P. 1
makalah logam berat

makalah logam berat

|Views: 393|Likes:
Published by Yakoeza HanZou
anor
anor

More info:

Published by: Yakoeza HanZou on May 13, 2013
Copyright:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as RTF, PDF, TXT or read online from Scribd
See more
See less

03/07/2015

pdf

text

original

BAB I PENDAHULUAN

1.1

Latar Belakang Disebut logam berat berbahaya karena umumnya memiliki rapat massa

tinggi(5 gr/cm3) dan sejumlah konsentrasi kecil dapat bersifat racun dan berbahaya. Diantara semua unsur logam berat, Hg menduduki urutan pertama dalam hal sifatracunnya, kemudian diikuti oleh logam berat antara lain Cd, Ag, Ni, Pb, As, Cr, Sn,dan Zn. Logam berat merupakan komponen alami tanah. Logam berat masih termasuk golongan logam dengan kriteria-kriteria yang sama dengan logam-logam lain. Perbedaannya terletak dari pengaruh yang dihasilkan bila logam berat ini berikatandan atau masuk ke dalam tubuh organisme hidup. Sebagai contoh, bila unsur logambesi (Fe) masuk kedalam tubuh, meski dalam jumlah agak berlebihan, biasanyatidaklah menimbulkan pengaruh yang buruk terhadap tubuh. Karena unsur besi (Fe)dibutuhkan dalam darah untuk mengikat oksigen. Sedangkan unsur logam berat baik itu logam berat beracun yang dipentingkan seperti tembaga (Cu), bila masuk kedalam tubuh dalam jumlah berlebihan akan menimbulkan pengaruh-pengaruhburuk terhadap fungsi fisiologi tubuh. Jika yang masuk kedalam tubuh organismehidup adalah unsur logam berat beracun seperti hidragyrum(Hg) atau disebut juga airraksa, maka dapat dipastikan bahwa organisme tersebut akan langsung keracunan.Sehingga dengan kata lain elemen ini tidak dapat didegradasi maupun dihancurkan. Logam berat dapat masuk ke dalam tubuh manusia melalui makanan,air minum, atau udara. Logam berat seperti tembaga, selenium, atau seng dibutuhkantubuh manusia untuk membantu kinerja metabolisme tubuh. Akan tetapi, dapatberpotensi menjadi racun jika konsentrasi dalam tubuh berlebih. Logam berat menjadi berbahaya disebabkan sistem bioakumulasi, yaitu peningkatan konsentrasiunsur kimia didalam tubuh manusia. 1.2 ; Rumusan Masalah Apa yang dimaksud dengan pencemaran logam berat ?

KIMIA LINGKUNGAN

1

; ; ;

Apa penyebab terjadinya pencemaran air oleh logam berat ? Bagaimana proses pencemaran air oleh logam berat? Bagaimana dampak dan cara pengendalin pencemaran air oleh logam berat ?

1.3 ; ; ; ;

Tujuan Mengetahui pengertian pencemaran logam berat. Mengetahui sumber pencemaran air serta indikator terjadinya pencemaran air oleh logam berat Mengetahui proses pencemaran air oleh logam berat. Mengetahui dampak dan cara pengendalin pencemaran air oleh logamberat

1.4

Ruang Lingkup Makalah “Logam Berat” ini merupakan ruang lingkup Pengendalian

Pencemaran Lingkungan Fisik. 1.5 Manfaat Makalah ini dapat menambah pengetahuan tentang pengendalian pencemaran lingkungan “Logam Berat” terhadap manusia dan lingkungan.

KIMIA LINGKUNGAN

2

BAB II PEMBAHASAN

2.1

Pengertian Logam Berat Logam berat (heavy metal) adalah logam dengan massa jenis lima atau

lebih, dengan nomor atom 22 sampai dengan 92. Logam berat dianggap berbahaya bagi kesehatan bila terakumulasi secara berlebihan di dalam tubuh. Beberapa di antaranya bersifat membangkitkan kanker (karsinogen). Demikian pula dengan bahan pangan dengan kandungan logam berat tinggi dianggap tidak layak konsumsi. Kasus-kasus pencemaran lingkungan menyebabkan banyak bahan pangan mengandung logam berat berlebihan. Kasus yang populer adalah sindrom Minamata, sebagai akibat akumulasi raksa (Hg) dalam tubuh ikan konsumsi. Di Indonesia, pernah dilaporkan bahwa ikan-ikan di Teluk Jakarta juga memiliki kandungan raksa yang tinggi. Udang dari tambak Sidoarjo pernah ditolak importir dari Jepang karena dinilai memiliki kandungan kadmium (Cd) dan timbal (Pb) yang melebihi ambang batas. Diduga logam-logam ini merupakan dampak buangan limbah industri di sekitarnya. Kakao dari Indonesia juga pernah ditolak pada lelang internasional karena dinilai memiliki kandungan Cd di atas ambang batas yang diizinkan. Cd diduga berasal dari pupuk TSP yang diberikan kepada tanaman di perkebunan. Logam berat adalah unsur-unsur kimia dengan bobot jenis lebih besar dari 5 gr/cm3, terletak di sudut kanan bawah sistem periodik, mempunyai afinitas yang tinggi terhadap unsur S dan biasanya bernomor atom 22 sampai 92 dari perioda 4 sampai 7 (Miettinen, 1977). Sebagian logam berat seperti timbal (Pb), kadmium (Cd), dan merkuri (Hg) merupakan zat pencemar yang berbahaya. Afinitas yang tinggi terhadap unsur S menyebabkan logam ini menyerang ikatan belerang dalam enzim, sehingga enzim bersangkutan menjadi tak aktif. Gugus

