BAB I PENDAHULUAN

1.1

Latar Belakang Disebut logam berat berbahaya karena umumnya memiliki rapat massa

tinggi(5 gr/cm3) dan sejumlah konsentrasi kecil dapat bersifat racun dan berbahaya. Diantara semua unsur logam berat, Hg menduduki urutan pertama dalam hal sifatracunnya, kemudian diikuti oleh logam berat antara lain Cd, Ag, Ni, Pb, As, Cr, Sn,dan Zn. Logam berat merupakan komponen alami tanah. Logam berat masih termasuk golongan logam dengan kriteria-kriteria yang sama dengan logam-logam lain. Perbedaannya terletak dari pengaruh yang dihasilkan bila logam berat ini berikatandan atau masuk ke dalam tubuh organisme hidup. Sebagai contoh, bila unsur logambesi (Fe) masuk kedalam tubuh, meski dalam jumlah agak berlebihan, biasanyatidaklah menimbulkan pengaruh yang buruk terhadap tubuh. Karena unsur besi (Fe)dibutuhkan dalam darah untuk mengikat oksigen. Sedangkan unsur logam berat baik itu logam berat beracun yang dipentingkan seperti tembaga (Cu), bila masuk kedalam tubuh dalam jumlah berlebihan akan menimbulkan pengaruh-pengaruhburuk terhadap fungsi fisiologi tubuh. Jika yang masuk kedalam tubuh organismehidup adalah unsur logam berat beracun seperti hidragyrum(Hg) atau disebut juga airraksa, maka dapat dipastikan bahwa organisme tersebut akan langsung keracunan.Sehingga dengan kata lain elemen ini tidak dapat didegradasi maupun dihancurkan. Logam berat dapat masuk ke dalam tubuh manusia melalui makanan,air minum, atau udara. Logam berat seperti tembaga, selenium, atau seng dibutuhkantubuh manusia untuk membantu kinerja metabolisme tubuh. Akan tetapi, dapatberpotensi menjadi racun jika konsentrasi dalam tubuh berlebih. Logam berat menjadi berbahaya disebabkan sistem bioakumulasi, yaitu peningkatan konsentrasiunsur kimia didalam tubuh manusia. 1.2 ; Rumusan Masalah Apa yang dimaksud dengan pencemaran logam berat ?

KIMIA LINGKUNGAN

1

; ; ;

Apa penyebab terjadinya pencemaran air oleh logam berat ? Bagaimana proses pencemaran air oleh logam berat? Bagaimana dampak dan cara pengendalin pencemaran air oleh logam berat ?

1.3 ; ; ; ;

Tujuan Mengetahui pengertian pencemaran logam berat. Mengetahui sumber pencemaran air serta indikator terjadinya pencemaran air oleh logam berat Mengetahui proses pencemaran air oleh logam berat. Mengetahui dampak dan cara pengendalin pencemaran air oleh logamberat

1.4

Ruang Lingkup Makalah “Logam Berat” ini merupakan ruang lingkup Pengendalian

Pencemaran Lingkungan Fisik. 1.5 Manfaat Makalah ini dapat menambah pengetahuan tentang pengendalian pencemaran lingkungan “Logam Berat” terhadap manusia dan lingkungan.

KIMIA LINGKUNGAN

2

BAB II PEMBAHASAN

2.1

Pengertian Logam Berat Logam berat (heavy metal) adalah logam dengan massa jenis lima atau

lebih, dengan nomor atom 22 sampai dengan 92. Logam berat dianggap berbahaya bagi kesehatan bila terakumulasi secara berlebihan di dalam tubuh. Beberapa di antaranya bersifat membangkitkan kanker (karsinogen). Demikian pula dengan bahan pangan dengan kandungan logam berat tinggi dianggap tidak layak konsumsi. Kasus-kasus pencemaran lingkungan menyebabkan banyak bahan pangan mengandung logam berat berlebihan. Kasus yang populer adalah sindrom Minamata, sebagai akibat akumulasi raksa (Hg) dalam tubuh ikan konsumsi. Di Indonesia, pernah dilaporkan bahwa ikan-ikan di Teluk Jakarta juga memiliki kandungan raksa yang tinggi. Udang dari tambak Sidoarjo pernah ditolak importir dari Jepang karena dinilai memiliki kandungan kadmium (Cd) dan timbal (Pb) yang melebihi ambang batas. Diduga logam-logam ini merupakan dampak buangan limbah industri di sekitarnya. Kakao dari Indonesia juga pernah ditolak pada lelang internasional karena dinilai memiliki kandungan Cd di atas ambang batas yang diizinkan. Cd diduga berasal dari pupuk TSP yang diberikan kepada tanaman di perkebunan. Logam berat adalah unsur-unsur kimia dengan bobot jenis lebih besar dari 5 gr/cm3, terletak di sudut kanan bawah sistem periodik, mempunyai afinitas yang tinggi terhadap unsur S dan biasanya bernomor atom 22 sampai 92 dari perioda 4 sampai 7 (Miettinen, 1977). Sebagian logam berat seperti timbal (Pb), kadmium (Cd), dan merkuri (Hg) merupakan zat pencemar yang berbahaya. Afinitas yang tinggi terhadap unsur S menyebabkan logam ini menyerang ikatan belerang dalam enzim, sehingga enzim bersangkutan menjadi tak aktif. Gugus

KIMIA LINGKUNGAN

3

karboksilat (-COOH) dan amina (-NH2) juga bereaksi dengan logam berat. yaitu : a Bersifat toksik tinggi yang terdiri dari atas unsur-unsur Hg. c Mudah terakumulasi di sedimen. b Dapat terakumulasi dalam organisme termasuk kerang dan ikan. Cu. seng (Zn). Ni. Sedangkan menurut Kementrian Negara Kependudukan dan Lingkungan Hidup (1990) sifat toksisitas logam berat dapat dikelompokan ke dalam 3 kelompok. Berdasarkan sifat kimia dan fisikanya. berbahaya baik secara langsung terhadap kehidupan organisme. dan Co. Pb. Sutamihardja dkk. Menurut Darmono (1995) daftar urutan toksisitas logam paling tinggi ke paling rendah terhadap manusia yang mengkomsumsi ikan adalah sebagai berikut Hg2+ > Cd2+ >Ag2+ > Ni2+ > Pb2+ > As2+ > Cr2+ Sn2+ > Zn2+. Disamping itu sedimen mudah tersuspensi karena pergerakan masa air yang akan melarutkan kembali KIMIA LINGKUNGAN 4 . kadmium (Cd). Adanya logam berat di perairan. Cd. sehingga konsentrasinya selalu lebih tinggi dari konsentrasi logam dalam air. maupun efeknya secara tidak langsung terhadap kesehatan manusia. 1997. 1982). Logam berat juga mengendapkan senyawa fosfat biologis atau mengkatalis penguraiannya. Hal ini berkaitan dengan sifat-sifat logam berat ( PPLH-IPB. sehingga mudah terakumulasi dalam lingkungan perairan dan keberadaannya secara alami sulit terurai (dihilangkan). b c Bersifat toksik sedang terdiri dari unsur-unsur Cr. nikel (Ni). dan Zn. dan akan membahayakan kesehatan manusia yang mengkomsumsi organisme tersebut. 1982) yaitu : a Sulit didegradasi. dan kobalt (Co) (Sutamihardja dkk. timah hitam (Pb). dan tembaga terikat pada sel-sel membran yang menghambat proses transpormasi melalui dinding sel. timbal. krom (Cr). maka tingkat atau daya racun logam berat terhadap hewan air dapat diurutkan (dari tinggi ke rendah) sebagai berikut merkuri (Hg). Kadmium. Bersifat tosik rendah terdiri atas unsur Mn dan Fe.

Jika yang masuk kedalam tubuh organisme hidup adalah unsur logam berat beracun seperti hidragyrum(Hg) atau disebut juga air raksa. Karena unsur besi (Fe) dibutuhkan dalam darah untuk mengikat oksigen.logam yang dikandungnya ke dalam air. Sedangkan unsur logam berat baik itu logam berat beracun yang dipentingkan seperti tembaga (Cu). KIMIA LINGKUNGAN 5 . Logam berat masih termasuk golongan logam dengan kriteria-kriteria yang sama dengan logam-logam lain. bertemu dengan unsur nitrogen dan atau unsur belerang (sulfur) atau disebut juga nitrogen/sulfur seeking metal. biasanya tidaklah menimbulkan pengaruh yang buruk terhadap tubuh. Mempunyai nomor atom 22-34 dan 40-50 serta unsur-unsur lantanida dan aktinida. sehingga sedimen menjadi sumber pencemar potensial dalam skala waktu tertentu. sebagai suatu ilmiah yang menggambarkan bentuk dari logam tertentu. Karakteristik dari kelompok logam berat adalah sebagai berikut : a b c Spesifikasi graviti yang sangat besar (lebih dari 4). Istilah logam berat sebetulnya telah dipergunakan secara luas. Nierbor dan Richardson menggunakan istilah logam berat untuk menggantikan pengelompokan ion-ion logam kedalam 3 kelompok biologi dan kimia (bio-kimia) pengelompokan tersebut adalah sebagai berikut : a b Logam-logam yang dengan mudah mengalami reaksi kimia bila Logam-logam yang dengan mudah mengalami reaksi kimia bila bertemu dengan unsur oksigen atau disebur juga dengan oxygen-seeking metal. terutama dalam perpustakaan ilmiah. maka dapat dipastikan bahwa organisme tersebut akan langsung keracunan (Palar. 2004). meski dalam jumlah agak berlebihan. Perbedaannya terletak dari pengaruh yang dihasilkan bila logam berat ini berikatan dan masuk ke dalam tubuh organisme hidup. bila unsur logam besi (Fe) masuk kedalam tubuh. bila masuk kedalam tubuh dalam jumlah berlebihan akan menimbulkan pengaruh-pengaruh buruk terhadap fungsi fisiologi tubuh. Sebagai contoh. Mempunyai respon biokimia khas (spesifik) pada organisme hidup.

