berubah menjadi jaringan ikat dan ascites (tertimbunnya cairan dalam ruang perut). timbul seperti bubul (clavus). dan liver. SGPT. efek arsen terhadap fungsi reproduksi biasanya fatal dan dapat pula berupa cacat bayi waktu dilahirkan. Pada pembuluh darah. penyakit burger). oedema paru dan penyakit pembuluh darah perifer (varises. sehingga dapat mengakibatkan penyakit arteriosclerosis (rusaknya pembuluh darah). Pada liver. terjadi penurunan daya KIMIA LINGKUNGAN 13 . darah . ichterus (penyakit kuning). dapat berakibat buruk terhadap mata. berupa meningkatnya aktifitas enzim pada liver (enzim SGOT. Pada kulit menyebabkan berwarna gelap (hiperpigmentasi). akan ginjal. Efek Arsenic terhadap mata adalah gangguan penglihatan dan kontraksi mata pada bagian perifer sehingga mengganggu daya pandang ( visual fields) mata.

karenaitu konsentrasi dalam air minum yang dikonsumsi seharusnya ditentukan lebih rendah. KIMIA LINGKUNGAN 14 . pembuluh darah dan ginjal. f Klor Kadar Cl yang berlebihan akan menyebabkan rasa asin dan korosif pada logam. e Kromium Keracunan tubuh manusia terhadap chromium (Cr). g Flour Beriklim hangat konsentrasi fluor MenurutNpedoman WHO yang dikeluarkan tahun 1984. Sementara di wilayah yang iklimnya lebih dingin. kelainan berupa nekrosis tubulus ginjal. Gastrointestinal (saluran pencernaan) . Karen adalam cuaca panas. berupa anker paru dan ulkus kronis/ perforasi pada septum nasal. Mengapa perbedaan iklim mempengaruhi jumlah fluor yang sebaiknya dikonsumsi. efek terhadap sel mengakibatkan Arsen rusaknya mitochondria dalam inti sel menyebabkan turunnya energi sel dan sel dapat mati. dapat berakibat buruk terhadap saluran pernafa san. Pada kulit (Skin effects). mual (nausea) dan muntah (vomiting). akibat nya peka terhadap bahan karsinogen (pencetus kanker) dan infeksi virus. Pada Pada sistem sel. Sedangkan pada ginjal (Kidney effects). 2 ppm. berupa ulkus kronis pada permukaan kulit. akan menyebabkan perasaan mual dan muntah. untuk wilayah yang optimal dalam airminum sebaiknya masih dibawah 1 mg/liter atau 1 ppm (parts per million). serta nyeri perut. Efek chromium (Cr) terhadap s istem saluran pernafasan ( Respiratory sistem effects).tahan tubuh/ penurunan kekebalan. kulit. tubuh kita mengeluarkan lebih banyak keringat sehingga perlu minum lebih banyak. Pada pembuluh darah (Vascular effects). konsentrasinya 1. berupa penebalan oleh plag pada pembuluh aorta (Atherosclerotic aortic plaque).

yaituretakpanggul.000 kematian akibatkan kerkarena fluori daada tahun 1988. Studi yang dilakukan National Cancer Institute Toxicological Program menemukan bahwa fluorida bisa digolongkan sebagai karsinogen. Memberikan fluorida kepada anak-anak bukan saja tidak bermanfaat tetapi berbahaya.1 ppm kandungan fluor konsumsitiapsaat. 1999). Kemudianterdapatefekkronis. infeltirasi. Di India. HUMO membuat tulisan tentang bahaya fluorida (Nurno Nr. Memang permukaan gigi menjadi lebih keras. Namun selama ini setidaknya dua belas pemenang Nobel di bidang kedokteran dan kimia telah memberi peringatan sehubungan risiko kesehatan yang ditimbulkannya. Fluorida sangat reaktif dan mampu menembus hinggake dalamtulangdan set tempat substansi terakumulasi.5 ppm. namun gigi itu sendiri menjadi lebih rapuh. kematian massal –puluhanjuta orangkarenamen kanker.Efekakut yang ada terjadi padakonsumsi air minumdari air sumur yang belumdiuji di India Tengah. April 20. yang banyakdijumpaikasus fluorosis. melaporkan setidaknya 40.Berdasarkan pedoman WHO juga diketahui bahwa batas ataskan dungan fluor dalam air minum yang diperbolehkan adalah 1. padatahun 1998 telah menetapkan bata satas yang diperbolehkanhanya 1 ppm. tetapi memberi argument para pendukung pemakai fluorida. Dari berbagai uji toksisitas yang telah dilakukan banyak sekali fakta bahwa fluorida sangat membahayakan pengguna. khususnya dari para dokter gigi yang meski tidak diragukan berniat baik. memilikikadarfluortinggiyaitusekitar 38 ppm dan mengakibatkan deritaartritisparah. Penyakitretak panggul terjadi karena meminum air yang mengandungfluor yang mampu meningkatkan risiko retak panggulhingg adua kali lipat bagi pria dan wanaita lanjut usia hanyadengan 0. Ilmuwan FDA (Food and Drug Administration) melaporkan adanya korelasi kuat antara penurunan KIMIA LINGKUNGAN 15 . Pada tahun 1999. KepalaKimiawan di National Cancer Institute AS. Pada saat itu reaksinya cukup banyak.17/33059. dan Alzheimer. Fluorosis yang mengancam kesehatan inimemiliki efekakut dan kronis. namunti dak bersifat universal. kerusakan otak.