KIMIA LINGKUNGAN

3

berbahaya baik secara langsung terhadap kehidupan organisme. Logam berat juga mengendapkan senyawa fosfat biologis atau mengkatalis penguraiannya. b Dapat terakumulasi dalam organisme termasuk kerang dan ikan. seng (Zn). timah hitam (Pb). krom (Cr). Sedangkan menurut Kementrian Negara Kependudukan dan Lingkungan Hidup (1990) sifat toksisitas logam berat dapat dikelompokan ke dalam 3 kelompok. nikel (Ni). Sutamihardja dkk. sehingga mudah terakumulasi dalam lingkungan perairan dan keberadaannya secara alami sulit terurai (dihilangkan). Menurut Darmono (1995) daftar urutan toksisitas logam paling tinggi ke paling rendah terhadap manusia yang mengkomsumsi ikan adalah sebagai berikut Hg2+ > Cd2+ >Ag2+ > Ni2+ > Pb2+ > As2+ > Cr2+ Sn2+ > Zn2+. Cd.karboksilat (-COOH) dan amina (-NH2) juga bereaksi dengan logam berat. dan Zn. 1982). dan akan membahayakan kesehatan manusia yang mengkomsumsi organisme tersebut. kadmium (Cd). 1982) yaitu : a Sulit didegradasi. yaitu : a Bersifat toksik tinggi yang terdiri dari atas unsur-unsur Hg. dan Co. Adanya logam berat di perairan. Pb. Cu. Bersifat tosik rendah terdiri atas unsur Mn dan Fe. maupun efeknya secara tidak langsung terhadap kesehatan manusia. dan kobalt (Co) (Sutamihardja dkk. Kadmium. b c Bersifat toksik sedang terdiri dari unsur-unsur Cr. sehingga konsentrasinya selalu lebih tinggi dari konsentrasi logam dalam air. 1997. Ni. timbal. Hal ini berkaitan dengan sifat-sifat logam berat ( PPLH-IPB. c Mudah terakumulasi di sedimen. Berdasarkan sifat kimia dan fisikanya. dan tembaga terikat pada sel-sel membran yang menghambat proses transpormasi melalui dinding sel. maka tingkat atau daya racun logam berat terhadap hewan air dapat diurutkan (dari tinggi ke rendah) sebagai berikut merkuri (Hg). Disamping itu sedimen mudah tersuspensi karena pergerakan masa air yang akan melarutkan kembali KIMIA LINGKUNGAN 4 .

biasanya tidaklah menimbulkan pengaruh yang buruk terhadap tubuh. bila unsur logam besi (Fe) masuk kedalam tubuh. Mempunyai respon biokimia khas (spesifik) pada organisme hidup. Mempunyai nomor atom 22-34 dan 40-50 serta unsur-unsur lantanida dan aktinida. Logam berat masih termasuk golongan logam dengan kriteria-kriteria yang sama dengan logam-logam lain. Jika yang masuk kedalam tubuh organisme hidup adalah unsur logam berat beracun seperti hidragyrum(Hg) atau disebut juga air raksa. bila masuk kedalam tubuh dalam jumlah berlebihan akan menimbulkan pengaruh-pengaruh buruk terhadap fungsi fisiologi tubuh. meski dalam jumlah agak berlebihan. bertemu dengan unsur nitrogen dan atau unsur belerang (sulfur) atau disebut juga nitrogen/sulfur seeking metal. Karena unsur besi (Fe) dibutuhkan dalam darah untuk mengikat oksigen. Istilah logam berat sebetulnya telah dipergunakan secara luas. Sedangkan unsur logam berat baik itu logam berat beracun yang dipentingkan seperti tembaga (Cu). sebagai suatu ilmiah yang menggambarkan bentuk dari logam tertentu. Karakteristik dari kelompok logam berat adalah sebagai berikut : a b c Spesifikasi graviti yang sangat besar (lebih dari 4). KIMIA LINGKUNGAN 5 . Nierbor dan Richardson menggunakan istilah logam berat untuk menggantikan pengelompokan ion-ion logam kedalam 3 kelompok biologi dan kimia (bio-kimia) pengelompokan tersebut adalah sebagai berikut : a b Logam-logam yang dengan mudah mengalami reaksi kimia bila Logam-logam yang dengan mudah mengalami reaksi kimia bila bertemu dengan unsur oksigen atau disebur juga dengan oxygen-seeking metal.logam yang dikandungnya ke dalam air. Sebagai contoh. maka dapat dipastikan bahwa organisme tersebut akan langsung keracunan (Palar. terutama dalam perpustakaan ilmiah. sehingga sedimen menjadi sumber pencemar potensial dalam skala waktu tertentu. Perbedaannya terletak dari pengaruh yang dihasilkan bila logam berat ini berikatan dan masuk ke dalam tubuh organisme hidup. 2004).

Sebagai contoh adalah unsure logam besi (Fe).c Logam antara atau logam transisi yang memiliki sifat khusus (spesifik) sebagai logam pengganti (ion pengganti) untuk logam-logam atau ionion logam dari kelas A dan logam dari kelas B. Dapat dikatakan bahwa semua logam berat dapatmenjadi racun yang akan meracuni tubuh makhluk hidup. dan nikel (Ni).Berbeda dengan logam biasa. meski semua logam berat dapat mengakibatkan hidup.kebutuhan tersebut berada dalam jumlah yang sangat sedikit. yang bisa merusak lingkungan khususnya perairan. Karena tingkatkebutuhan sangat dipentingkan maka logam-logam tersebut juga dinamakan sebagailogam-logam atau mineralmineral esensial tubuh. Beberapa unsurelogam sangat dibutuhkan oleh makhluk hidup untuk mempertahankan kehidupannya. limbah industri. di antaranya adalah unsur-unsur logam. Material berbahaya tersebut memiliki dampak yang bermacam-macam dalam perairan. Ternyata kemudian. Tetapi bila kebutuhan dalam jumlah yang sangat kecil itutidak terpenuhi. timah (Pb). dan khrom (Cr). Sebagai contoh adalahlogam air raksa (Hg). keracunan atas makhluk hidup. sebagian dari logam-logam berat tersebut tetap dibutuhkan oleh makhluk hidup. bila jumlahdari loga-logam esensial ini masuk ke dalam tubuh dalam jumlah berlebihan. pertambangan (emas). Contoh dari logam-logam beratesensial ini adalah tembaga (Cu). limbah pertanian dan perumahan. seng (Zn). Namun demikian. 2. industry bahan kimia. Ada yang berdampak langsung. makaakan berubah fungsi menjadi zat racun bagi tubuh. logam berat biasanya menimbulkan efek-efek khusus pada makhluk hidup.yang masuk ke dalam perairan. kadmium (Cd).2 Sumber Pencemaran Sumber pencemaran logam berat adalah masuknya material pencemar seperti partikel kimia. unsure ini berkaitan dengan Hb darahmembentuk haemoglobin yang berfungi sebagai pengikat oksigen (O2) dalam darah. maupun KIMIA LINGKUNGAN 6 . Kimia dapat diartikan sebagai peranan kimia (unsure-unsur kimia) dalam kehidupan makhluk hidup. maka akan berakibatfatal terhadap kelangsungan hidup dari setiap makhluk hidup.