Karena tingkatkebutuhan sangat dipentingkan maka logam-logam tersebut juga dinamakan sebagailogam-logam atau mineralmineral esensial tubuh.c Logam antara atau logam transisi yang memiliki sifat khusus (spesifik) sebagai logam pengganti (ion pengganti) untuk logam-logam atau ionion logam dari kelas A dan logam dari kelas B. Dapat dikatakan bahwa semua logam berat dapatmenjadi racun yang akan meracuni tubuh makhluk hidup. unsure ini berkaitan dengan Hb darahmembentuk haemoglobin yang berfungi sebagai pengikat oksigen (O2) dalam darah. sebagian dari logam-logam berat tersebut tetap dibutuhkan oleh makhluk hidup. meski semua logam berat dapat mengakibatkan hidup. limbah pertanian dan perumahan. bila jumlahdari loga-logam esensial ini masuk ke dalam tubuh dalam jumlah berlebihan. maka akan berakibatfatal terhadap kelangsungan hidup dari setiap makhluk hidup. logam berat biasanya menimbulkan efek-efek khusus pada makhluk hidup.yang masuk ke dalam perairan. Beberapa unsurelogam sangat dibutuhkan oleh makhluk hidup untuk mempertahankan kehidupannya. seng (Zn).kebutuhan tersebut berada dalam jumlah yang sangat sedikit. Contoh dari logam-logam beratesensial ini adalah tembaga (Cu). Ternyata kemudian. Sebagai contoh adalahlogam air raksa (Hg).Berbeda dengan logam biasa. Material berbahaya tersebut memiliki dampak yang bermacam-macam dalam perairan. Kimia dapat diartikan sebagai peranan kimia (unsure-unsur kimia) dalam kehidupan makhluk hidup. industry bahan kimia. dan khrom (Cr). 2.Sebagai contoh adalah unsure logam besi (Fe). dan nikel (Ni). keracunan atas makhluk hidup. di antaranya adalah unsur-unsur logam. maupun KIMIA LINGKUNGAN 6 .2 Sumber Pencemaran Sumber pencemaran logam berat adalah masuknya material pencemar seperti partikel kimia. yang bisa merusak lingkungan khususnya perairan. kadmium (Cd). Tetapi bila kebutuhan dalam jumlah yang sangat kecil itutidak terpenuhi. makaakan berubah fungsi menjadi zat racun bagi tubuh. limbah industri. Namun demikian. Ada yang berdampak langsung. pertambangan (emas). timah (Pb).

Aspek-aspek pencemaranair yaitu terdiri dari aspek kimia-fisika pencemran air dan aspek biokimiapencemaran. Tingginya konsentrasi bahan tersebut menyebabkan pertumbuhantumbuhan air ini akan meningkat dan akan mendominasi perairan. apakah airtersebut termasuk air yang tercemar ataukah tidak tercemar. serta penyakit.3 Indikator Pencemaran Logam Berat Dalam Air Aspek-Aspek Pencemaran Air ada beberapa aspek sebagai pengukuran tingkat pencemaran air. suatu unsur kimiametalik yang memiliki kepadatan yang relatif tinggi dan bersifat racun atau beracunpada konsentrasi rendah. Contoh logam berat yang sering mencemari adalah air raksa. 2.Limbah kimia yang bersifat toxic (racun) yang masuk ke perairan laut akanmenimbulkan efek yang sangat berbahaya. seluruh penyusun rantai makanan termasuk manusia. Kelompok limbah kimia ini terbagi dua. Sumber dari limbah ini umumnya berasal dari sisa pupuk pertanian yang terhanyut kedalam perairan. Terdapat pula logam berat. Racun ini juga diketahui terakumulasi dalam dasar perairan yang berlumpur. ketika pestisida masuk ke dalam ekosistemlaut. Adapun aspek kimia-fisika pencemaran air itu adalah sebagai berikut : KIMIA LINGKUNGAN 7 . dioksin dan fenol. Dalam jaring makanan. Senyawa kimia ini dapat menyebabkan eutrofikasi. Racun semacam itu dapat terakumulasi dalam jaringan berbagai jenis organisme laut yang dikenal dengan istilah bioakumulasi. sehinggamenganggu organisme lain bahkan bisa mematikan. yang dapat berbahaya bagihewan laut. timah. juga dari limbah rumah tangga berupa detergent yang banyak mengandung fosfor. dan fosfor.pertama kelompok racun yang sifatnya cenderung masuk terus menerus sepertipestisida. pestisida ini dapat menyebabkan mutasi.Bahan kimia anorganik lain yang bisa berbahaya bagi ekosistem laut adalah nitrogen. Bahan-bahan ini dapat menyebabkan mutasi keturunan dari organisme yang tercemar serta penyakit dan kematian secara massal seperti yang terjadi pada kasus yang terjadi di Teluk Minamata. arsenik dan cadmium. furan. nikel. karena senyawa ini merupakan nutrien bagi tumbuhan air seperti alga dan phytoplankton. mereka segera diserap ke dalam jaring makanan di laut.tidak langsung.

yang mengakibatkan pembiasan cahaya ke dalam air. Warna air dibedakan menjadi dua macam yaitu warna sejati (akibat bahan-bahan terlarut) dan air semu (akibat bahan terlarut. Kekeruhan menunjukan sifat toptis air.a Nilai pH.5.03% karbondioksida)bersentuhan dengna permukaan air pada tekanan standar maka kelarytankarbondioksida terhadap perubahan suhu. Jada kadar oksigenterlarut dapat dijadikan ukuran untuk menetukan kualitas air. baik tumbuhan maupun hewan.Mengganggu kehidupan ikan dan hewan air alinya. Naiknyasuhu air akan menimbulkan akibat sebagai berikut :Menurunya jumlah oksigen terlarut dalam air. bahan tersuspensi diantaranya yang bersifat koloid. c Oksigen Terlarut untuk mempertahankan hidupnya. yan merupakan salah satu sifat air. e Warna dan kekeruhan warna air yang tidak normaal biasanya merupakan indikasi terjadinya pencemaran air. Keasaman dan Alkhalinitas. Air akan bersifat asam atau basa tergantung besar kecilnya pH. Air pendingin tersebut setelah digunakan akan mendapatkan panas daribahan yang didinginkan. makhluk yang tinggal di dalam air.Meningkatkan kecepatan reaksi kimia. Kekurahan ini terjadi karena adanya bahan terapung. Jika udara (yang mengandung 0. dan terurainya zat tertentu. sedangkan air yangmempunyai pH di atas pH normal bersifat basa. Air limbah dan bahan buanganindustri akan mengubah pH air yang akhirnya akan mengganggu kehidupan biotaakuatik. ayitu sungaiatau sumber air lainnya.Adanya ion kalsium (Ca) dan magnesium (Mg) di dalam air akan mengakibatkansifat kesadahan air tersebut.Air normal yang memenuhi syarat untuk suatu kehidupan mempunyai pHsekitar 6. b SuhuAir sering digunakan sebagai medium pendingin dalam berbagai prosesindustri.Alkalinitas berkaitan dengan kesadahan air. ikan dan hewan air lainnyamungkin akan mati. kemudian dikembalikan ke tempat asalnya. d Karbondioksida Dalam AirKepekaan oksigen terlarut dalam air bergantung kepda kepekaankarbondioksida yang ada.Jika bata suhu yang mematikan terlampaui. bergantung kepada oksigen terlarut. seperti bahan organik.5– 7. maka air tersebut bersifat asam.Bila pH di bawah pH normal. Kekeruhan membatasi masukannya cahaya ke dalam air. jasad KIMIA LINGKUNGAN 8 . Air buangan lebih tingi dari pada air asalnya.