agar bila terpaksa harus dibuang ke sungai tidak menyebabkan terjadinya pencemaran air.Penumpukan logam-logam berat ini terjadi dalam tumbuh- KIMIA LINGKUNGAN 16 . menyebabkan naiknya tekanan darah dan terganggunyasistem syaraf.Jangka panjang. Bahkan kalau dapat setelah diolah tidak dibuang ke sungai melainkan dapat digunakan lagi untuk keperluan industri sendiri. Beracun jika terhirupdari udara atau uap. Cadmium (Cd): Dalam bentuk serbuk mudah terbakar. Jangka panjang. Pada Manusia bahaya yang Dapat Ditimbulkan oleh Logam Berat di dalam Tubuh Manusia : 1 Barium (Ba): Dalam bentuk serbuk.dicurigai dapat menyebabkan hipertensi.6 Menaggulangi Pencemaran Logam Berat Pengolahan limbah industri sebelum dibuang ke tempat pembuangan. kemudian diolah.Pencemaran air yang telah terjadi secara alami misalnya adanya jumlahlogam-logam berat yang masuk dan menumpuk dalam tubuh manusia. pankreas. mudah terbakar pada temperatur ruang.TerakhirpenelitianVarnier J A yang dilaporkandalam Wall Street Journal menyebutkanbahwafluoridamenyebabkankerusakanotakdanmalfungsikoordinasitu buhsetelahtermagnifikasi.Larutan dari kadmium sangatberacun. Kelebihan kadar flourida pada air akan menyebakan kerusakan pada gigi ( carries gigi ). 2. terakumulasi di hati. logam berat inidapat meracuni organ tubuh melalui pencernaan karena tubuh memakan tumbuh-tumbuhan yang mengandung logam berat meskipun diperlukan dalam jumlah kecil.dialirkan ke sungai atau selokan hendaknya dikumpulkan di suatu tempat yangdisediakan.tingkatfertiitaswanitadalamrentangusis 10-49 tahundenganpeningkatan level fluorida. ginjal dan tiroid.Dapat menyebabkan kanker.

Peran pemerintah untuk melakukan AMDAL terhadap suatu perusahaan yangmenggunakan air raksa harus dilakukan dengan benar dan sanksi yang tegas apabilaAMDALnya membahayakan kesehatan manusia dan lingkungan.tumbuhan karena terkontaminasi oleh limbah industri. maka limbah industri hendaknya dilakukanpengolahan sebelum dibuang ke lingkungan.Usaha-usaha tersebut dapatdilakukan. Artinya. . . . Bupati.Pengendalian/penanggulangan pencemaran air di Indonesia telah diaturmelalui Peraturan Pemerintah Nomor 82 tahun 2001 tentang Pengelolaan Kualitas danPengendalian Pencemaran Air. kebijakan publik. Hal ini bisa dilakukan dengan memberikan penyuluhan-penyuluhan padamasyarakat penambang. Menempatkan daerah industri atau pabrik jauh dari daerah perumahan ataupemukiman Pembuangan limbah industri diatur sehingga tidak mencermari lingkungan atauekosistem Pengawasan terhadap penggunaan jenis jenis pestisida dan zat zat kimia lainyang dapat menimbulkan pencemaran Memperluas gerakan penghijauan Tindakan tegas terhadap perilaku pencemaran lingkungan Memberikan kesadaran terhadap masyaratkat tentang arti lingkungan hidupsehingga manusia lebih lebih mencintai lingkungan hidupnya Melakukan intensifikasi pertanianPencegahan adalah lebih baik dari pengobatan.Proses pencegahan terjadinya pencemaran lebih baik daripada prosespenanggulangan terhadap pencemaran yang telah terjadi. . . .Salah satu upaya serius yang telah dilakukan Pemerintah dalam pengendalianpencemaran air adalah melalui Program Kali Bersih (PROKASIH) KIMIA LINGKUNGAN 17 . Untuk menanggulangi agar tidak terjadipenumpukan logam-logam berat. Khususnya untuk kasus PETI(Penambangan Emas Tanpa Izin). Gubernur. . ini kembali pada soalkoordinasi unsur-unsur masyarakat terkait. diantaranya melalui menjaga air tanah agar tetap bersih misalnya : . danDepartemen Pertambangan sangat menentukan dalam mengurangi pencemaransungai.

sehingga tidak meracuni mayarakat. bahwa Teluk Jakarta menerima air dari 13 sungai. biota laut. 2000 ). Penelitian di Kepulauan Seribu menunjukkanbahwa konsentrasi beberapa logam berat sudah melampaui standar yang berlaku.Pada prinsipnya ada 2 (dua) usaha untuk menanggulangi pencemaran. air dan tanah seagian besar akantersalurkan air dan masuk ke dalam laut. baik berasl udara. mengatur danmengawasi segala macam bentuk kegiatan industri dan teknologi sehingga tidak terjadi pencemaran. standar yang berlaku telah di lampaui sebanyak 45% sampai 91 % ( Djuangsih. danHg dalam konsentrasi yang jauh lebih besar dari yang diperolehkan. misalnyameliputi AMDAL.2000 ) KIMIA LINGKUNGAN 18 . Sekalipun demikian. 2. ternyata juaga mengandung Cd. Peraturan perundangan ini hendaknya dapat memberikangambaran secara jelas tentang kegiatan industri yang akan dilaksanakan. belumada peraturan yang menentukan bagian laut mana saja yang boleh dieksploitasiproduknya. 6 jenis ikan yang biasa di makan turis. pengaturan dan pengawasan kegiatan dan menanamkan perilakudisiplin. Patut dicatatdisini . misalnya dengan mengubah proses.196.7 Contoh Kasus Pencemaran laut.Semua pencemar. mengelolalimbah atau menambah alat bantu yang dapat mengurangi pencemaran. Zn. Pb. dan pariwisata ( berenang dan menyelam).50 untuk Zn ( Kunaefi dan Herto. Cu. yaitupenanggulangan secara non-teknis dan secara teknis. muali dari yang terkecil11.20 untuk Pb sampai 65. Penanggulangan secara nonteknis yaitu suatu usaha untuk mengurangi pencemaran lingkungan dengan caramenciptakan peraturan perundangan yang dapat merencanakan. Penelitian lain di Pantai UtaraTangerang yang menerima air 12 sungai. Hal inidiperkirakan akibat dari proses biokonsentrasi. Sedangkan penanggulangan secara teknis bersumber pada perlakuan industriterhadap perlakuan buangannya. menunjukkan kualitas air sudah tidak lagimemenuhi syarat bagi perikanan. Factor biokonsentrasi ( BCF ) yangdiperkirakan untuk logamlogam tersebut sangat bervariasi.