serta penyakit. Tingginya konsentrasi bahan tersebut menyebabkan pertumbuhantumbuhan air ini akan meningkat dan akan mendominasi perairan. timah.Limbah kimia yang bersifat toxic (racun) yang masuk ke perairan laut akanmenimbulkan efek yang sangat berbahaya. pestisida ini dapat menyebabkan mutasi. Dalam jaring makanan. 2. furan. seluruh penyusun rantai makanan termasuk manusia. Racun semacam itu dapat terakumulasi dalam jaringan berbagai jenis organisme laut yang dikenal dengan istilah bioakumulasi. ketika pestisida masuk ke dalam ekosistemlaut. Racun ini juga diketahui terakumulasi dalam dasar perairan yang berlumpur. apakah airtersebut termasuk air yang tercemar ataukah tidak tercemar. mereka segera diserap ke dalam jaring makanan di laut. Senyawa kimia ini dapat menyebabkan eutrofikasi.Bahan kimia anorganik lain yang bisa berbahaya bagi ekosistem laut adalah nitrogen. Kelompok limbah kimia ini terbagi dua. dioksin dan fenol. Contoh logam berat yang sering mencemari adalah air raksa. dan fosfor. nikel. Terdapat pula logam berat.3 Indikator Pencemaran Logam Berat Dalam Air Aspek-Aspek Pencemaran Air ada beberapa aspek sebagai pengukuran tingkat pencemaran air. Sumber dari limbah ini umumnya berasal dari sisa pupuk pertanian yang terhanyut kedalam perairan.tidak langsung. suatu unsur kimiametalik yang memiliki kepadatan yang relatif tinggi dan bersifat racun atau beracunpada konsentrasi rendah. juga dari limbah rumah tangga berupa detergent yang banyak mengandung fosfor. arsenik dan cadmium. karena senyawa ini merupakan nutrien bagi tumbuhan air seperti alga dan phytoplankton.pertama kelompok racun yang sifatnya cenderung masuk terus menerus sepertipestisida. Bahan-bahan ini dapat menyebabkan mutasi keturunan dari organisme yang tercemar serta penyakit dan kematian secara massal seperti yang terjadi pada kasus yang terjadi di Teluk Minamata. sehinggamenganggu organisme lain bahkan bisa mematikan. yang dapat berbahaya bagihewan laut. Aspek-aspek pencemaranair yaitu terdiri dari aspek kimia-fisika pencemran air dan aspek biokimiapencemaran. Adapun aspek kimia-fisika pencemaran air itu adalah sebagai berikut : KIMIA LINGKUNGAN 7 .

Bila pH di bawah pH normal. c Oksigen Terlarut untuk mempertahankan hidupnya. Air limbah dan bahan buanganindustri akan mengubah pH air yang akhirnya akan mengganggu kehidupan biotaakuatik. Air buangan lebih tingi dari pada air asalnya. Air akan bersifat asam atau basa tergantung besar kecilnya pH. Jada kadar oksigenterlarut dapat dijadikan ukuran untuk menetukan kualitas air. b SuhuAir sering digunakan sebagai medium pendingin dalam berbagai prosesindustri.Mengganggu kehidupan ikan dan hewan air alinya. Kekeruhan membatasi masukannya cahaya ke dalam air. ikan dan hewan air lainnyamungkin akan mati. Naiknyasuhu air akan menimbulkan akibat sebagai berikut :Menurunya jumlah oksigen terlarut dalam air. baik tumbuhan maupun hewan. Keasaman dan Alkhalinitas.Adanya ion kalsium (Ca) dan magnesium (Mg) di dalam air akan mengakibatkansifat kesadahan air tersebut.Alkalinitas berkaitan dengan kesadahan air.Jika bata suhu yang mematikan terlampaui.03% karbondioksida)bersentuhan dengna permukaan air pada tekanan standar maka kelarytankarbondioksida terhadap perubahan suhu. yang mengakibatkan pembiasan cahaya ke dalam air. bergantung kepada oksigen terlarut.Air normal yang memenuhi syarat untuk suatu kehidupan mempunyai pHsekitar 6. Jika udara (yang mengandung 0. bahan tersuspensi diantaranya yang bersifat koloid. jasad KIMIA LINGKUNGAN 8 .5– 7. dan terurainya zat tertentu. maka air tersebut bersifat asam. yan merupakan salah satu sifat air. seperti bahan organik. d Karbondioksida Dalam AirKepekaan oksigen terlarut dalam air bergantung kepda kepekaankarbondioksida yang ada. Air pendingin tersebut setelah digunakan akan mendapatkan panas daribahan yang didinginkan. e Warna dan kekeruhan warna air yang tidak normaal biasanya merupakan indikasi terjadinya pencemaran air. Kekeruhan menunjukan sifat toptis air.5. sedangkan air yangmempunyai pH di atas pH normal bersifat basa. makhluk yang tinggal di dalam air.a Nilai pH. ayitu sungaiatau sumber air lainnya. kemudian dikembalikan ke tempat asalnya. Kekurahan ini terjadi karena adanya bahan terapung.Meningkatkan kecepatan reaksi kimia. Warna air dibedakan menjadi dua macam yaitu warna sejati (akibat bahan-bahan terlarut) dan air semu (akibat bahan terlarut.

4 Proses Pencemaran Logam Berat Dalam Air Air laut adalah suatu komponen yang berinteraksi dengan lingkungan daratan. kimia). cumi-cumi. limbah. yaitu :. Kemudian. Pencegahanpencemaran posfor dapat dilakukan dengan melarang penggunaan ditergen yangmengandung posfat. di mana buangan limbah dari daratan akan bermuara ke laut. Semakin keruh air. Limbah tersebut yang mengandung polutan kemudian masuk ke dalam ekosistem perairanpantai dan laut.Padatan terlarut total. g PosforPosfor memasuki air melalui berbagai jalan yaitu kotoran. lumpur tanah liat dan benda yang terapung dansangat halus sekali. Juga dengan mewajibkan pengolahan limbah industridengan memberikann air kapur atau aluminium sulfat agar posfatnyamengendapa dan dapat dibuang. NitratJika kandungan nitrat tersebut akan berubah menjadi nitrit di perut. rumput laut dan lain-lain). kerang.renik.Aspek ini menggunakan dua pengujian yang berhubungan dengan kandunganoksigen dalam air yaitu : a. b. sisapertanian. 2. semakin tinggi daya hantar listriknya dansemakin banyak pula padatannya. polutan tersebut yang masuk ke air diserap Uji BOD (Biochemical Oxygen Demand Test = uji kebutuhan Uji COD (Chemical Oxygen Demand = uji kebutuhan oksigen oksigenbiokimia). ikan. sebagian tenggelam ke dasar danterkonsentrasi ke sedimen. f Padatan pada dasarnya air yang tercemar selalu mengandung padatan yang dapatdibedakan menjadi empat kelompok berdasarkan besar partikelnya dan sifatsfatlainnya. Selain itu ada juga yang disebut dengan aspek biokimia pencemaran air..Padatan tersuspensi dan koloid.Keracunan nitrit akan mengakibatkan wajah membiru dan kematian. Selain itu air laut juga sebagai tempat penerimaan polutan (bahan cemar) yang jatuh dari atmosfir. KIMIA LINGKUNGAN 9 . dan sebagian masuk ke dalam jaringan tubuh organismelaut (termasuk fitoplankton.Minyak dan Lemak g. terutama kelarutannya.Padatan terendap (sedimen). Sebagian larut dalam air. kotoran hewan dan sisa tumbuhan dan hewan yang mati. udang.