. yaitu :. Sebagian larut dalam air. semakin tinggi daya hantar listriknya dansemakin banyak pula padatannya.4 Proses Pencemaran Logam Berat Dalam Air Air laut adalah suatu komponen yang berinteraksi dengan lingkungan daratan. dan sebagian masuk ke dalam jaringan tubuh organismelaut (termasuk fitoplankton.Keracunan nitrit akan mengakibatkan wajah membiru dan kematian. lumpur tanah liat dan benda yang terapung dansangat halus sekali. Limbah tersebut yang mengandung polutan kemudian masuk ke dalam ekosistem perairanpantai dan laut. Pencegahanpencemaran posfor dapat dilakukan dengan melarang penggunaan ditergen yangmengandung posfat.Padatan terendap (sedimen). cumi-cumi. udang. Kemudian. kotoran hewan dan sisa tumbuhan dan hewan yang mati. f Padatan pada dasarnya air yang tercemar selalu mengandung padatan yang dapatdibedakan menjadi empat kelompok berdasarkan besar partikelnya dan sifatsfatlainnya. sisapertanian. ikan. g PosforPosfor memasuki air melalui berbagai jalan yaitu kotoran. kimia). kerang. Selain itu ada juga yang disebut dengan aspek biokimia pencemaran air. 2. Juga dengan mewajibkan pengolahan limbah industridengan memberikann air kapur atau aluminium sulfat agar posfatnyamengendapa dan dapat dibuang. di mana buangan limbah dari daratan akan bermuara ke laut. KIMIA LINGKUNGAN 9 . b.renik.Padatan terlarut total.Padatan tersuspensi dan koloid. limbah.Minyak dan Lemak g. Semakin keruh air. terutama kelarutannya. sebagian tenggelam ke dasar danterkonsentrasi ke sedimen. NitratJika kandungan nitrat tersebut akan berubah menjadi nitrit di perut. polutan tersebut yang masuk ke air diserap Uji BOD (Biochemical Oxygen Demand Test = uji kebutuhan Uji COD (Chemical Oxygen Demand = uji kebutuhan oksigen oksigenbiokimia). Selain itu air laut juga sebagai tempat penerimaan polutan (bahan cemar) yang jatuh dari atmosfir. rumput laut dan lain-lain).Aspek ini menggunakan dua pengujian yang berhubungan dengan kandunganoksigen dalam air yaitu : a.

5 Beberapa logam berat yang berbahaya a. Fitoplankton danzooplankton dimakan oleh ikan-ikan planktivores (pemakan plankton) sebagai tropik level kedua.Kerang juga mengandung logam berat yang tinggi karena cara makannya denganmenyaring air masuk ke dalam insangnya setiap saat dan fitoplankton ikut tertelan. 2. Bahkan tidak sedikit yang menyebabkan kematian. Ikan planktivores dimangsa oleh ikan karnivores (pemakan ikan atauhewan) sebagai tropik level ketiga. Mercury KIMIA LINGKUNGAN 10 .Polutan ikut masuk ke dalam tubuhnya dan terakumulasi terus-menerus dan bahkan bisa melebihi konsentrasi yang di air. Bila polutan ini berada dalam jaringan tubuh organisme laut tersebut dalam konsentrasi yang tinggi. Karena kesehatan manusia sangat dipengaruhi oleh makanan yang dimakan.Fitoplankton adalah produsen dan sebagai tropik level pertama dalamrantai makanan. Logam berat telah lama dikenal sebagai suatu elemen yang mempunyaidaya racun yang sangat potensil dan memiliki kemampuan terakumulasi dalam organtubuh manusia. Polutan tersebut mengikuti rantai makanan mulai dari fitoplankton sampai ikan predator dan pada akhirnya sampai ke manusia. Kemudian fitoplankton dimakan zooplankton. WHO (World Health Organization) atau Organisasi Kesehatan Duniadan FAO (Food Agriculture Organization) atau Organisasi Pangan Dunia merekomendasikan untuk tidak mengonsumsi makanan laut (seafood) yang tercemarlogam berat.Ikan predator dan ikan yang berumur panjang mengandungkonsentrasi polutan dalam tubuhnya paling tinggi di antara seluruh organisme laut. selanjutnya dimangsa oleh ikan predator sebagaitropik level tertinggi.langsung olehfitoplankton. Konsentrasi polutan dalam tubuh zooplankton lebih tinggi dibanding dalam tubuh fitoplankton karenazooplankton memangsa fitoplankton sebanyakbanyaknya. Demikian juga makanan laut (seafood) yangberasal dari pantai dan laut yang tercemar juga mengandung bahan polutan yangtinggi. Makanan yang berasal dari daerah tercemarkemungkinan besar juga tercemar. kemudian dijadikan sebagai bahan makanan maka akan berbahaya bagi kesehatan manusia. Salah satu polutan yang paling berbahaya bagi kesehatan manusia adalahlogam berat.

udang dan makanan laut lainnyayang mengandung mercury. dan lain-lain. produk susu.Terjadinya pencemaran mercury di perairan laut lebih banyak disebabkan oleh faktormanusia dibanding faktor alam.sebagai katalisator. Pencemaran mercury secara besar-besarandisebabkan karena limbah yang dibuang oleh manusia. crustacea dan ikan yang merupakankonsumsi sehari-hari bagi masyarakat Minamata.Air Raksa atau Mercury (Hg) adalah salah satu logam berat dalam bentuk cair. Dewasa ini mercury telah digunakan secara meluas dalamproduk elektronik. Kemudian mencapai konsentrasiyang tinggi pada daging kerang-kerangan. pembuatan gigi palsu. Pada saat itu banyak orang mengalami penyakityang mematikan akibat mengonsumsi ikan. lumpuh. Meskipun pencemaran mercury dapat terjadi secaraalami tetapi kadarnya sangat kecil. Penggunaan mercury sebagai elektroda dalampembuatan soda api dalam industri makanan seperti minyak goreng.kertas tima. Methyl mercury ini masuk ke dalam tubuh organisme laut baik secaralangsung dari air maupun mengikuti rantai makanan. Konsentrasi atau kandunganmercury dalam rambut beberapa pasien di rumah sakit Minamata mencapai lebih 500ppm. pembungkus makanan juga kadang mencemari makanan tersebut. Kasus minamata yang terjadi dari tahun 1953 sampai1975 telah menyebabkan ribuan orang meninggal dunia akibat pencemaran mercurydi Teluk Minamata Jepang. Industri Kimia Chisso menggunakan mercury khlorida(HgCl2) sebagai katalisator dalam memproduksi acetaldehyde sintesis di mana setiap memproduksi satu ton acetaldehyde menghasilkan limbah antara 30-100 gr mercurydalam bentuk methyl mercury (CH3Hg) yang dibuang ke laut Teluk Minamata. Masyarakat Minamata yang mengonsumsi makanan laut yang tercemar tersebutdalam jumlah banyak telah terserang penyakit syaraf. kerang.Pencemaran logam mercury (Hg) mulai mendapat perhatian sejak munculnya kasusminamata di Jepang pada tahun 1953. industri pembuatan cat. kehilangan inderaperasa dan bahkan banyak yang meninggal dunia. KIMIA LINGKUNGAN 11 . peleburan emas. Manusia telah menggunakanmercury oksida (HgO) dan mercury sulfida (HgS) sebagai zat pewarna dan bahankosmetik sejak jaman dulu.

b. peleburan logam. serta merusak kelenjar reproduksi.0 mg/kg. bahan bakar. Selanjutnya Pb tersebut jatuh ke laut mengikuti air KIMIA LINGKUNGAN 12 . ginjal. baterai. batubaramengandung Cd sampai 2 ppm. Sementara batasmaksimum konsentrasi atau kandungan Cd pada daging makanan laut yang layak bagikesehatan yang direkomendasikan FAO dan WHO adalah lebih kecil dari 0.Bahan bakar dan minyak pelumas mengandung Cd sampai 0.95 mg/kg. Konsentrasi Cd pada air laut yang tidak tercemar adalah kurang dari 1 mg/l ataukurang dari 1 mg/kg sedimen laut. Sebaliknya Dirjen Pengawasan Obat dan Makanan merekomendasikan tidak lebihdari 2.5 ppm. Dewasa ini pelepasan Pb ke atmosfir meningkat tajam akibatpembakaran minyak dan gas bumi yang turut menyumbang pembuangan Pb keatmosfir. Keracunan kronis yang disebabkan oleh Cd adalah kerusakan sistem fisiologis tubuh seperti pada pernapasan. sirkulasi darah. anemia dan mempengaruhi anggotatubuh lainnya. Pencemaran kadmium pada air minum di Jepang menyebabkan penyakit “itai”. c Timbal Timbal (Pb) juga salah satu logam berat yang mempunyai daya toksitas yangtinggi terhadap manusia karena dapat merusak perkembangan otak pada anak-anak. Pb dapat diakumulasi langsung dari air dan dari sedimen olehorganisme laut. minyak pelumas. jantung dan kerapuhan tulang. Kadmium Kadmium (Cd) menjadi populer sebagai logam berat yang berbahaya setelahtimbulnya pencemaran sungai di wilayah Kumamoto Jepang yang menyebabkankeracunan pada manusia.01.penciuman.Konsentrasi Cd maksimum dalam air minum yangdiperbolehkan oleh Depkes RI dan WHO adalah 0. pewarnaan. Limbah cair dari industri dan pembuangan minyak pelumasbekas yang mengandung Cd masuk ke dalam perairan laut serta sisa-sisa pembakaranbahan bakar yang terlepas ke atmosfir dan selanjutnya jatuh masuk ke laut. Kadmium telah digunakan secara meluas pada berbagai industri antara lainpelapisan logam. pupuk superpospat juga mengandung Cd bahkan adayang sampai 170 ppm.menyebabkan penyumbatan sel-sel darah merah.mg/l. Gejalanya ditandai dengan ketidak normalan tulangdan beberapa organ tubuh menjadi mati.