konsentrasi beberapa logam berat sudah melampauistandar yang berlaku dan sebagian besar tersalurkan air ke dalam laut. Cd. biotalaut. ternyata juaga mengandung Cd. standar yang berlaku telah dilampaui. Ada beberapa faktor yang mempengaruhi aktivitas keracunan setiap jenis logam berat. antara lain: bentuk senyawa dari logam berat itu.2. ukuran partikel dan beberapa sifat kimia dan fisika lainnya. Hal ini disebabkan Pb dapat menghambat kerja enzim yang diperlukan untuk pembentukan hemoglobin (Dewi dan Saeni. 6 jenis ikan yang biasa di makan turis. Zn. dan pariwisata ( berenang dan menyelam ). dan bila tubuh kekurangan Ca dan Fe. Dan untuk masyarakat yang mengalami keracunan seharusnya ditindak lanjuti lebih dini. sehingga meningkatnya kadaar pada jaringan lunak dan juga menyebabkan hemotoksisitas. penyerapan Pb akan meningkat. Pb. khususnya Pb adalah nutrisi. kehamilan dan umur. 2010). Cu. Zn. Dampak KasusKepulauan Seribu menunjukkan bahwa konsentrasi beberapa logam beratsudah melampaui standar yang berlaku. Cu. Pengendalian dari kasusUntuk logam-logam berat seperti Hg. dan Hg dalam konsentrasi yang jauhlebih besar dari yang diperolehkan. dan lain-lain dalampemakaiannya diperhatikan menurut standar yang berlaku dan limbah yangdihasilkan diolah melalui pengolahan sehingga tidak mencemari lingkungankhususnya air. daya kelarutannya dalam cairan. Pb.8 Pembahasan Kasus Analisa Kasus Di Kepulauan Seribu. Kurang gizi akan meningkatkan kadar Pb yang bebas dalam darah. Dalam Faktor yang Mempengaruhi Toksisitas Timbal KIMIA LINGKUNGAN 19 . Kadar Ca dan Fe yang tinggi dalam makanan akan menurunkan penyerapan Pb. a Contoh Kasus Timbal Faktor-faktor yang dapat mempengaruhi kerentanan tubuh terhadap logam berat. Dinyatakan pula defisiensi Fe dan Pb akan menyebabkan gangguan ekskresi Pb dari tulang.Sehingga kualitas air sudah tidak lagi memenuhi syarat bagi perikanan. Hal ini diperkirakan akibat dari prosesbiokonsentrasi.

Sel darah merah muda (retikulosit) dan sel stipel kemudian dibebaskan. ras. Misalnya merokok dan minum minuan keras) KIMIA LINGKUNGAN 20 . sehingga organ-organ ini harus selalu dimonitor untuk mengetahui derajat keracunan terhadap logam berat (Hammond. yaitu hati dan ginjal. Sifat fisik Sifat kimia Cara masuk kedalam tubuh Faktor individu (usia.beberapa kasus.Timbal menghambat enzim sulfidril untuk mengikat delta-amnolevulinik acid (ALA) menjadi porprobilinogen. Ditemukannya sel stipel basofil (basophilic stipping) merupakan gejala dari adanya gangguan metabolik dari pembentukan Hb.Basofilik stipling reteni dari DNA ribosoma dalam sitoplasma eritrosit sehingga mengganggu sintesis protein.Tetapi. Hal ini menyebabkan anemia dan adanya basofilik stipling dari eritrosit yang merupakan cirri khas keracunan timbale. kesehatan.Timbale dapat mengganggu enzim oksidase dan akibatnya menghambat sistem metabolism sel. lebih sering logam berat ini merusak organ-organ detoksikasi dan ekskresi.tanda keracunan Pb. salah satu diantaranya adalah menghambat sintesis Hb dalam sumsum tulang. sebagian besar timbal diserap dalam bentuk ikatan dengan eritrosit. faktor genetic dan kebiasaan lain. 1979 dalam Darmono 1983). logam berat biasanya menyerang jaringan syaraf atau menghambat aktivitas enzimatik melalui reaksi biokimia. Kompensasi penurunan sintesis Hb karena terhambat timbal adalah peningkatan produksi erithrofoesis. Faktor yang mempengaruhi toksisitas bahan kimia pada manusia adalah: a b c d Tempat Kerja Didalam aliran darah. serta protoforvirin IX menjadi Hb. dengan cara menghambatenzim delta aminolevulinik acid dehidratase (delta ALAD) dan feroketalase yangakhirnya meningkatkan ekskresi koproporfirin dalam urin dan delta ALA sertamensintesis Hb. Hal ini terjadi karena adanya tanda . status gizi. jenis kelamin. Timbal mengganggu sistem sintesis Hb dengan cara menghambat konversidelta aminolevulinik acid (delta ALAD) menjadi forfobilinogen dan menghambatkorporasi dari Fe ke protoporfirin IX untuk membentuk Hb.