Konsentrasi polutan dalam tubuh zooplankton lebih tinggi dibanding dalam tubuh fitoplankton karenazooplankton memangsa fitoplankton sebanyakbanyaknya.Fitoplankton adalah produsen dan sebagai tropik level pertama dalamrantai makanan. Bila polutan ini berada dalam jaringan tubuh organisme laut tersebut dalam konsentrasi yang tinggi.5 Beberapa logam berat yang berbahaya a.Polutan ikut masuk ke dalam tubuhnya dan terakumulasi terus-menerus dan bahkan bisa melebihi konsentrasi yang di air. Kemudian fitoplankton dimakan zooplankton. kemudian dijadikan sebagai bahan makanan maka akan berbahaya bagi kesehatan manusia.Ikan predator dan ikan yang berumur panjang mengandungkonsentrasi polutan dalam tubuhnya paling tinggi di antara seluruh organisme laut. selanjutnya dimangsa oleh ikan predator sebagaitropik level tertinggi. WHO (World Health Organization) atau Organisasi Kesehatan Duniadan FAO (Food Agriculture Organization) atau Organisasi Pangan Dunia merekomendasikan untuk tidak mengonsumsi makanan laut (seafood) yang tercemarlogam berat.langsung olehfitoplankton. Salah satu polutan yang paling berbahaya bagi kesehatan manusia adalahlogam berat.Kerang juga mengandung logam berat yang tinggi karena cara makannya denganmenyaring air masuk ke dalam insangnya setiap saat dan fitoplankton ikut tertelan. Demikian juga makanan laut (seafood) yangberasal dari pantai dan laut yang tercemar juga mengandung bahan polutan yangtinggi. Karena kesehatan manusia sangat dipengaruhi oleh makanan yang dimakan. 2. Makanan yang berasal dari daerah tercemarkemungkinan besar juga tercemar. Bahkan tidak sedikit yang menyebabkan kematian. Mercury KIMIA LINGKUNGAN 10 . Logam berat telah lama dikenal sebagai suatu elemen yang mempunyaidaya racun yang sangat potensil dan memiliki kemampuan terakumulasi dalam organtubuh manusia. Fitoplankton danzooplankton dimakan oleh ikan-ikan planktivores (pemakan plankton) sebagai tropik level kedua. Ikan planktivores dimangsa oleh ikan karnivores (pemakan ikan atauhewan) sebagai tropik level ketiga. Polutan tersebut mengikuti rantai makanan mulai dari fitoplankton sampai ikan predator dan pada akhirnya sampai ke manusia.

sebagai katalisator. Manusia telah menggunakanmercury oksida (HgO) dan mercury sulfida (HgS) sebagai zat pewarna dan bahankosmetik sejak jaman dulu.Air Raksa atau Mercury (Hg) adalah salah satu logam berat dalam bentuk cair. produk susu. kehilangan inderaperasa dan bahkan banyak yang meninggal dunia. Kemudian mencapai konsentrasiyang tinggi pada daging kerang-kerangan. udang dan makanan laut lainnyayang mengandung mercury. crustacea dan ikan yang merupakankonsumsi sehari-hari bagi masyarakat Minamata. dan lain-lain. Pada saat itu banyak orang mengalami penyakityang mematikan akibat mengonsumsi ikan. Meskipun pencemaran mercury dapat terjadi secaraalami tetapi kadarnya sangat kecil. Kasus minamata yang terjadi dari tahun 1953 sampai1975 telah menyebabkan ribuan orang meninggal dunia akibat pencemaran mercurydi Teluk Minamata Jepang. pembuatan gigi palsu.Terjadinya pencemaran mercury di perairan laut lebih banyak disebabkan oleh faktormanusia dibanding faktor alam. peleburan emas. Methyl mercury ini masuk ke dalam tubuh organisme laut baik secaralangsung dari air maupun mengikuti rantai makanan. pembungkus makanan juga kadang mencemari makanan tersebut. lumpuh. Penggunaan mercury sebagai elektroda dalampembuatan soda api dalam industri makanan seperti minyak goreng.Pencemaran logam mercury (Hg) mulai mendapat perhatian sejak munculnya kasusminamata di Jepang pada tahun 1953. industri pembuatan cat. Pencemaran mercury secara besar-besarandisebabkan karena limbah yang dibuang oleh manusia. Konsentrasi atau kandunganmercury dalam rambut beberapa pasien di rumah sakit Minamata mencapai lebih 500ppm. Masyarakat Minamata yang mengonsumsi makanan laut yang tercemar tersebutdalam jumlah banyak telah terserang penyakit syaraf. kerang.kertas tima. KIMIA LINGKUNGAN 11 . Industri Kimia Chisso menggunakan mercury khlorida(HgCl2) sebagai katalisator dalam memproduksi acetaldehyde sintesis di mana setiap memproduksi satu ton acetaldehyde menghasilkan limbah antara 30-100 gr mercurydalam bentuk methyl mercury (CH3Hg) yang dibuang ke laut Teluk Minamata. Dewasa ini mercury telah digunakan secara meluas dalamproduk elektronik.

mg/l.menyebabkan penyumbatan sel-sel darah merah. ginjal. Selanjutnya Pb tersebut jatuh ke laut mengikuti air KIMIA LINGKUNGAN 12 . Pencemaran kadmium pada air minum di Jepang menyebabkan penyakit “itai”. Pb dapat diakumulasi langsung dari air dan dari sedimen olehorganisme laut. Sementara batasmaksimum konsentrasi atau kandungan Cd pada daging makanan laut yang layak bagikesehatan yang direkomendasikan FAO dan WHO adalah lebih kecil dari 0.5 ppm. Kadmium telah digunakan secara meluas pada berbagai industri antara lainpelapisan logam. pewarnaan.b.penciuman. batubaramengandung Cd sampai 2 ppm.95 mg/kg. anemia dan mempengaruhi anggotatubuh lainnya. Kadmium Kadmium (Cd) menjadi populer sebagai logam berat yang berbahaya setelahtimbulnya pencemaran sungai di wilayah Kumamoto Jepang yang menyebabkankeracunan pada manusia. sirkulasi darah.01.Konsentrasi Cd maksimum dalam air minum yangdiperbolehkan oleh Depkes RI dan WHO adalah 0. Limbah cair dari industri dan pembuangan minyak pelumasbekas yang mengandung Cd masuk ke dalam perairan laut serta sisa-sisa pembakaranbahan bakar yang terlepas ke atmosfir dan selanjutnya jatuh masuk ke laut.0 mg/kg. Dewasa ini pelepasan Pb ke atmosfir meningkat tajam akibatpembakaran minyak dan gas bumi yang turut menyumbang pembuangan Pb keatmosfir. peleburan logam. c Timbal Timbal (Pb) juga salah satu logam berat yang mempunyai daya toksitas yangtinggi terhadap manusia karena dapat merusak perkembangan otak pada anak-anak. bahan bakar. pupuk superpospat juga mengandung Cd bahkan adayang sampai 170 ppm. Sebaliknya Dirjen Pengawasan Obat dan Makanan merekomendasikan tidak lebihdari 2. minyak pelumas. jantung dan kerapuhan tulang. serta merusak kelenjar reproduksi. Keracunan kronis yang disebabkan oleh Cd adalah kerusakan sistem fisiologis tubuh seperti pada pernapasan. Konsentrasi Cd pada air laut yang tidak tercemar adalah kurang dari 1 mg/l ataukurang dari 1 mg/kg sedimen laut. Gejalanya ditandai dengan ketidak normalan tulangdan beberapa organ tubuh menjadi mati.Bahan bakar dan minyak pelumas mengandung Cd sampai 0. baterai.