liver cirrhosis (jaringan hati berubah menjadi jaringan ikat dan ascites (tertimbunnya cairan dalam ruang perut). menyebabkan timbulnya laryngitis (infeksi renal damage (terjadi bronchitis (infeksi bronkus) dan dapat pula menyebabkan kanker paru. infeksi kulit (dermatitis) dan mempunyai efek pencetus kanker (carcinogenic). akan ginjal. dapat berakibat buruk terhadap mata.hujan. ichterus (penyakit kuning). d Arsen Intoksikasi tubuh manusia terhadap arsenik (As). oedema paru dan penyakit pembuluh darah perifer (varises. Pada pembuluh darah. sehingga dapat mengakibatkan penyakit arteriosclerosis (rusaknya pembuluh darah). terjadi penurunan daya KIMIA LINGKUNGAN 13 . Dengan kejadiantersebut maka banyak negara di dunia mengurangi tetraeil Pb pada minyak bumi dangas alam untuk mengurangi pencemaran Pb di atmosfir. Pada liver. Pada pernafasan. SGPT. berupa meningkatnya aktifitas enzim pada liver (enzim SGOT. Efek Arsenic terhadap mata adalah gangguan penglihatan dan kontraksi mata pada bagian perifer sehingga mengganggu daya pandang ( visual fields) mata. efek arsen terhadap fungsi reproduksi biasanya fatal dan dapat pula berupa cacat bayi waktu dilahirkan. Pada sistem immunologi. penebalan kulit (hiperkeratosis). kulit. logam berat Arsen dapat menganggu fungsi pembuluh darah. Pada kulit menyebabkan berwarna gelap (hiperpigmentasi). gamma GT). Pada darah. timbul seperti bubul (clavus). Arsen (As) akan menyebabkan kerusakan ginjal berupa ichemia and kerusakan jaringan). Pada sistem reproduksi. dan liver. lazim disebut effek malformasi. mempunyai efek yang signifikan pada paparan yang cukup lama (paparan kronis). darah . menyebabkan kegagalan fungsi sungsum tulang dan terjadinya pancytopenia (yaitu menurunnya jumlah sel darah perifer). portal hypertention (hipertensi oleh karena faktor pembuluh darah potal). penyakit burger). Pada saluran laryng).

g Flour Beriklim hangat konsentrasi fluor MenurutNpedoman WHO yang dikeluarkan tahun 1984. 2 ppm. Pada kulit (Skin effects). mual (nausea) dan muntah (vomiting). Gastrointestinal (saluran pencernaan) . akibat nya peka terhadap bahan karsinogen (pencetus kanker) dan infeksi virus. Karen adalam cuaca panas. kulit. tubuh kita mengeluarkan lebih banyak keringat sehingga perlu minum lebih banyak. berupa anker paru dan ulkus kronis/ perforasi pada septum nasal. e Kromium Keracunan tubuh manusia terhadap chromium (Cr). f Klor Kadar Cl yang berlebihan akan menyebabkan rasa asin dan korosif pada logam. berupa ulkus kronis pada permukaan kulit. konsentrasinya 1. dapat berakibat buruk terhadap saluran pernafa san. Pada Pada sistem sel. KIMIA LINGKUNGAN 14 . berupa penebalan oleh plag pada pembuluh aorta (Atherosclerotic aortic plaque). karenaitu konsentrasi dalam air minum yang dikonsumsi seharusnya ditentukan lebih rendah. Pada pembuluh darah (Vascular effects). Sedangkan pada ginjal (Kidney effects). efek terhadap sel mengakibatkan Arsen rusaknya mitochondria dalam inti sel menyebabkan turunnya energi sel dan sel dapat mati. kelainan berupa nekrosis tubulus ginjal. pembuluh darah dan ginjal. Mengapa perbedaan iklim mempengaruhi jumlah fluor yang sebaiknya dikonsumsi.tahan tubuh/ penurunan kekebalan. akan menyebabkan perasaan mual dan muntah. untuk wilayah yang optimal dalam airminum sebaiknya masih dibawah 1 mg/liter atau 1 ppm (parts per million). serta nyeri perut. Efek chromium (Cr) terhadap s istem saluran pernafasan ( Respiratory sistem effects). Sementara di wilayah yang iklimnya lebih dingin.

Kemudianterdapatefekkronis. infeltirasi. Ilmuwan FDA (Food and Drug Administration) melaporkan adanya korelasi kuat antara penurunan KIMIA LINGKUNGAN 15 . Studi yang dilakukan National Cancer Institute Toxicological Program menemukan bahwa fluorida bisa digolongkan sebagai karsinogen.5 ppm. Namun selama ini setidaknya dua belas pemenang Nobel di bidang kedokteran dan kimia telah memberi peringatan sehubungan risiko kesehatan yang ditimbulkannya.1 ppm kandungan fluor konsumsitiapsaat. April 20. tetapi memberi argument para pendukung pemakai fluorida. kematian massal –puluhanjuta orangkarenamen kanker. Fluorosis yang mengancam kesehatan inimemiliki efekakut dan kronis. Di India.000 kematian akibatkan kerkarena fluori daada tahun 1988.Efekakut yang ada terjadi padakonsumsi air minumdari air sumur yang belumdiuji di India Tengah. Dari berbagai uji toksisitas yang telah dilakukan banyak sekali fakta bahwa fluorida sangat membahayakan pengguna. Memberikan fluorida kepada anak-anak bukan saja tidak bermanfaat tetapi berbahaya. Penyakitretak panggul terjadi karena meminum air yang mengandungfluor yang mampu meningkatkan risiko retak panggulhingg adua kali lipat bagi pria dan wanaita lanjut usia hanyadengan 0. HUMO membuat tulisan tentang bahaya fluorida (Nurno Nr. Pada saat itu reaksinya cukup banyak. khususnya dari para dokter gigi yang meski tidak diragukan berniat baik. Fluorida sangat reaktif dan mampu menembus hinggake dalamtulangdan set tempat substansi terakumulasi. dan Alzheimer. namunti dak bersifat universal. yang banyakdijumpaikasus fluorosis. padatahun 1998 telah menetapkan bata satas yang diperbolehkanhanya 1 ppm. Memang permukaan gigi menjadi lebih keras. namun gigi itu sendiri menjadi lebih rapuh. kerusakan otak. KepalaKimiawan di National Cancer Institute AS. yaituretakpanggul.17/33059. memilikikadarfluortinggiyaitusekitar 38 ppm dan mengakibatkan deritaartritisparah. 1999).Berdasarkan pedoman WHO juga diketahui bahwa batas ataskan dungan fluor dalam air minum yang diperbolehkan adalah 1. Pada tahun 1999. melaporkan setidaknya 40.

mudah terbakar pada temperatur ruang. Bahkan kalau dapat setelah diolah tidak dibuang ke sungai melainkan dapat digunakan lagi untuk keperluan industri sendiri.Penumpukan logam-logam berat ini terjadi dalam tumbuh- KIMIA LINGKUNGAN 16 . 2.Jangka panjang.Pencemaran air yang telah terjadi secara alami misalnya adanya jumlahlogam-logam berat yang masuk dan menumpuk dalam tubuh manusia. menyebabkan naiknya tekanan darah dan terganggunyasistem syaraf.Larutan dari kadmium sangatberacun. pankreas. logam berat inidapat meracuni organ tubuh melalui pencernaan karena tubuh memakan tumbuh-tumbuhan yang mengandung logam berat meskipun diperlukan dalam jumlah kecil. Kelebihan kadar flourida pada air akan menyebakan kerusakan pada gigi ( carries gigi ). terakumulasi di hati. Jangka panjang. ginjal dan tiroid. agar bila terpaksa harus dibuang ke sungai tidak menyebabkan terjadinya pencemaran air.dicurigai dapat menyebabkan hipertensi. Pada Manusia bahaya yang Dapat Ditimbulkan oleh Logam Berat di dalam Tubuh Manusia : 1 Barium (Ba): Dalam bentuk serbuk. kemudian diolah. Cadmium (Cd): Dalam bentuk serbuk mudah terbakar. Beracun jika terhirupdari udara atau uap.TerakhirpenelitianVarnier J A yang dilaporkandalam Wall Street Journal menyebutkanbahwafluoridamenyebabkankerusakanotakdanmalfungsikoordinasitu buhsetelahtermagnifikasi.dialirkan ke sungai atau selokan hendaknya dikumpulkan di suatu tempat yangdisediakan.tingkatfertiitaswanitadalamrentangusis 10-49 tahundenganpeningkatan level fluorida.Dapat menyebabkan kanker.6 Menaggulangi Pencemaran Logam Berat Pengolahan limbah industri sebelum dibuang ke tempat pembuangan.

ini kembali pada soalkoordinasi unsur-unsur masyarakat terkait. .Usaha-usaha tersebut dapatdilakukan. Khususnya untuk kasus PETI(Penambangan Emas Tanpa Izin). .Pengendalian/penanggulangan pencemaran air di Indonesia telah diaturmelalui Peraturan Pemerintah Nomor 82 tahun 2001 tentang Pengelolaan Kualitas danPengendalian Pencemaran Air. . .Salah satu upaya serius yang telah dilakukan Pemerintah dalam pengendalianpencemaran air adalah melalui Program Kali Bersih (PROKASIH) KIMIA LINGKUNGAN 17 . maka limbah industri hendaknya dilakukanpengolahan sebelum dibuang ke lingkungan. Menempatkan daerah industri atau pabrik jauh dari daerah perumahan ataupemukiman Pembuangan limbah industri diatur sehingga tidak mencermari lingkungan atauekosistem Pengawasan terhadap penggunaan jenis jenis pestisida dan zat zat kimia lainyang dapat menimbulkan pencemaran Memperluas gerakan penghijauan Tindakan tegas terhadap perilaku pencemaran lingkungan Memberikan kesadaran terhadap masyaratkat tentang arti lingkungan hidupsehingga manusia lebih lebih mencintai lingkungan hidupnya Melakukan intensifikasi pertanianPencegahan adalah lebih baik dari pengobatan. Artinya. Gubernur. kebijakan publik.tumbuhan karena terkontaminasi oleh limbah industri.Peran pemerintah untuk melakukan AMDAL terhadap suatu perusahaan yangmenggunakan air raksa harus dilakukan dengan benar dan sanksi yang tegas apabilaAMDALnya membahayakan kesehatan manusia dan lingkungan.Proses pencegahan terjadinya pencemaran lebih baik daripada prosespenanggulangan terhadap pencemaran yang telah terjadi. Bupati. Untuk menanggulangi agar tidak terjadipenumpukan logam-logam berat. Hal ini bisa dilakukan dengan memberikan penyuluhan-penyuluhan padamasyarakat penambang. diantaranya melalui menjaga air tanah agar tetap bersih misalnya : . danDepartemen Pertambangan sangat menentukan dalam mengurangi pencemaransungai. . . .