Sel darah merah gagal untuk menjadi dewasa dan sel tersebut menyisakan organel yang biasanya menghilang pada proses kedewasaan sel. akhirnya poliribosoma ireguler pada agregat RNA membentuk sel stipel (Sudarwin. Absorbsi Timbal dalam Tubuh Timbal masuk ke dalam tubuh terutama melalui saluran pencernaan dari makanan dan minuman.Paparan inhalasi umumnya terjadi pada kawasan industri. Paparan pada daerah non-industri terjadi terutama melalui pencernaan. Semua bahan pangan mengandung timbal dalam konsentasi yang kecil dan dalam proses mempersiapkan makanan mungkin timbal akan bertambah (Fardiaz.Partikel yang mudah larut menyebabkan absorbsi di paru berlangsung cepat dan luas. KIMIA LINGKUNGAN 21 . 2008). Berikut ini salah satu mekanisme intake manusia terhadap logam berat termasuk Timbal/Timah hitam (Pb): Penyerapan Timbal dapat melalui inhalasi debu timbal atau benda berbahan timbal lainnya. 1995). tetapi dapat juga melalui pernafasan atau kulit dari udara yang terdcemar timbal.

Absorsbi zat– zat kimia oleh tubuh dapat melalui saluran pernapasan. OSHA menyatakan level paparan yang diizinkan (PEL) untuk debu atau asap timbal inorganik adalah 50 mcg/m3 selama 8 jam. pengelasan dan pembakaran potongan logam yang permukaannya dilapisi cat yang berbahan dasar timbal menyebabkan intoksikasi timbal simptomatik dalam satu hari sampai beberapa minggu. uap – uap dan mist (kabut) setelah diserap oleh paru – paru akan masuk kedalam aliran darah dan kemudian didistribusikan ke bagian – bagian / organ –organ tubuh lainnya. uap dan mist.5 1>2500 mcg/m3) ditemui selama peledakan. uap-uap atau mists tersebut. Partikel yang diabsorbsi secara inhalasi dengan ukuran <0. Sedangkan gas tidak mudah larut dalam air akan mengadakan iritasi pada saluran pernafasan bagian bawah. yang terjadi adalah karena absorbsi saluran pernafasan lebih baik daripada absorsi saluran pencernaan. Level yang berbahaya bagi kesehatan dan mengancam jiwa(IDHL) adalah 100 mg/m3.terutama pada anak-anak yang mengabsorbsi 45-50% timbal larut dibandingkan pada orang dewasa yang hanya sekitar 10-15%. a Absorbsi Melalui Saluran Pernafasan. uap-uap dan mists yang mudah larut dalam lemak dapat diserap melalui kapiler – kapiler pembuluh darah yang terdapat disekitar alveoli dan selanjutnya zat – zat tersebut dari aliran darah akan menuju ke binding sites yakni jaringan lemak (Fat Depots) yang mempunyai afinitas khusus terhadap gas-gas. saluran pencernaan dan kulit. serta zat padat. Keracunan zat – zat kimia melaui saluran pernafasan (inhalasi) adalah yang terpenting dan yang saling sering terjadi ditempat – tempat kerja. Gas – gas.zat kimia yang terhirup dan menyebabkan keracunan dapat digolongkan menjadi kelompok gas. Zat. dan iritasi biasanya timbul beberapa jam setelah pemaparan (peradangan paru yang akut dan sembab paru). Gas –gas. b Absorbsi Melaui Saluran Pencernaan Adapun proses biotransformasi dengan jalur pencernaan adalah dipengaruhi oleh faktor dibawah ini : KIMIA LINGKUNGAN 22 . Gas – gas iritan yang mudah larut dalam airakan menyebabkan iritasi ini dapat timbul segera setelah inhalasi gas – gas tersebut.

. Batas toksik dan anjuran/batas aman “intake” logam berat Arsen Apabila terjadi kontak dengan bahan kimiayang banyak terjadi adalah: (As). .1995). . Logam berat KIMIA LINGKUNGAN 23 .manusia) yang disebut pencemaran dakhil(Notohadiprawira. Disamping melalui mulut dari makanan dan minuman.manusia) atau lewat rantai pangan panjang (tanaman – hewan. Zat kimia akan menembus kulit dan menyebabkan sensitasi pada kulit Zat kimia akan menembus kulit dan kemudia masuk kedalam aliran darah dan selanjutnya akan menimbulkan efek sistemik. Pengosongan lambung mampu mengurangi absorbsi senyawa kimia Peristaltik usus yang meningkat akan menghambat absorbsi zat kimia melalui usus Getah lambung dan pankreas mampu menghidrolisis dan mereduksi zat – zat kimia berbahaya. . Absorbsi Zat Kimia Melalui Kulit Kulit (lemak dan keringat) berfungsi sebagai barier Zat kimia akan bereaksi dengan permukaan kulit dan menyebabkan iritasi primer (asam dan basa kuat serts pelarut organik). dan [proses detoksikan menyebabkan absorbsi zat – zat kimia kimia ke dalam darah menjadi kurang efisien dan selektif .. Timbal/lead (Pb) dan Zink (Zn) dalam tubuh manusia adalah sebagai berikut: Proses Biotransformasi Logam Berat (Pb) Logam berat masuk ke tubuh manusia melewati rantai pangan pendek (hewan . Makanan dan cairan yang terdapat dalam saluran pencernaan dapat mengencerkan toksin dan membentuk kompleks zat kimia yang mudah larut air c . . Kadmium (Cd). unsur logam berat juga dapat masuk ke dalam tubuh melalui pernafasan dan kulit.