berupa meningkatnya aktifitas enzim pada liver (enzim SGOT. penebalan kulit (hiperkeratosis). terjadi penurunan daya KIMIA LINGKUNGAN 13 . Efek Arsenic terhadap mata adalah gangguan penglihatan dan kontraksi mata pada bagian perifer sehingga mengganggu daya pandang ( visual fields) mata. portal hypertention (hipertensi oleh karena faktor pembuluh darah potal). dapat berakibat buruk terhadap mata. d Arsen Intoksikasi tubuh manusia terhadap arsenik (As). infeksi kulit (dermatitis) dan mempunyai efek pencetus kanker (carcinogenic). dan liver. kulit. liver cirrhosis (jaringan hati berubah menjadi jaringan ikat dan ascites (tertimbunnya cairan dalam ruang perut). Pada darah. logam berat Arsen dapat menganggu fungsi pembuluh darah. oedema paru dan penyakit pembuluh darah perifer (varises. lazim disebut effek malformasi. sehingga dapat mengakibatkan penyakit arteriosclerosis (rusaknya pembuluh darah). menyebabkan timbulnya laryngitis (infeksi renal damage (terjadi bronchitis (infeksi bronkus) dan dapat pula menyebabkan kanker paru. Pada kulit menyebabkan berwarna gelap (hiperpigmentasi). Arsen (As) akan menyebabkan kerusakan ginjal berupa ichemia and kerusakan jaringan). mempunyai efek yang signifikan pada paparan yang cukup lama (paparan kronis). ichterus (penyakit kuning). Pada sistem reproduksi. Pada saluran laryng). SGPT. timbul seperti bubul (clavus). Pada pembuluh darah.hujan. darah . akan ginjal. Pada sistem immunologi. gamma GT). Pada pernafasan. menyebabkan kegagalan fungsi sungsum tulang dan terjadinya pancytopenia (yaitu menurunnya jumlah sel darah perifer). efek arsen terhadap fungsi reproduksi biasanya fatal dan dapat pula berupa cacat bayi waktu dilahirkan. Pada liver. penyakit burger). Dengan kejadiantersebut maka banyak negara di dunia mengurangi tetraeil Pb pada minyak bumi dangas alam untuk mengurangi pencemaran Pb di atmosfir.

berupa penebalan oleh plag pada pembuluh aorta (Atherosclerotic aortic plaque). e Kromium Keracunan tubuh manusia terhadap chromium (Cr). dapat berakibat buruk terhadap saluran pernafa san. KIMIA LINGKUNGAN 14 . tubuh kita mengeluarkan lebih banyak keringat sehingga perlu minum lebih banyak. kelainan berupa nekrosis tubulus ginjal. 2 ppm. Sementara di wilayah yang iklimnya lebih dingin. Efek chromium (Cr) terhadap s istem saluran pernafasan ( Respiratory sistem effects). akibat nya peka terhadap bahan karsinogen (pencetus kanker) dan infeksi virus. pembuluh darah dan ginjal.tahan tubuh/ penurunan kekebalan. Pada kulit (Skin effects). berupa ulkus kronis pada permukaan kulit. Sedangkan pada ginjal (Kidney effects). Karen adalam cuaca panas. berupa anker paru dan ulkus kronis/ perforasi pada septum nasal. kulit. akan menyebabkan perasaan mual dan muntah. Gastrointestinal (saluran pencernaan) . g Flour Beriklim hangat konsentrasi fluor MenurutNpedoman WHO yang dikeluarkan tahun 1984. konsentrasinya 1. karenaitu konsentrasi dalam air minum yang dikonsumsi seharusnya ditentukan lebih rendah. Pada Pada sistem sel. mual (nausea) dan muntah (vomiting). Mengapa perbedaan iklim mempengaruhi jumlah fluor yang sebaiknya dikonsumsi. Pada pembuluh darah (Vascular effects). untuk wilayah yang optimal dalam airminum sebaiknya masih dibawah 1 mg/liter atau 1 ppm (parts per million). serta nyeri perut. f Klor Kadar Cl yang berlebihan akan menyebabkan rasa asin dan korosif pada logam. efek terhadap sel mengakibatkan Arsen rusaknya mitochondria dalam inti sel menyebabkan turunnya energi sel dan sel dapat mati.

melaporkan setidaknya 40. Fluorosis yang mengancam kesehatan inimemiliki efekakut dan kronis. April 20. kematian massal –puluhanjuta orangkarenamen kanker. Penyakitretak panggul terjadi karena meminum air yang mengandungfluor yang mampu meningkatkan risiko retak panggulhingg adua kali lipat bagi pria dan wanaita lanjut usia hanyadengan 0. memilikikadarfluortinggiyaitusekitar 38 ppm dan mengakibatkan deritaartritisparah.17/33059. padatahun 1998 telah menetapkan bata satas yang diperbolehkanhanya 1 ppm. Dari berbagai uji toksisitas yang telah dilakukan banyak sekali fakta bahwa fluorida sangat membahayakan pengguna. Pada tahun 1999. Namun selama ini setidaknya dua belas pemenang Nobel di bidang kedokteran dan kimia telah memberi peringatan sehubungan risiko kesehatan yang ditimbulkannya. dan Alzheimer. tetapi memberi argument para pendukung pemakai fluorida. Pada saat itu reaksinya cukup banyak.1 ppm kandungan fluor konsumsitiapsaat. HUMO membuat tulisan tentang bahaya fluorida (Nurno Nr. khususnya dari para dokter gigi yang meski tidak diragukan berniat baik. namun gigi itu sendiri menjadi lebih rapuh.Berdasarkan pedoman WHO juga diketahui bahwa batas ataskan dungan fluor dalam air minum yang diperbolehkan adalah 1. infeltirasi. Fluorida sangat reaktif dan mampu menembus hinggake dalamtulangdan set tempat substansi terakumulasi. Memberikan fluorida kepada anak-anak bukan saja tidak bermanfaat tetapi berbahaya. Di India. kerusakan otak.000 kematian akibatkan kerkarena fluori daada tahun 1988. Kemudianterdapatefekkronis. namunti dak bersifat universal.5 ppm. yaituretakpanggul.Efekakut yang ada terjadi padakonsumsi air minumdari air sumur yang belumdiuji di India Tengah. Studi yang dilakukan National Cancer Institute Toxicological Program menemukan bahwa fluorida bisa digolongkan sebagai karsinogen. KepalaKimiawan di National Cancer Institute AS. 1999). Memang permukaan gigi menjadi lebih keras. Ilmuwan FDA (Food and Drug Administration) melaporkan adanya korelasi kuat antara penurunan KIMIA LINGKUNGAN 15 . yang banyakdijumpaikasus fluorosis.