2.Pada prinsipnya ada 2 (dua) usaha untuk menanggulangi pencemaran. sehingga tidak meracuni mayarakat.196.2000 ) KIMIA LINGKUNGAN 18 . menunjukkan kualitas air sudah tidak lagimemenuhi syarat bagi perikanan.20 untuk Pb sampai 65. dan pariwisata ( berenang dan menyelam). bahwa Teluk Jakarta menerima air dari 13 sungai. Patut dicatatdisini . mengatur danmengawasi segala macam bentuk kegiatan industri dan teknologi sehingga tidak terjadi pencemaran. Sekalipun demikian. danHg dalam konsentrasi yang jauh lebih besar dari yang diperolehkan. Pb. biota laut. standar yang berlaku telah di lampaui sebanyak 45% sampai 91 % ( Djuangsih. Penanggulangan secara nonteknis yaitu suatu usaha untuk mengurangi pencemaran lingkungan dengan caramenciptakan peraturan perundangan yang dapat merencanakan. Penelitian lain di Pantai UtaraTangerang yang menerima air 12 sungai. Sedangkan penanggulangan secara teknis bersumber pada perlakuan industriterhadap perlakuan buangannya. misalnya dengan mengubah proses. 2000 ). air dan tanah seagian besar akantersalurkan air dan masuk ke dalam laut. muali dari yang terkecil11. Peraturan perundangan ini hendaknya dapat memberikangambaran secara jelas tentang kegiatan industri yang akan dilaksanakan. Factor biokonsentrasi ( BCF ) yangdiperkirakan untuk logamlogam tersebut sangat bervariasi. mengelolalimbah atau menambah alat bantu yang dapat mengurangi pencemaran.Semua pencemar. Cu.50 untuk Zn ( Kunaefi dan Herto.7 Contoh Kasus Pencemaran laut. Penelitian di Kepulauan Seribu menunjukkanbahwa konsentrasi beberapa logam berat sudah melampaui standar yang berlaku. 6 jenis ikan yang biasa di makan turis. yaitupenanggulangan secara non-teknis dan secara teknis. belumada peraturan yang menentukan bagian laut mana saja yang boleh dieksploitasiproduknya. ternyata juaga mengandung Cd. misalnyameliputi AMDAL. Hal inidiperkirakan akibat dari proses biokonsentrasi. baik berasl udara. Zn. pengaturan dan pengawasan kegiatan dan menanamkan perilakudisiplin.

Dampak KasusKepulauan Seribu menunjukkan bahwa konsentrasi beberapa logam beratsudah melampaui standar yang berlaku.2. Dinyatakan pula defisiensi Fe dan Pb akan menyebabkan gangguan ekskresi Pb dari tulang. konsentrasi beberapa logam berat sudah melampauistandar yang berlaku dan sebagian besar tersalurkan air ke dalam laut. Hal ini disebabkan Pb dapat menghambat kerja enzim yang diperlukan untuk pembentukan hemoglobin (Dewi dan Saeni. Pb.Sehingga kualitas air sudah tidak lagi memenuhi syarat bagi perikanan. Ada beberapa faktor yang mempengaruhi aktivitas keracunan setiap jenis logam berat. Pengendalian dari kasusUntuk logam-logam berat seperti Hg. penyerapan Pb akan meningkat. Hal ini diperkirakan akibat dari prosesbiokonsentrasi. ukuran partikel dan beberapa sifat kimia dan fisika lainnya.8 Pembahasan Kasus Analisa Kasus Di Kepulauan Seribu. Cu. dan pariwisata ( berenang dan menyelam ). kehamilan dan umur. 2010). biotalaut. Zn. dan bila tubuh kekurangan Ca dan Fe. dan Hg dalam konsentrasi yang jauhlebih besar dari yang diperolehkan. standar yang berlaku telah dilampaui. khususnya Pb adalah nutrisi. Kurang gizi akan meningkatkan kadar Pb yang bebas dalam darah. sehingga meningkatnya kadaar pada jaringan lunak dan juga menyebabkan hemotoksisitas. a Contoh Kasus Timbal Faktor-faktor yang dapat mempengaruhi kerentanan tubuh terhadap logam berat. 6 jenis ikan yang biasa di makan turis. Dalam Faktor yang Mempengaruhi Toksisitas Timbal KIMIA LINGKUNGAN 19 . Dan untuk masyarakat yang mengalami keracunan seharusnya ditindak lanjuti lebih dini. daya kelarutannya dalam cairan. Zn. antara lain: bentuk senyawa dari logam berat itu. Pb. ternyata juaga mengandung Cd. Kadar Ca dan Fe yang tinggi dalam makanan akan menurunkan penyerapan Pb. Cd. dan lain-lain dalampemakaiannya diperhatikan menurut standar yang berlaku dan limbah yangdihasilkan diolah melalui pengolahan sehingga tidak mencemari lingkungankhususnya air. Cu.

beberapa kasus. Hal ini terjadi karena adanya tanda .Basofilik stipling reteni dari DNA ribosoma dalam sitoplasma eritrosit sehingga mengganggu sintesis protein.Timbal menghambat enzim sulfidril untuk mengikat delta-amnolevulinik acid (ALA) menjadi porprobilinogen.tanda keracunan Pb. salah satu diantaranya adalah menghambat sintesis Hb dalam sumsum tulang. ras. Sifat fisik Sifat kimia Cara masuk kedalam tubuh Faktor individu (usia. Faktor yang mempengaruhi toksisitas bahan kimia pada manusia adalah: a b c d Tempat Kerja Didalam aliran darah. kesehatan. serta protoforvirin IX menjadi Hb. status gizi. Ditemukannya sel stipel basofil (basophilic stipping) merupakan gejala dari adanya gangguan metabolik dari pembentukan Hb. logam berat biasanya menyerang jaringan syaraf atau menghambat aktivitas enzimatik melalui reaksi biokimia. sehingga organ-organ ini harus selalu dimonitor untuk mengetahui derajat keracunan terhadap logam berat (Hammond. lebih sering logam berat ini merusak organ-organ detoksikasi dan ekskresi. 1979 dalam Darmono 1983). Misalnya merokok dan minum minuan keras) KIMIA LINGKUNGAN 20 . jenis kelamin. Kompensasi penurunan sintesis Hb karena terhambat timbal adalah peningkatan produksi erithrofoesis. Timbal mengganggu sistem sintesis Hb dengan cara menghambat konversidelta aminolevulinik acid (delta ALAD) menjadi forfobilinogen dan menghambatkorporasi dari Fe ke protoporfirin IX untuk membentuk Hb. Hal ini menyebabkan anemia dan adanya basofilik stipling dari eritrosit yang merupakan cirri khas keracunan timbale. sebagian besar timbal diserap dalam bentuk ikatan dengan eritrosit.Tetapi. yaitu hati dan ginjal. faktor genetic dan kebiasaan lain.Timbale dapat mengganggu enzim oksidase dan akibatnya menghambat sistem metabolism sel. Sel darah merah muda (retikulosit) dan sel stipel kemudian dibebaskan. dengan cara menghambatenzim delta aminolevulinik acid dehidratase (delta ALAD) dan feroketalase yangakhirnya meningkatkan ekskresi koproporfirin dalam urin dan delta ALA sertamensintesis Hb.

Paparan inhalasi umumnya terjadi pada kawasan industri. akhirnya poliribosoma ireguler pada agregat RNA membentuk sel stipel (Sudarwin.Partikel yang mudah larut menyebabkan absorbsi di paru berlangsung cepat dan luas. 1995).Sel darah merah gagal untuk menjadi dewasa dan sel tersebut menyisakan organel yang biasanya menghilang pada proses kedewasaan sel. Semua bahan pangan mengandung timbal dalam konsentasi yang kecil dan dalam proses mempersiapkan makanan mungkin timbal akan bertambah (Fardiaz. KIMIA LINGKUNGAN 21 . Berikut ini salah satu mekanisme intake manusia terhadap logam berat termasuk Timbal/Timah hitam (Pb): Penyerapan Timbal dapat melalui inhalasi debu timbal atau benda berbahan timbal lainnya. tetapi dapat juga melalui pernafasan atau kulit dari udara yang terdcemar timbal. 2008). Absorbsi Timbal dalam Tubuh Timbal masuk ke dalam tubuh terutama melalui saluran pencernaan dari makanan dan minuman. Paparan pada daerah non-industri terjadi terutama melalui pencernaan.