. banyak digunakan dalam industri kabel. Laidler (1991) menyatakan didalam bensin timbal ditambahkan dalam bentuk timbal tetra etil (TEL) dengan rumus molekul (C2H5)4-Pb atau dalam bentuk timbal tetra metil dengan rumus molekul (CH3)4-Pb. ginjal dan . pembentuk darah.Hidrolisis dan Konjugasi. Proses ini umumnya menyebabkan terbentuknya metabolit yang mudah larut air. Reduksi. gigi. dan rambut. Fase pertama adalah meningkatkan polaritas senyawa toksik sehingga kelarutannya pada air akan meningkat.1992). konvulsi dan diarrhea. Adanya kontaminasi timbal dalam tubuh dapat diketahui melalui pengukuran kadar timbal dalam darah. dalam pestisida. Gugus ini banyak terdapat dalam enzim. yang kemudian berakhir dengan kematian (Bartic dan Piskoc. 1980). Selain dari makanan. 1991). Biotransformasi umumnya menghasilkan metabolit yang kurang toksik. kebutaan. 1981). Fase tersebut dikenal dengan fase pertama dari biotransformasi. anoreksia. Selain itu jufga adanya fase roaksi oksidatif yang bertujuan untuk menambaha kereaktivan senyawa toksik. dalam penyepuhan. sehingga hewan akan mengalami sakit perut (kolik) yang hebat. dan memiliki kepolaran yang tinggi sehingga mudah di ekskresikan oleh tubuh.mempunyai afinitas yang tinggi terhadap senyawa – senyawa sulfida. cat (sebagai warnanya). timbal dalam rambut dapat berasal dari cat rambut yang mengandung timbal asetat dan dapat berasal dari debu (Cohen dan Ros. seperti sulfihidril (-SH) dan disulfida (-S-S)(Petruci. batrei. Proses Biotransformasi adalah proses transpormasi metabolik dimana zat kimia dirubah menjadi zat derifat lain (Metabolit) dalam tubuh manusia. dan yang paling banyak ditambahkan pada bensin. dan air. sehingga dengan terkaitnya logam berat pada gugus ini. Tujuan pereaktivan senyawa toksik adalah dengan KIMIA LINGKUNGAN 24 . udara. Transformasi metabolik dapat dibagi menjadi emapat kategori diantaranya Oksidasi. Timbal disebut juga sebagai timah hitam. dan tidak mudah larut lemak. Racun timah hitam ini biasanya mempengaruhi sistem syaraf. anemia. Keracunan timah hitam sering terjadi pada hewan ruminansia yang merumput di daerah tercemar (Humphreys. logam berat dapat menghambat kerja enzim tertentu.

Terdapat dua macam reaksi oksidasi yaitu penambahan oksigen secara langsung pada unsur – unsur carbon. Pada reaksi konjugasi grup – grup polar akan di tambahkan pada hasil reaksi pada fase satu. merupakan satu – satunya reaksi biotransformasi yang terjadi di dalam tubuh. ginjal. gizi. Pada jaringan atau organ tubuh logam Pb akan terakumulasi pada tulang.. Fase kedua adalah proses konjugasi. dan lain. Adapun faktor – faktor yang mempengaruhi proses biotransformasi adalah : status kesehatan. melalui proses Dehidrogenasi. Selain itu juga apabila akumulasi pada tubuh semakin meningkat maka seberapa besar kemampuan tubuh dalam mengubah tingkat toksisitasnya masih kurang. nitrogen. Disamping itu pada wanita hamil logam Pb dapat dapat melewati plasenta dan kemudian akan ikut masuk dalam sistem peredaran darah janin dan selanjutnya setelah bayi lahir Pb akan dikeluarkan bersama air susu. Peranan Reduksi dalam biotransformasi umumnya adalah kurang begitu penting. Hal itu disebabkan senyawa- KIMIA LINGKUNGAN 25 . sulfur.mempermudah keterikatannya dengan senyawa anti oksidan yang mampu meningkatkan ROX. Pewarna sintetik umumya sulit umtuk dilakukan proses metabolit yang menjadikannya kurang toksik.lain). Meskipun jumlah Pb yang diserap oleh tubuh hanya sedikit ternyata logam Pb ini sangat berbahaya. Salah satu storage depot yang penting adalah jaringan lemak (Adipose Tissue). Pada kasus timah hitam (Pb) dalam tubuh akan ditimbun dalam tulang tetapi manifestasi efek toksiknya akan terlihat pada jaringan – jaringan lunak (syaraf. logam ini mampu menggantikan keberadaan ion Ca2+ (kalsium) yang terdapat pada jaringan tulang. Deposit Organ dan Efek Pb terhadap Kesehatan Penimbunan zat-zat kimia (Chemical Storage) dalam jaringan/organ tubuh dapat terjadi di jaringan atau organ dimana efek zat – zat kimia akan terlihat. Kebanyakan dari reaksi – reaksi ini memerlukan enzim – enzim mikrosomal dan juga oksidase – oksidase yang terdapat dalam sitoplasma dan mitokondria. Oksidasi merupakan reaksi biotransformasi yang paling penting. Karena dalam bentuk ion Pb2+. usia.

Dapat pula menimbulkan anemia dan bagi wanita hamil yang terpajan timbal akan mengenai anak yang disusuinya dan terakumulasi dalam ASI. memendekkan tinggi badan. mempengaruhi perilaku dan intelejensia. nephropati irreversible. seperti ginjal. Paparan bahan tercemar Pb dapat menyebabkan gangguanpada organ sebagai berikut : .Komponen Pb organik misalnya tetraethil Pb segara dapat terabsorbsi oleh tubuh melalui kulit dan membran mukosa. fibrosis dan KIMIA LINGKUNGAN 26 . disimpan dan kemudian ditampung dalam darah. Gangguan terhadap fungsi ginjal Logam berat Pb dapat menyebabkan tidak berfungsinya tubulus renal. sclerosis va skuler. .Pb organik diabsorbsi terutama melalui saluran pencernaan dan pernafasan dan merupakan sumber Pb utama di dalam tubuh. merusak fungsi organ tubuh. Dampak dari timbal sendiri sangat mengerikan bagi manusia. meningkatkan tekanan darah dan mempengaruhi perkembangan otak. dan reproduksi. kemampuan belajar. Pb yang terhirup oleh manusia setiap hari akan diserap. Kira-kira 5-10 % dari jumlah yang tertelan akan diabsorbsi melalui saluran pencernaan. Di antaranya adalah mempengaruhi fungsi kognitif. Pb sebagai gas buang kendaraan bermotor dapat membahayakan kesehatan dan merusak lingkungan. ataxia. penurunan fungsi pendengaran. dan kira-kira 30 % dari jumlah yang terisap melalui hidung akan diabsorbsi melalui saluran pernafasan akan tinggal di dalam tubuh karena dipengaruhi oleh ukuran partikel-partikelnya. sistem syaraf. utamanya bagi anak-anak.senyawa Pb dapat memberikan efek racun terhadap berbagai macam fungsi organ tubuh. stupor dan coma. Tidak semua Pb yang terisap atau tertelan ke dalam tubuh akan tertinggal di dalam tubuh. Pada anak-anak dapat menimbulkan kejang tubuh dan neuropathy perifer. sel tubulusatropi. Bentuk kimia Pb merupakan faktor penting yang mempengaruhi sifat-sifat Pb di dalam tubuh. Gangguan neurologi Gangguan neurologi (susunan syaraf) akibat tercemar oleh Pb dapat berupa encephalopathy.