TerakhirpenelitianVarnier J A yang dilaporkandalam Wall Street Journal menyebutkanbahwafluoridamenyebabkankerusakanotakdanmalfungsikoordinasitu buhsetelahtermagnifikasi.dicurigai dapat menyebabkan hipertensi.Penumpukan logam-logam berat ini terjadi dalam tumbuh- KIMIA LINGKUNGAN 16 .Larutan dari kadmium sangatberacun. Cadmium (Cd): Dalam bentuk serbuk mudah terbakar. ginjal dan tiroid.Dapat menyebabkan kanker.Pencemaran air yang telah terjadi secara alami misalnya adanya jumlahlogam-logam berat yang masuk dan menumpuk dalam tubuh manusia. menyebabkan naiknya tekanan darah dan terganggunyasistem syaraf.tingkatfertiitaswanitadalamrentangusis 10-49 tahundenganpeningkatan level fluorida.Jangka panjang. terakumulasi di hati. Beracun jika terhirupdari udara atau uap.dialirkan ke sungai atau selokan hendaknya dikumpulkan di suatu tempat yangdisediakan. pankreas.6 Menaggulangi Pencemaran Logam Berat Pengolahan limbah industri sebelum dibuang ke tempat pembuangan. Kelebihan kadar flourida pada air akan menyebakan kerusakan pada gigi ( carries gigi ). 2. Jangka panjang. Bahkan kalau dapat setelah diolah tidak dibuang ke sungai melainkan dapat digunakan lagi untuk keperluan industri sendiri. logam berat inidapat meracuni organ tubuh melalui pencernaan karena tubuh memakan tumbuh-tumbuhan yang mengandung logam berat meskipun diperlukan dalam jumlah kecil. mudah terbakar pada temperatur ruang. kemudian diolah. agar bila terpaksa harus dibuang ke sungai tidak menyebabkan terjadinya pencemaran air. Pada Manusia bahaya yang Dapat Ditimbulkan oleh Logam Berat di dalam Tubuh Manusia : 1 Barium (Ba): Dalam bentuk serbuk.

Gubernur. . maka limbah industri hendaknya dilakukanpengolahan sebelum dibuang ke lingkungan. Hal ini bisa dilakukan dengan memberikan penyuluhan-penyuluhan padamasyarakat penambang. Bupati.Peran pemerintah untuk melakukan AMDAL terhadap suatu perusahaan yangmenggunakan air raksa harus dilakukan dengan benar dan sanksi yang tegas apabilaAMDALnya membahayakan kesehatan manusia dan lingkungan.Proses pencegahan terjadinya pencemaran lebih baik daripada prosespenanggulangan terhadap pencemaran yang telah terjadi. . ini kembali pada soalkoordinasi unsur-unsur masyarakat terkait.Pengendalian/penanggulangan pencemaran air di Indonesia telah diaturmelalui Peraturan Pemerintah Nomor 82 tahun 2001 tentang Pengelolaan Kualitas danPengendalian Pencemaran Air. . danDepartemen Pertambangan sangat menentukan dalam mengurangi pencemaransungai. Menempatkan daerah industri atau pabrik jauh dari daerah perumahan ataupemukiman Pembuangan limbah industri diatur sehingga tidak mencermari lingkungan atauekosistem Pengawasan terhadap penggunaan jenis jenis pestisida dan zat zat kimia lainyang dapat menimbulkan pencemaran Memperluas gerakan penghijauan Tindakan tegas terhadap perilaku pencemaran lingkungan Memberikan kesadaran terhadap masyaratkat tentang arti lingkungan hidupsehingga manusia lebih lebih mencintai lingkungan hidupnya Melakukan intensifikasi pertanianPencegahan adalah lebih baik dari pengobatan. . . . Khususnya untuk kasus PETI(Penambangan Emas Tanpa Izin).Salah satu upaya serius yang telah dilakukan Pemerintah dalam pengendalianpencemaran air adalah melalui Program Kali Bersih (PROKASIH) KIMIA LINGKUNGAN 17 .Usaha-usaha tersebut dapatdilakukan. . Untuk menanggulangi agar tidak terjadipenumpukan logam-logam berat.tumbuhan karena terkontaminasi oleh limbah industri. Artinya. kebijakan publik. diantaranya melalui menjaga air tanah agar tetap bersih misalnya : .

50 untuk Zn ( Kunaefi dan Herto. mengatur danmengawasi segala macam bentuk kegiatan industri dan teknologi sehingga tidak terjadi pencemaran. Penelitian lain di Pantai UtaraTangerang yang menerima air 12 sungai. Peraturan perundangan ini hendaknya dapat memberikangambaran secara jelas tentang kegiatan industri yang akan dilaksanakan. ternyata juaga mengandung Cd. menunjukkan kualitas air sudah tidak lagimemenuhi syarat bagi perikanan. Sekalipun demikian. belumada peraturan yang menentukan bagian laut mana saja yang boleh dieksploitasiproduknya. standar yang berlaku telah di lampaui sebanyak 45% sampai 91 % ( Djuangsih. Penanggulangan secara nonteknis yaitu suatu usaha untuk mengurangi pencemaran lingkungan dengan caramenciptakan peraturan perundangan yang dapat merencanakan. air dan tanah seagian besar akantersalurkan air dan masuk ke dalam laut. dan pariwisata ( berenang dan menyelam).7 Contoh Kasus Pencemaran laut. Factor biokonsentrasi ( BCF ) yangdiperkirakan untuk logamlogam tersebut sangat bervariasi. misalnyameliputi AMDAL. Patut dicatatdisini . bahwa Teluk Jakarta menerima air dari 13 sungai. mengelolalimbah atau menambah alat bantu yang dapat mengurangi pencemaran.196.Pada prinsipnya ada 2 (dua) usaha untuk menanggulangi pencemaran. Penelitian di Kepulauan Seribu menunjukkanbahwa konsentrasi beberapa logam berat sudah melampaui standar yang berlaku. Cu.20 untuk Pb sampai 65. Hal inidiperkirakan akibat dari proses biokonsentrasi. biota laut. muali dari yang terkecil11.Semua pencemar. Zn. 6 jenis ikan yang biasa di makan turis. 2. Pb. misalnya dengan mengubah proses. yaitupenanggulangan secara non-teknis dan secara teknis. pengaturan dan pengawasan kegiatan dan menanamkan perilakudisiplin. Sedangkan penanggulangan secara teknis bersumber pada perlakuan industriterhadap perlakuan buangannya. 2000 ). danHg dalam konsentrasi yang jauh lebih besar dari yang diperolehkan. baik berasl udara. sehingga tidak meracuni mayarakat.2000 ) KIMIA LINGKUNGAN 18 .