Keracunan zat – zat kimia melaui saluran pernafasan (inhalasi) adalah yang terpenting dan yang saling sering terjadi ditempat – tempat kerja. Zat. pengelasan dan pembakaran potongan logam yang permukaannya dilapisi cat yang berbahan dasar timbal menyebabkan intoksikasi timbal simptomatik dalam satu hari sampai beberapa minggu. uap-uap atau mists tersebut. OSHA menyatakan level paparan yang diizinkan (PEL) untuk debu atau asap timbal inorganik adalah 50 mcg/m3 selama 8 jam. Partikel yang diabsorbsi secara inhalasi dengan ukuran <0. Gas –gas. Sedangkan gas tidak mudah larut dalam air akan mengadakan iritasi pada saluran pernafasan bagian bawah. uap dan mist. b Absorbsi Melaui Saluran Pencernaan Adapun proses biotransformasi dengan jalur pencernaan adalah dipengaruhi oleh faktor dibawah ini : KIMIA LINGKUNGAN 22 . Gas – gas iritan yang mudah larut dalam airakan menyebabkan iritasi ini dapat timbul segera setelah inhalasi gas – gas tersebut. a Absorbsi Melalui Saluran Pernafasan. uap-uap dan mists yang mudah larut dalam lemak dapat diserap melalui kapiler – kapiler pembuluh darah yang terdapat disekitar alveoli dan selanjutnya zat – zat tersebut dari aliran darah akan menuju ke binding sites yakni jaringan lemak (Fat Depots) yang mempunyai afinitas khusus terhadap gas-gas.terutama pada anak-anak yang mengabsorbsi 45-50% timbal larut dibandingkan pada orang dewasa yang hanya sekitar 10-15%.zat kimia yang terhirup dan menyebabkan keracunan dapat digolongkan menjadi kelompok gas. uap – uap dan mist (kabut) setelah diserap oleh paru – paru akan masuk kedalam aliran darah dan kemudian didistribusikan ke bagian – bagian / organ –organ tubuh lainnya. dan iritasi biasanya timbul beberapa jam setelah pemaparan (peradangan paru yang akut dan sembab paru). Gas – gas. saluran pencernaan dan kulit. yang terjadi adalah karena absorbsi saluran pernafasan lebih baik daripada absorsi saluran pencernaan.5 1>2500 mcg/m3) ditemui selama peledakan. Level yang berbahaya bagi kesehatan dan mengancam jiwa(IDHL) adalah 100 mg/m3. Absorsbi zat– zat kimia oleh tubuh dapat melalui saluran pernapasan. serta zat padat.

. Kadmium (Cd). Timbal/lead (Pb) dan Zink (Zn) dalam tubuh manusia adalah sebagai berikut: Proses Biotransformasi Logam Berat (Pb) Logam berat masuk ke tubuh manusia melewati rantai pangan pendek (hewan . Batas toksik dan anjuran/batas aman “intake” logam berat Arsen Apabila terjadi kontak dengan bahan kimiayang banyak terjadi adalah: (As).manusia) atau lewat rantai pangan panjang (tanaman – hewan. unsur logam berat juga dapat masuk ke dalam tubuh melalui pernafasan dan kulit.1995). . dan [proses detoksikan menyebabkan absorbsi zat – zat kimia kimia ke dalam darah menjadi kurang efisien dan selektif . . Absorbsi Zat Kimia Melalui Kulit Kulit (lemak dan keringat) berfungsi sebagai barier Zat kimia akan bereaksi dengan permukaan kulit dan menyebabkan iritasi primer (asam dan basa kuat serts pelarut organik). Makanan dan cairan yang terdapat dalam saluran pencernaan dapat mengencerkan toksin dan membentuk kompleks zat kimia yang mudah larut air c . . Pengosongan lambung mampu mengurangi absorbsi senyawa kimia Peristaltik usus yang meningkat akan menghambat absorbsi zat kimia melalui usus Getah lambung dan pankreas mampu menghidrolisis dan mereduksi zat – zat kimia berbahaya. Zat kimia akan menembus kulit dan menyebabkan sensitasi pada kulit Zat kimia akan menembus kulit dan kemudia masuk kedalam aliran darah dan selanjutnya akan menimbulkan efek sistemik. Disamping melalui mulut dari makanan dan minuman. ..manusia) yang disebut pencemaran dakhil(Notohadiprawira. Logam berat KIMIA LINGKUNGAN 23 .

yang kemudian berakhir dengan kematian (Bartic dan Piskoc. sehingga dengan terkaitnya logam berat pada gugus ini. Gugus ini banyak terdapat dalam enzim. cat (sebagai warnanya). Biotransformasi umumnya menghasilkan metabolit yang kurang toksik. dalam pestisida. dan tidak mudah larut lemak.Hidrolisis dan Konjugasi. Tujuan pereaktivan senyawa toksik adalah dengan KIMIA LINGKUNGAN 24 . Proses Biotransformasi adalah proses transpormasi metabolik dimana zat kimia dirubah menjadi zat derifat lain (Metabolit) dalam tubuh manusia. Reduksi. sehingga hewan akan mengalami sakit perut (kolik) yang hebat. Racun timah hitam ini biasanya mempengaruhi sistem syaraf. anemia. dan rambut. konvulsi dan diarrhea. dalam penyepuhan. dan yang paling banyak ditambahkan pada bensin.. Keracunan timah hitam sering terjadi pada hewan ruminansia yang merumput di daerah tercemar (Humphreys. dan memiliki kepolaran yang tinggi sehingga mudah di ekskresikan oleh tubuh.mempunyai afinitas yang tinggi terhadap senyawa – senyawa sulfida. Adanya kontaminasi timbal dalam tubuh dapat diketahui melalui pengukuran kadar timbal dalam darah. 1980). Proses ini umumnya menyebabkan terbentuknya metabolit yang mudah larut air. ginjal dan . logam berat dapat menghambat kerja enzim tertentu. Fase tersebut dikenal dengan fase pertama dari biotransformasi. batrei. Selain itu jufga adanya fase roaksi oksidatif yang bertujuan untuk menambaha kereaktivan senyawa toksik. seperti sulfihidril (-SH) dan disulfida (-S-S)(Petruci. udara. dan air. Transformasi metabolik dapat dibagi menjadi emapat kategori diantaranya Oksidasi. Fase pertama adalah meningkatkan polaritas senyawa toksik sehingga kelarutannya pada air akan meningkat. Laidler (1991) menyatakan didalam bensin timbal ditambahkan dalam bentuk timbal tetra etil (TEL) dengan rumus molekul (C2H5)4-Pb atau dalam bentuk timbal tetra metil dengan rumus molekul (CH3)4-Pb. kebutaan. banyak digunakan dalam industri kabel. pembentuk darah. anoreksia. Selain dari makanan.1992). Timbal disebut juga sebagai timah hitam. gigi. 1981). 1991). timbal dalam rambut dapat berasal dari cat rambut yang mengandung timbal asetat dan dapat berasal dari debu (Cohen dan Ros.

gizi. logam ini mampu menggantikan keberadaan ion Ca2+ (kalsium) yang terdapat pada jaringan tulang. Pewarna sintetik umumya sulit umtuk dilakukan proses metabolit yang menjadikannya kurang toksik. Selain itu juga apabila akumulasi pada tubuh semakin meningkat maka seberapa besar kemampuan tubuh dalam mengubah tingkat toksisitasnya masih kurang. Adapun faktor – faktor yang mempengaruhi proses biotransformasi adalah : status kesehatan.mempermudah keterikatannya dengan senyawa anti oksidan yang mampu meningkatkan ROX. ginjal. Disamping itu pada wanita hamil logam Pb dapat dapat melewati plasenta dan kemudian akan ikut masuk dalam sistem peredaran darah janin dan selanjutnya setelah bayi lahir Pb akan dikeluarkan bersama air susu. Pada jaringan atau organ tubuh logam Pb akan terakumulasi pada tulang. Kebanyakan dari reaksi – reaksi ini memerlukan enzim – enzim mikrosomal dan juga oksidase – oksidase yang terdapat dalam sitoplasma dan mitokondria. Peranan Reduksi dalam biotransformasi umumnya adalah kurang begitu penting. Meskipun jumlah Pb yang diserap oleh tubuh hanya sedikit ternyata logam Pb ini sangat berbahaya. merupakan satu – satunya reaksi biotransformasi yang terjadi di dalam tubuh. Pada reaksi konjugasi grup – grup polar akan di tambahkan pada hasil reaksi pada fase satu. Fase kedua adalah proses konjugasi. sulfur. Oksidasi merupakan reaksi biotransformasi yang paling penting. Salah satu storage depot yang penting adalah jaringan lemak (Adipose Tissue).. dan lain. Karena dalam bentuk ion Pb2+. Hal itu disebabkan senyawa- KIMIA LINGKUNGAN 25 . usia. Pada kasus timah hitam (Pb) dalam tubuh akan ditimbun dalam tulang tetapi manifestasi efek toksiknya akan terlihat pada jaringan – jaringan lunak (syaraf. melalui proses Dehidrogenasi. nitrogen. Terdapat dua macam reaksi oksidasi yaitu penambahan oksigen secara langsung pada unsur – unsur carbon. Deposit Organ dan Efek Pb terhadap Kesehatan Penimbunan zat-zat kimia (Chemical Storage) dalam jaringan/organ tubuh dapat terjadi di jaringan atau organ dimana efek zat – zat kimia akan terlihat.lain).