namun belum tampak adanya gejala lead encephalopathy. halusinasi.3-dimercapto-succinic acid (DMSA) KIMIA LINGKUNGAN 27 . Efek dominan dari keracunan Pb pada sistem hemopoitik adalah peningkatan ekskresi ALA dan CP (Coproporphyrine).sclerosis glumerolus. . . Gangguan terhadap sistem hemopoitik Keracunan Pb dapat dapat menyebabkan terjadinya anemia akibat penurunan sintesis globin walaupun tak tampak adanya penurunan kadar zat besi dalam serum. b Contoh Kasus Merkuri 2. tremor. Apabila pada masa bayi sudah mulai terpapar oleh Pb. Akibatnya dapat menimbulkan aminoaciduria dan glukosuria. maka pengaruhnya pada profil psikologis dan penampilan pendidikannya akan tampak pada umur sekitar 5-15 tahun. Pada anak dengan kadar Pb darah (Pb-B) sebesar 40-80 μg/100 ml dapat timbul gejala gangguan hematologis. gampang lupa. mudah tersinggung. kesakitan dan kematian janin. dan jika paparannya terus berlanjut dapat terjadi nefritis kronis. Pada anak – anak juga terjadi peningkatan ALA dalam darah. Gangguan terhadap sistem syaraf Efek pencemaran Pb terhadap kerja otak lebih sensitif pada anakanak dibandingkan pada orang dewasa. Gejala yang timbul pada lead encephalopathy antara lain adalah rasa cangung. sukar konsentrasi dan menurunnya kecerdasan. Logam berat Pb mempunyai efek racun terhadap gamet dan dapat menyebabkan cacat kromosom . gampang tersinggung. Gangguan terhadap sistem reproduksi Logam berat Pb dapat menyebabkan gangguan pada sistem reproduksi berupa keguguran. dan penurunan pembentukan konsep. Gambaran klinis yang timbul adalah rasa malas. Anemia ringan yang terjadi disertai dengan sedikit peningkatan kadar ALA ( Amino Levulinic Acid) urine. sakit kepala. Akan timbul gejala tidak spesifik berupa hiperaktifitas atau gangguan psikologis jika terpapar Pb pada anak berusi 21 bulan sampai 18 tahun. Paparan menahun dengan Pb dapat menyebabkan lead encephalopathy.

3-dimercapto-succinic acid (DMSA) merupakan senyawa organik yang larut dalam air. Dalam upaya mempercepat proses pengeluaran merkuri dalam tubuh manusia.( Khalil : 2011 KIMIA LINGKUNGAN 28 . yang tidak terkontaminasi merkuri. DMSA Senyawa organik yang dikenal juga dengan nama dagang chemet ini merupakan khelator yang efektif dalam penanganan keracunan logam berat seperti timbal. Pada manusia normal. Sedangkan sisanya berada dalam bentuk bebas atau tanpa ikatan dengan gugus lain. DMSA dapat digunakan bersamaan dengan khelator lain seperti ALA (Alpha Lipoic Acid). arsen dan merkuri. diekskresikan melalui urin dalam bentuk disulfida dengan gugus thiol sistein.2. Gambar 1. yang mengandung dua gugus tiol (-SH). dalam upaya mengurangi gangguan kesehatan sebagai akibat pembentukan radikal bebas oleh merkuri. seperti vitamin E dan vitamin C. Rusia dan Republik Rakyat China. manusia. DMSA akan mengikat merkuri yang terikat pada gugus thiol pada sistein dan kemudian nantinya akan dikeluarkan bersama urine. 90 % DMSA yang diabsorbsi tubuh. dan sejak tahun 1970-an digunakan di Eropa dan Amerika Serikat. Dalam tubuh. Serangkaian penelitian menunjukkan bahwa DMSA mampu mengeluarkan 65 % merkuri dari dalam tubuh manusia dalam selang waktu tiga jam (Patrick : 2002) DMSA relatif aman digunakan sebagai khelator. DMSA juga dapat digunakan bersamaan dengan anti oksidan. Senyawa ini telah digunakan dalam penanganan keracunan merkuri sejak tahun 1950-an di Jepang.