khususnya Pb adalah nutrisi. 6 jenis ikan yang biasa di makan turis. Kadar Ca dan Fe yang tinggi dalam makanan akan menurunkan penyerapan Pb.2. Hal ini diperkirakan akibat dari prosesbiokonsentrasi. Cd. konsentrasi beberapa logam berat sudah melampauistandar yang berlaku dan sebagian besar tersalurkan air ke dalam laut. Zn. Dinyatakan pula defisiensi Fe dan Pb akan menyebabkan gangguan ekskresi Pb dari tulang. antara lain: bentuk senyawa dari logam berat itu. dan bila tubuh kekurangan Ca dan Fe. Dampak KasusKepulauan Seribu menunjukkan bahwa konsentrasi beberapa logam beratsudah melampaui standar yang berlaku. ukuran partikel dan beberapa sifat kimia dan fisika lainnya. Cu. Hal ini disebabkan Pb dapat menghambat kerja enzim yang diperlukan untuk pembentukan hemoglobin (Dewi dan Saeni. dan lain-lain dalampemakaiannya diperhatikan menurut standar yang berlaku dan limbah yangdihasilkan diolah melalui pengolahan sehingga tidak mencemari lingkungankhususnya air. Pb. dan Hg dalam konsentrasi yang jauhlebih besar dari yang diperolehkan. a Contoh Kasus Timbal Faktor-faktor yang dapat mempengaruhi kerentanan tubuh terhadap logam berat. Kurang gizi akan meningkatkan kadar Pb yang bebas dalam darah. ternyata juaga mengandung Cd. penyerapan Pb akan meningkat. Dan untuk masyarakat yang mengalami keracunan seharusnya ditindak lanjuti lebih dini. Pengendalian dari kasusUntuk logam-logam berat seperti Hg.Sehingga kualitas air sudah tidak lagi memenuhi syarat bagi perikanan. Cu. Pb. kehamilan dan umur. dan pariwisata ( berenang dan menyelam ).8 Pembahasan Kasus Analisa Kasus Di Kepulauan Seribu. biotalaut. 2010). daya kelarutannya dalam cairan. Zn. sehingga meningkatnya kadaar pada jaringan lunak dan juga menyebabkan hemotoksisitas. Ada beberapa faktor yang mempengaruhi aktivitas keracunan setiap jenis logam berat. Dalam Faktor yang Mempengaruhi Toksisitas Timbal KIMIA LINGKUNGAN 19 . standar yang berlaku telah dilampaui.

Timbale dapat mengganggu enzim oksidase dan akibatnya menghambat sistem metabolism sel. dengan cara menghambatenzim delta aminolevulinik acid dehidratase (delta ALAD) dan feroketalase yangakhirnya meningkatkan ekskresi koproporfirin dalam urin dan delta ALA sertamensintesis Hb. Misalnya merokok dan minum minuan keras) KIMIA LINGKUNGAN 20 .tanda keracunan Pb. ras. status gizi. lebih sering logam berat ini merusak organ-organ detoksikasi dan ekskresi.Timbal menghambat enzim sulfidril untuk mengikat delta-amnolevulinik acid (ALA) menjadi porprobilinogen. sehingga organ-organ ini harus selalu dimonitor untuk mengetahui derajat keracunan terhadap logam berat (Hammond. Ditemukannya sel stipel basofil (basophilic stipping) merupakan gejala dari adanya gangguan metabolik dari pembentukan Hb. salah satu diantaranya adalah menghambat sintesis Hb dalam sumsum tulang. Timbal mengganggu sistem sintesis Hb dengan cara menghambat konversidelta aminolevulinik acid (delta ALAD) menjadi forfobilinogen dan menghambatkorporasi dari Fe ke protoporfirin IX untuk membentuk Hb. Hal ini menyebabkan anemia dan adanya basofilik stipling dari eritrosit yang merupakan cirri khas keracunan timbale. Faktor yang mempengaruhi toksisitas bahan kimia pada manusia adalah: a b c d Tempat Kerja Didalam aliran darah. Kompensasi penurunan sintesis Hb karena terhambat timbal adalah peningkatan produksi erithrofoesis.beberapa kasus. serta protoforvirin IX menjadi Hb. 1979 dalam Darmono 1983). jenis kelamin.Basofilik stipling reteni dari DNA ribosoma dalam sitoplasma eritrosit sehingga mengganggu sintesis protein. faktor genetic dan kebiasaan lain. sebagian besar timbal diserap dalam bentuk ikatan dengan eritrosit.Tetapi. Sel darah merah muda (retikulosit) dan sel stipel kemudian dibebaskan. kesehatan. yaitu hati dan ginjal. Hal ini terjadi karena adanya tanda . logam berat biasanya menyerang jaringan syaraf atau menghambat aktivitas enzimatik melalui reaksi biokimia. Sifat fisik Sifat kimia Cara masuk kedalam tubuh Faktor individu (usia.

Sel darah merah gagal untuk menjadi dewasa dan sel tersebut menyisakan organel yang biasanya menghilang pada proses kedewasaan sel. tetapi dapat juga melalui pernafasan atau kulit dari udara yang terdcemar timbal. Semua bahan pangan mengandung timbal dalam konsentasi yang kecil dan dalam proses mempersiapkan makanan mungkin timbal akan bertambah (Fardiaz. KIMIA LINGKUNGAN 21 . 2008).Paparan inhalasi umumnya terjadi pada kawasan industri. 1995). Paparan pada daerah non-industri terjadi terutama melalui pencernaan. akhirnya poliribosoma ireguler pada agregat RNA membentuk sel stipel (Sudarwin. Absorbsi Timbal dalam Tubuh Timbal masuk ke dalam tubuh terutama melalui saluran pencernaan dari makanan dan minuman. Berikut ini salah satu mekanisme intake manusia terhadap logam berat termasuk Timbal/Timah hitam (Pb): Penyerapan Timbal dapat melalui inhalasi debu timbal atau benda berbahan timbal lainnya.Partikel yang mudah larut menyebabkan absorbsi di paru berlangsung cepat dan luas.