sel tubulusatropi. Dapat pula menimbulkan anemia dan bagi wanita hamil yang terpajan timbal akan mengenai anak yang disusuinya dan terakumulasi dalam ASI.Pb organik diabsorbsi terutama melalui saluran pencernaan dan pernafasan dan merupakan sumber Pb utama di dalam tubuh. Kira-kira 5-10 % dari jumlah yang tertelan akan diabsorbsi melalui saluran pencernaan. fibrosis dan KIMIA LINGKUNGAN 26 . Dampak dari timbal sendiri sangat mengerikan bagi manusia. stupor dan coma. Paparan bahan tercemar Pb dapat menyebabkan gangguanpada organ sebagai berikut : . utamanya bagi anak-anak. seperti ginjal. penurunan fungsi pendengaran.Komponen Pb organik misalnya tetraethil Pb segara dapat terabsorbsi oleh tubuh melalui kulit dan membran mukosa. nephropati irreversible. kemampuan belajar. sclerosis va skuler. . Pb sebagai gas buang kendaraan bermotor dapat membahayakan kesehatan dan merusak lingkungan. disimpan dan kemudian ditampung dalam darah. Bentuk kimia Pb merupakan faktor penting yang mempengaruhi sifat-sifat Pb di dalam tubuh. merusak fungsi organ tubuh. Pada anak-anak dapat menimbulkan kejang tubuh dan neuropathy perifer. Pb yang terhirup oleh manusia setiap hari akan diserap. Tidak semua Pb yang terisap atau tertelan ke dalam tubuh akan tertinggal di dalam tubuh. Gangguan neurologi Gangguan neurologi (susunan syaraf) akibat tercemar oleh Pb dapat berupa encephalopathy. sistem syaraf. mempengaruhi perilaku dan intelejensia.senyawa Pb dapat memberikan efek racun terhadap berbagai macam fungsi organ tubuh. Gangguan terhadap fungsi ginjal Logam berat Pb dapat menyebabkan tidak berfungsinya tubulus renal. ataxia. dan kira-kira 30 % dari jumlah yang terisap melalui hidung akan diabsorbsi melalui saluran pernafasan akan tinggal di dalam tubuh karena dipengaruhi oleh ukuran partikel-partikelnya. memendekkan tinggi badan. meningkatkan tekanan darah dan mempengaruhi perkembangan otak. dan reproduksi. Di antaranya adalah mempengaruhi fungsi kognitif.

gampang lupa. sukar konsentrasi dan menurunnya kecerdasan. Pada anak – anak juga terjadi peningkatan ALA dalam darah. maka pengaruhnya pada profil psikologis dan penampilan pendidikannya akan tampak pada umur sekitar 5-15 tahun. Anemia ringan yang terjadi disertai dengan sedikit peningkatan kadar ALA ( Amino Levulinic Acid) urine. mudah tersinggung. tremor.3-dimercapto-succinic acid (DMSA) KIMIA LINGKUNGAN 27 . kesakitan dan kematian janin. Apabila pada masa bayi sudah mulai terpapar oleh Pb. b Contoh Kasus Merkuri 2. Gambaran klinis yang timbul adalah rasa malas. halusinasi. . Akan timbul gejala tidak spesifik berupa hiperaktifitas atau gangguan psikologis jika terpapar Pb pada anak berusi 21 bulan sampai 18 tahun. dan jika paparannya terus berlanjut dapat terjadi nefritis kronis. Akibatnya dapat menimbulkan aminoaciduria dan glukosuria. Gangguan terhadap sistem syaraf Efek pencemaran Pb terhadap kerja otak lebih sensitif pada anakanak dibandingkan pada orang dewasa. gampang tersinggung. Efek dominan dari keracunan Pb pada sistem hemopoitik adalah peningkatan ekskresi ALA dan CP (Coproporphyrine). namun belum tampak adanya gejala lead encephalopathy. Paparan menahun dengan Pb dapat menyebabkan lead encephalopathy. sakit kepala. Logam berat Pb mempunyai efek racun terhadap gamet dan dapat menyebabkan cacat kromosom . Gangguan terhadap sistem reproduksi Logam berat Pb dapat menyebabkan gangguan pada sistem reproduksi berupa keguguran. Gangguan terhadap sistem hemopoitik Keracunan Pb dapat dapat menyebabkan terjadinya anemia akibat penurunan sintesis globin walaupun tak tampak adanya penurunan kadar zat besi dalam serum. dan penurunan pembentukan konsep.sclerosis glumerolus. . Pada anak dengan kadar Pb darah (Pb-B) sebesar 40-80 μg/100 ml dapat timbul gejala gangguan hematologis. Gejala yang timbul pada lead encephalopathy antara lain adalah rasa cangung.

arsen dan merkuri. Sedangkan sisanya berada dalam bentuk bebas atau tanpa ikatan dengan gugus lain. DMSA dapat digunakan bersamaan dengan khelator lain seperti ALA (Alpha Lipoic Acid). DMSA Senyawa organik yang dikenal juga dengan nama dagang chemet ini merupakan khelator yang efektif dalam penanganan keracunan logam berat seperti timbal.3-dimercapto-succinic acid (DMSA) merupakan senyawa organik yang larut dalam air. seperti vitamin E dan vitamin C.2. Senyawa ini telah digunakan dalam penanganan keracunan merkuri sejak tahun 1950-an di Jepang. yang tidak terkontaminasi merkuri. Dalam upaya mempercepat proses pengeluaran merkuri dalam tubuh manusia. Rusia dan Republik Rakyat China. Gambar 1. DMSA akan mengikat merkuri yang terikat pada gugus thiol pada sistein dan kemudian nantinya akan dikeluarkan bersama urine. dan sejak tahun 1970-an digunakan di Eropa dan Amerika Serikat. dalam upaya mengurangi gangguan kesehatan sebagai akibat pembentukan radikal bebas oleh merkuri. yang mengandung dua gugus tiol (-SH). diekskresikan melalui urin dalam bentuk disulfida dengan gugus thiol sistein. Serangkaian penelitian menunjukkan bahwa DMSA mampu mengeluarkan 65 % merkuri dari dalam tubuh manusia dalam selang waktu tiga jam (Patrick : 2002) DMSA relatif aman digunakan sebagai khelator. Pada manusia normal. DMSA juga dapat digunakan bersamaan dengan anti oksidan.( Khalil : 2011 KIMIA LINGKUNGAN 28 . 90 % DMSA yang diabsorbsi tubuh. manusia. Dalam tubuh.

Pada tahun 1968 Katsuna melaporkan adanya epidemic keracunan Hg di Teluk Minamata. Berdasarkan temuan Diner dan Brenner (1998) serta Frackelton dan Christensen (1998) dikatakan bahwa diagno se klinis keracunan tidaklah mudah dan sering dikaburkan dengan diagnose Hg kelainan merupakan gangguan psikologik berupa rasa cemas dan kadang timbul sifat psikiatrik dan autisme. sebesar 1 ppm. Di Irak pada tahun 1971-1972 terjadi keracunan alkil merkuri akibat mengkonsumsi gandum yang disemprot dengan alkil merkuri yang menyebabkan 500 orang meninggal dunia dan 6000 orang masuk rumah sakit.4% padaanak-anakdan 13. Pada saat terjadi epidemi. semuanyadiatasstandar yang berlaku. Penelitian Eto (1999). kadar Hg pada ikan di Teluk Minamata sebesar 11 µg/kg berat basah dan di sungai Agano sebesar 10 µg/kg berat basah.Pada studi epidemiologi ditemukan bahwa keracunan metil dan etil merkuri sebagian besar di sebabkan oleh konsumsi ikan yang di peroleh dari daerah tercemar atau makanan yang berbahan baku tumbuhan yang disemprot dengan pestisida jenis fungisida alkil merkuri. Hg dapat anak-anak. menyimpulkan bahwa efek keracunan Hg tergantung dari kepekaan individu dan faktor genetik. c Kasus Flour InsidensiFluorisisgigi di 10 desaIndia Tengah yang ditelitisecararinci.8%-70. untuklokasi yang sama.4 hingga 9. Gejala yang timbul akibat keracunan agresi. dan pada tahun 1967 terjadi pencemaran Hg di sungai Agano di Nigata. yang mirip dengan kelainan psikiatrik. Individu yang peka terhadap keracunan Hg adalah anak dalam kandungan (prenatal). apabilakadarfluor rata-rata dalam air diurutdari yang terkecilhingga yang terbesaradalah 1. berkisarantara 22. dan orang tua. bayi. Kesukaran diagnose tersebut disebabkan oleh karena panjangnya periode laten dari mulai terpapar sampai timbulnya gejala dan tidak jelasnya bentuk gejala yang timbul.7% pada orang dewasa. ditemukan juga deformitas KIMIA LINGKUNGAN 29 .6%-81.7 ppm. Selain Fluorosis gigi.