4% padaanak-anakdan 13. Selain Fluorosis gigi. kadar Hg pada ikan di Teluk Minamata sebesar 11 µg/kg berat basah dan di sungai Agano sebesar 10 µg/kg berat basah. berkisarantara 22. bayi. yang mirip dengan kelainan psikiatrik.Pada studi epidemiologi ditemukan bahwa keracunan metil dan etil merkuri sebagian besar di sebabkan oleh konsumsi ikan yang di peroleh dari daerah tercemar atau makanan yang berbahan baku tumbuhan yang disemprot dengan pestisida jenis fungisida alkil merkuri. semuanyadiatasstandar yang berlaku. untuklokasi yang sama. Pada tahun 1968 Katsuna melaporkan adanya epidemic keracunan Hg di Teluk Minamata. dan orang tua. menyimpulkan bahwa efek keracunan Hg tergantung dari kepekaan individu dan faktor genetik. Berdasarkan temuan Diner dan Brenner (1998) serta Frackelton dan Christensen (1998) dikatakan bahwa diagno se klinis keracunan tidaklah mudah dan sering dikaburkan dengan diagnose Hg kelainan merupakan gangguan psikologik berupa rasa cemas dan kadang timbul sifat psikiatrik dan autisme. Penelitian Eto (1999). Gejala yang timbul akibat keracunan agresi.7 ppm. Pada saat terjadi epidemi. Hg dapat anak-anak. sebesar 1 ppm. apabilakadarfluor rata-rata dalam air diurutdari yang terkecilhingga yang terbesaradalah 1. dan pada tahun 1967 terjadi pencemaran Hg di sungai Agano di Nigata.7% pada orang dewasa.8%-70. ditemukan juga deformitas KIMIA LINGKUNGAN 29 . Kesukaran diagnose tersebut disebabkan oleh karena panjangnya periode laten dari mulai terpapar sampai timbulnya gejala dan tidak jelasnya bentuk gejala yang timbul. c Kasus Flour InsidensiFluorisisgigi di 10 desaIndia Tengah yang ditelitisecararinci.6%-81. Di Irak pada tahun 1971-1972 terjadi keracunan alkil merkuri akibat mengkonsumsi gandum yang disemprot dengan alkil merkuri yang menyebabkan 500 orang meninggal dunia dan 6000 orang masuk rumah sakit. Individu yang peka terhadap keracunan Hg adalah anak dalam kandungan (prenatal).4 hingga 9.

kerangka. karena tidak sanggup lagi berdiri. kanker. Penelitian di Indonesia menunjukkanadanya Fluorosis gigi yang ditemukansekitargunungapi. 1979). kerusakan otak. Ciater. sekitar Gunung Tangkuban parahu didapat insiden Fluorosis anak sebesar 41. Dalampenelitian yang sama. ditemukan pula bahwa fluorosis gigianakmulaitampakpada intake F> 1 mg tiaphari (Indah. Kemudian terdapat efek kronis. maka sapi tersebut terpaksa harus disembelih. Fluorosis yang mengancam kesehatan ini memiliki efek akut dan kronis. Keracunan Fluor demikian telah merugikan banyak peternak (Shupe.47-2. Apabila terjadi patah tulang pada ternak sapi misalnya. Di Segalaherang. Kepala Kimiawan di National Cancer Institute AS.1 ppm kandungan fluor konsumsi tiap saat.89 ppm. Studi yang dilakukan National Cancer Institute Toxicological Program menemukan bahwa fluorida bisa digolongkan sebagai karsinogen. yaitu retak panggul. dan Alzheimer. infeltirasi. Terakhir penelitian Varnier J A yang dilaporkan dalam Wall Street KIMIA LINGKUNGAN 30 .000 kematian akibat kanker karena fluorida pada tahun 1988. Keracunan Fluor akibatemisi F keudara dari berbagai industri seringkali menyebabkan Fluorosis padat ernas. memiliki kadar fluor tinggi yaitu sekitar 38 ppm dan mengakibatkan kematian massal puluhanjuta orang karena menderita artritis parah. Penyakit retak panggul terjadi karena meminum air yang mengandungfluor yang mampu meningkatkan risiko retak panggul hingga dua kali lipat bagi pria dan wanita lanjut usia hanya dengan 0.7% dan sekitar Gunung Ijen di Asembagussebesar 100% (Suwondo. Efek akut yang ada terjadi pada konsumsi air minum dari air sumur yang belum diuji di India Tengah. 1970). Ternyatahubunganstatistikkadar F didalam air teh di Segalaherang yang mengandung F sebesar 22. Ilmuwan FDA (Food and Drug Administration) melaporkan adanya korelasi kuat antara penurunan tingkat fertilitas wanita dalam rentan gusis 10-49 tahun dengan peningkatan level fluorida. Dari berbagai uji toksisitas yang telah dilakukan banyak sekali fakta bahwa fluorida sangat membahayakan pengguna. melaporkan setidaknya 40. 1989).

d Arsenik Pencemaran Arsen dalam Lingkungan Pembakaran batubara dan pelelehan logam merupakan sumber utama pencemaran arsen dalam udara. Arsen merupakan salah satu hasil sampingan dari proses pengolahan bijih logam non-besi terutama emas. Tingginya tingkat pelapukan kimiawi dan aktivitas biokimia pada wilayah tropis.Pembakaran kayu yang diawetkan oleh senyawa arsen pentavalen. dapat menaikkan kadar arsen di udara. Ketika tailing dari suatu kegiatan pertambangan dibuang di dataran atau badan air. limbah unsur pencemar kemungkinan tersebar di sekitar wilayah tersebut dan dapat menyebabkan pencemaran lingkungan. Bahaya pencemaran lingkungan ini terbentuk jika tailing yang mengandung unsur tersebut tidak ditangani secara tepat.Journal menyebutkan bahwa fluorida menyebabkan kerusakan otak dan mal fungsi koordinasi tubuh setelah termagnifikasi. Dampak Arsen Terhadap Kesehatan Manusia KIMIA LINGKUNGAN 31 .Pupuk yang di dalamnya mengandung arsen. Selanjutnya dapat memasuki sistem air permukaan atau merembes ke dalam akifer-akifer air tanah setempat. Ini terjadi di negara-negara yang memproduksi emas dan logam dasar (Herman. yang mempunyai sifat sangat beracun. Pencemaran arsen terdapat di sekitar pelelehan logam (tembaga dan timah hitam). Sumber pencemaran arsen juga dapat berasal dari: 1. D. akan menunjang percepatan mobilisasi unsur-unsur berpotensi racun. 2. 2006).Pusat listrik tenaga panas bumi (geothermal) yang dapat menyebabkan kontaminasi arsen pada udara ambient.Z. 3.