Terakhir penelitian Varnier J A yang dilaporkan dalam Wall Street KIMIA LINGKUNGAN 30 . Kemudian terdapat efek kronis. kanker. Fluorosis yang mengancam kesehatan ini memiliki efek akut dan kronis. sekitar Gunung Tangkuban parahu didapat insiden Fluorosis anak sebesar 41.1 ppm kandungan fluor konsumsi tiap saat. Di Segalaherang. Apabila terjadi patah tulang pada ternak sapi misalnya.7% dan sekitar Gunung Ijen di Asembagussebesar 100% (Suwondo.000 kematian akibat kanker karena fluorida pada tahun 1988. Keracunan Fluor akibatemisi F keudara dari berbagai industri seringkali menyebabkan Fluorosis padat ernas. maka sapi tersebut terpaksa harus disembelih. 1979). memiliki kadar fluor tinggi yaitu sekitar 38 ppm dan mengakibatkan kematian massal puluhanjuta orang karena menderita artritis parah. yaitu retak panggul. Penyakit retak panggul terjadi karena meminum air yang mengandungfluor yang mampu meningkatkan risiko retak panggul hingga dua kali lipat bagi pria dan wanita lanjut usia hanya dengan 0. ditemukan pula bahwa fluorosis gigianakmulaitampakpada intake F> 1 mg tiaphari (Indah. Dalampenelitian yang sama. Dari berbagai uji toksisitas yang telah dilakukan banyak sekali fakta bahwa fluorida sangat membahayakan pengguna. kerusakan otak. Kepala Kimiawan di National Cancer Institute AS. 1970).kerangka. dan Alzheimer.47-2.89 ppm. Penelitian di Indonesia menunjukkanadanya Fluorosis gigi yang ditemukansekitargunungapi. Studi yang dilakukan National Cancer Institute Toxicological Program menemukan bahwa fluorida bisa digolongkan sebagai karsinogen. Efek akut yang ada terjadi pada konsumsi air minum dari air sumur yang belum diuji di India Tengah. 1989). Keracunan Fluor demikian telah merugikan banyak peternak (Shupe. Ilmuwan FDA (Food and Drug Administration) melaporkan adanya korelasi kuat antara penurunan tingkat fertilitas wanita dalam rentan gusis 10-49 tahun dengan peningkatan level fluorida. melaporkan setidaknya 40. karena tidak sanggup lagi berdiri. Ternyatahubunganstatistikkadar F didalam air teh di Segalaherang yang mengandung F sebesar 22. infeltirasi. Ciater.

2006). 3.Pembakaran kayu yang diawetkan oleh senyawa arsen pentavalen. Bahaya pencemaran lingkungan ini terbentuk jika tailing yang mengandung unsur tersebut tidak ditangani secara tepat. Arsen merupakan salah satu hasil sampingan dari proses pengolahan bijih logam non-besi terutama emas.Journal menyebutkan bahwa fluorida menyebabkan kerusakan otak dan mal fungsi koordinasi tubuh setelah termagnifikasi.Pusat listrik tenaga panas bumi (geothermal) yang dapat menyebabkan kontaminasi arsen pada udara ambient. Pencemaran arsen terdapat di sekitar pelelehan logam (tembaga dan timah hitam). yang mempunyai sifat sangat beracun. Dampak Arsen Terhadap Kesehatan Manusia KIMIA LINGKUNGAN 31 . akan menunjang percepatan mobilisasi unsur-unsur berpotensi racun. Selanjutnya dapat memasuki sistem air permukaan atau merembes ke dalam akifer-akifer air tanah setempat. limbah unsur pencemar kemungkinan tersebar di sekitar wilayah tersebut dan dapat menyebabkan pencemaran lingkungan. dapat menaikkan kadar arsen di udara. 2. Tingginya tingkat pelapukan kimiawi dan aktivitas biokimia pada wilayah tropis. D.Pupuk yang di dalamnya mengandung arsen. Ini terjadi di negara-negara yang memproduksi emas dan logam dasar (Herman.Z. d Arsenik Pencemaran Arsen dalam Lingkungan Pembakaran batubara dan pelelehan logam merupakan sumber utama pencemaran arsen dalam udara. Sumber pencemaran arsen juga dapat berasal dari: 1. Ketika tailing dari suatu kegiatan pertambangan dibuang di dataran atau badan air.

Berikut ini adalah implikasi klinik akibat tercemar oleh arsen: Cara Mengatasi Keracunan Arsenik Pertolongan pertama (standart treatment) bila kulit kita terpapar arsenik: cuci permukaan kulit dengan air mengalir secara kontinu kurang lebih 10 menit. air jangan tertelan. atau sampai tidak ada kandungan bahan kimia di atas kulit. yang dapat mengakibatkan kematian. Air tanah biasa digunakan sebagai sumber air minum bagi kelangsungan hidup manusia. Dapat juga dilakukan bilas lambung apabila ia tidak dapat minum. muntah dan diare. sebaiknya diberi antidotumnya. yaitu suntikan intramuskuler KIMIA LINGKUNGAN 32 . Salah satu akibat yang merugikan dari arsen adalah apabila dalam air minum mengandung unsur arsen melebihi nilai ambang batas. Kemudian segera ke dokter untuk mendapat pertolongan medis. gangguan fungsi jantung. Bila perlu. masukkan air dalam jumlah yang cukup besar ke dalam mulut untuk mencuci. Selain itu mengakibatkan penurunan pembentukan sel darah merah dan putih. Gejala keracunan kronis yang ditimbulkannya pada tubuh manusia berupa iritasi usus. kerusakan syaraf dan sel. luka di hati dan ginjal. Sementara bila racun masuk ke pencernaan. Cara mengatasi keracunan arsenik berbeda antara keracunan akut dan kronik. 2009). Untuk keracunan akut yang belum berlangsung 4 jam.wikipedia. Sedangkan untuk keracunan yang sudah berlangsung lebih lama (termasuk juga keracunan kronik). Segera cari pertolongan medis. pada umumnya efek yang timbul adalah iritasi saluran makanan. Kalau bahan kimianya sudah tertelan. Bila melalui mulut. minum kurang lebih 250 ml air dan jangan memaksakan muntah. 2005).WHO menetapkan ambang aman tertinggi arsen dalam air tanah sebesar 50 ppb (www.( Wijanto. korban diberi ipekak untuk merangsangnya muntah. mual. yaitu bila kadarnya melebihi 100 ppb dalam air minum. Dosis rendah akan mengakibatkan kerusakan jaringan. Baju yang terkontaminasi harus dilepaskan. Tetapi. kerusakan pembuluh darah. Arsen inorganik telah dikenal sebagai racun manusia sejak lama. Pemberian katartik atau karboaktif dapat bermanfaat. kelainan kulit atau melanoma serta kanker usus. gunakan sabun. nyeri.org.

Pengobatan dilanjutkan 2-3 kali sehari selama 8 hari ( www. KIMIA LINGKUNGAN 33 . Selain itu. Sehingga mereka yang tinggal di daerah yang beresiko terkontaminasi arsenik dalam air disarankan untuk mengonsumsi satu sampai tiga siung bawang putih per hari sebagai pencegahan keracunan arsen. 2009).blogspot.terselubung. Dimercaprol jauh lebih beracun daripada succimer. ada penelitian menarik yang dilakukan oleh Keya Chaudhuri dan rekan-rekannya dari Indian Institute of Chemical Biology di Kolkata dalam jurnal Food and Chemical Toxicology. Tikus yang diberi makan ekstrak bawang putih kandungan arsenik dalam darah dan hatinya berkurang 40 persen dan 45 persen dari arsen juga di keluarkan lewat air seni tikus tersebut. Mereka melakukan uji coba pada tikus.dimerkaprol 3-5 mg/kgBB 4-6 kali sehari selama 2 hari. Metode kimia dan sintetik saat ini digunakan untuk mengobati keracunan arsenik. Zat yang mengandung belerang dalam bawang putih dapat mengurangi kadar arsen dalam jaringan dan darah.com. Dimercaprol dan asam dimercaptosuccinic adalah agen chelating yang mengambil arsenik dari protein darah dan digunakan untuk mengobati keracunan arsenik akut.

2 Saran Saran dari penyusun adalah kita telah mengetahui logam berat itu berbahaya jika masuk dalam tubuh dan hendaknya kita bias mengontrol keluar masuknya limbah yang mengandung logam berat. yang masuk ke dalam perairan. KIMIA LINGKUNGAN 34 . limbah industri. industry bahan kimia. limbah pertanian dan perumahan. . yang bisa merusak lingkungan khususnya perairan. . Sumber-sumber pencemaran adalah partikel kimia. . pertambangan (emas).1 . Berdasarkan pembahasan tersebut dapat disimpulkan bahwa 3. Proses pencemaran air oleh logam berat melalui interaksi suatu komponen lingkungan daratan. Contohnya PP No. Cara pengendalian pencemaran air oleh logam berat dengan Pengolahan limbah industri sebelum dibuang ke tempat pembuangan. tanah dan udara) sehingga tidak sesuai lagi dengan peruntukannya. 20/1990 tentang Pengendalian Pencemaran Air.BAB III PENUTUP 3. Kesimpulan : Pencemaran adalah masuknya atau dimasukkannya makhluk hidup dankomponen lain yang berasal dari alamiah atau aktivitas manusia ke dalam komponen ( air.Sedangkan indikator terjadinya pencemaran lingkungan dapat dilihat dari aspek kimia-fisika pencemran air dan aspek kimia pencemaran. di mana buangan limbah dari daratan akan bermuara ke laut.

Sign up to vote on this title
UsefulNot useful