kerusakan syaraf dan sel. Gejala keracunan kronis yang ditimbulkannya pada tubuh manusia berupa iritasi usus. 2005). Dosis rendah akan mengakibatkan kerusakan jaringan. sebaiknya diberi antidotumnya.wikipedia. yang dapat mengakibatkan kematian. yaitu bila kadarnya melebihi 100 ppb dalam air minum. Cara mengatasi keracunan arsenik berbeda antara keracunan akut dan kronik. Segera cari pertolongan medis.WHO menetapkan ambang aman tertinggi arsen dalam air tanah sebesar 50 ppb (www.org. muntah dan diare. masukkan air dalam jumlah yang cukup besar ke dalam mulut untuk mencuci. Kemudian segera ke dokter untuk mendapat pertolongan medis. Pemberian katartik atau karboaktif dapat bermanfaat. gunakan sabun. kelainan kulit atau melanoma serta kanker usus. Berikut ini adalah implikasi klinik akibat tercemar oleh arsen: Cara Mengatasi Keracunan Arsenik Pertolongan pertama (standart treatment) bila kulit kita terpapar arsenik: cuci permukaan kulit dengan air mengalir secara kontinu kurang lebih 10 menit. Baju yang terkontaminasi harus dilepaskan. mual. Salah satu akibat yang merugikan dari arsen adalah apabila dalam air minum mengandung unsur arsen melebihi nilai ambang batas. yaitu suntikan intramuskuler KIMIA LINGKUNGAN 32 . Arsen inorganik telah dikenal sebagai racun manusia sejak lama. Dapat juga dilakukan bilas lambung apabila ia tidak dapat minum. Sedangkan untuk keracunan yang sudah berlangsung lebih lama (termasuk juga keracunan kronik). Selain itu mengakibatkan penurunan pembentukan sel darah merah dan putih. kerusakan pembuluh darah. Sementara bila racun masuk ke pencernaan. korban diberi ipekak untuk merangsangnya muntah. atau sampai tidak ada kandungan bahan kimia di atas kulit. air jangan tertelan. Bila melalui mulut. Bila perlu. 2009). minum kurang lebih 250 ml air dan jangan memaksakan muntah. Kalau bahan kimianya sudah tertelan.( Wijanto. Untuk keracunan akut yang belum berlangsung 4 jam. gangguan fungsi jantung. luka di hati dan ginjal. nyeri. Tetapi. pada umumnya efek yang timbul adalah iritasi saluran makanan. Air tanah biasa digunakan sebagai sumber air minum bagi kelangsungan hidup manusia.

terselubung. Selain itu.blogspot. Zat yang mengandung belerang dalam bawang putih dapat mengurangi kadar arsen dalam jaringan dan darah. KIMIA LINGKUNGAN 33 . Metode kimia dan sintetik saat ini digunakan untuk mengobati keracunan arsenik. Mereka melakukan uji coba pada tikus.dimerkaprol 3-5 mg/kgBB 4-6 kali sehari selama 2 hari. ada penelitian menarik yang dilakukan oleh Keya Chaudhuri dan rekan-rekannya dari Indian Institute of Chemical Biology di Kolkata dalam jurnal Food and Chemical Toxicology. Sehingga mereka yang tinggal di daerah yang beresiko terkontaminasi arsenik dalam air disarankan untuk mengonsumsi satu sampai tiga siung bawang putih per hari sebagai pencegahan keracunan arsen. Pengobatan dilanjutkan 2-3 kali sehari selama 8 hari ( www. Dimercaprol jauh lebih beracun daripada succimer.com. Tikus yang diberi makan ekstrak bawang putih kandungan arsenik dalam darah dan hatinya berkurang 40 persen dan 45 persen dari arsen juga di keluarkan lewat air seni tikus tersebut. Dimercaprol dan asam dimercaptosuccinic adalah agen chelating yang mengambil arsenik dari protein darah dan digunakan untuk mengobati keracunan arsenik akut. 2009).

BAB III PENUTUP 3. yang bisa merusak lingkungan khususnya perairan. Cara pengendalian pencemaran air oleh logam berat dengan Pengolahan limbah industri sebelum dibuang ke tempat pembuangan. limbah industri. pertambangan (emas). Kesimpulan : Pencemaran adalah masuknya atau dimasukkannya makhluk hidup dankomponen lain yang berasal dari alamiah atau aktivitas manusia ke dalam komponen ( air. KIMIA LINGKUNGAN 34 . industry bahan kimia.Sedangkan indikator terjadinya pencemaran lingkungan dapat dilihat dari aspek kimia-fisika pencemran air dan aspek kimia pencemaran. tanah dan udara) sehingga tidak sesuai lagi dengan peruntukannya. . . Sumber-sumber pencemaran adalah partikel kimia. limbah pertanian dan perumahan. di mana buangan limbah dari daratan akan bermuara ke laut.1 . 20/1990 tentang Pengendalian Pencemaran Air. Berdasarkan pembahasan tersebut dapat disimpulkan bahwa 3. yang masuk ke dalam perairan.2 Saran Saran dari penyusun adalah kita telah mengetahui logam berat itu berbahaya jika masuk dalam tubuh dan hendaknya kita bias mengontrol keluar masuknya limbah yang mengandung logam berat. . Proses pencemaran air oleh logam berat melalui interaksi suatu komponen lingkungan daratan. Contohnya PP No.

Sign up to vote on this title
UsefulNot useful