OSHA menyatakan level paparan yang diizinkan (PEL) untuk debu atau asap timbal inorganik adalah 50 mcg/m3 selama 8 jam. serta zat padat. b Absorbsi Melaui Saluran Pencernaan Adapun proses biotransformasi dengan jalur pencernaan adalah dipengaruhi oleh faktor dibawah ini : KIMIA LINGKUNGAN 22 . Keracunan zat – zat kimia melaui saluran pernafasan (inhalasi) adalah yang terpenting dan yang saling sering terjadi ditempat – tempat kerja. Partikel yang diabsorbsi secara inhalasi dengan ukuran <0.terutama pada anak-anak yang mengabsorbsi 45-50% timbal larut dibandingkan pada orang dewasa yang hanya sekitar 10-15%.zat kimia yang terhirup dan menyebabkan keracunan dapat digolongkan menjadi kelompok gas. Zat. Absorsbi zat– zat kimia oleh tubuh dapat melalui saluran pernapasan.5 1>2500 mcg/m3) ditemui selama peledakan. a Absorbsi Melalui Saluran Pernafasan. yang terjadi adalah karena absorbsi saluran pernafasan lebih baik daripada absorsi saluran pencernaan. uap – uap dan mist (kabut) setelah diserap oleh paru – paru akan masuk kedalam aliran darah dan kemudian didistribusikan ke bagian – bagian / organ –organ tubuh lainnya. uap dan mist. Gas – gas. uap-uap atau mists tersebut. uap-uap dan mists yang mudah larut dalam lemak dapat diserap melalui kapiler – kapiler pembuluh darah yang terdapat disekitar alveoli dan selanjutnya zat – zat tersebut dari aliran darah akan menuju ke binding sites yakni jaringan lemak (Fat Depots) yang mempunyai afinitas khusus terhadap gas-gas. Gas – gas iritan yang mudah larut dalam airakan menyebabkan iritasi ini dapat timbul segera setelah inhalasi gas – gas tersebut. pengelasan dan pembakaran potongan logam yang permukaannya dilapisi cat yang berbahan dasar timbal menyebabkan intoksikasi timbal simptomatik dalam satu hari sampai beberapa minggu. dan iritasi biasanya timbul beberapa jam setelah pemaparan (peradangan paru yang akut dan sembab paru). Level yang berbahaya bagi kesehatan dan mengancam jiwa(IDHL) adalah 100 mg/m3. Sedangkan gas tidak mudah larut dalam air akan mengadakan iritasi pada saluran pernafasan bagian bawah. saluran pencernaan dan kulit. Gas –gas.

manusia) atau lewat rantai pangan panjang (tanaman – hewan. Timbal/lead (Pb) dan Zink (Zn) dalam tubuh manusia adalah sebagai berikut: Proses Biotransformasi Logam Berat (Pb) Logam berat masuk ke tubuh manusia melewati rantai pangan pendek (hewan .manusia) yang disebut pencemaran dakhil(Notohadiprawira. unsur logam berat juga dapat masuk ke dalam tubuh melalui pernafasan dan kulit. Pengosongan lambung mampu mengurangi absorbsi senyawa kimia Peristaltik usus yang meningkat akan menghambat absorbsi zat kimia melalui usus Getah lambung dan pankreas mampu menghidrolisis dan mereduksi zat – zat kimia berbahaya. Zat kimia akan menembus kulit dan menyebabkan sensitasi pada kulit Zat kimia akan menembus kulit dan kemudia masuk kedalam aliran darah dan selanjutnya akan menimbulkan efek sistemik. . Makanan dan cairan yang terdapat dalam saluran pencernaan dapat mengencerkan toksin dan membentuk kompleks zat kimia yang mudah larut air c . dan [proses detoksikan menyebabkan absorbsi zat – zat kimia kimia ke dalam darah menjadi kurang efisien dan selektif . Batas toksik dan anjuran/batas aman “intake” logam berat Arsen Apabila terjadi kontak dengan bahan kimiayang banyak terjadi adalah: (As). . Disamping melalui mulut dari makanan dan minuman. Kadmium (Cd). Logam berat KIMIA LINGKUNGAN 23 . Absorbsi Zat Kimia Melalui Kulit Kulit (lemak dan keringat) berfungsi sebagai barier Zat kimia akan bereaksi dengan permukaan kulit dan menyebabkan iritasi primer (asam dan basa kuat serts pelarut organik). . .1995). ..

batrei. dan memiliki kepolaran yang tinggi sehingga mudah di ekskresikan oleh tubuh. dan yang paling banyak ditambahkan pada bensin. Timbal disebut juga sebagai timah hitam. Adanya kontaminasi timbal dalam tubuh dapat diketahui melalui pengukuran kadar timbal dalam darah.1992). konvulsi dan diarrhea. dan rambut. cat (sebagai warnanya). dan air. Selain dari makanan. 1980).mempunyai afinitas yang tinggi terhadap senyawa – senyawa sulfida. Gugus ini banyak terdapat dalam enzim. 1981). anemia. Fase pertama adalah meningkatkan polaritas senyawa toksik sehingga kelarutannya pada air akan meningkat. Proses Biotransformasi adalah proses transpormasi metabolik dimana zat kimia dirubah menjadi zat derifat lain (Metabolit) dalam tubuh manusia. pembentuk darah. Proses ini umumnya menyebabkan terbentuknya metabolit yang mudah larut air. gigi. sehingga hewan akan mengalami sakit perut (kolik) yang hebat. dalam pestisida. 1991). dalam penyepuhan. seperti sulfihidril (-SH) dan disulfida (-S-S)(Petruci.. Racun timah hitam ini biasanya mempengaruhi sistem syaraf. dan tidak mudah larut lemak. Keracunan timah hitam sering terjadi pada hewan ruminansia yang merumput di daerah tercemar (Humphreys. Fase tersebut dikenal dengan fase pertama dari biotransformasi. Tujuan pereaktivan senyawa toksik adalah dengan KIMIA LINGKUNGAN 24 . Biotransformasi umumnya menghasilkan metabolit yang kurang toksik. udara. timbal dalam rambut dapat berasal dari cat rambut yang mengandung timbal asetat dan dapat berasal dari debu (Cohen dan Ros. ginjal dan . yang kemudian berakhir dengan kematian (Bartic dan Piskoc. anoreksia. sehingga dengan terkaitnya logam berat pada gugus ini. banyak digunakan dalam industri kabel. kebutaan. Reduksi. Transformasi metabolik dapat dibagi menjadi emapat kategori diantaranya Oksidasi. Laidler (1991) menyatakan didalam bensin timbal ditambahkan dalam bentuk timbal tetra etil (TEL) dengan rumus molekul (C2H5)4-Pb atau dalam bentuk timbal tetra metil dengan rumus molekul (CH3)4-Pb. Selain itu jufga adanya fase roaksi oksidatif yang bertujuan untuk menambaha kereaktivan senyawa toksik.Hidrolisis dan Konjugasi. logam berat dapat menghambat kerja enzim tertentu.

ginjal. Deposit Organ dan Efek Pb terhadap Kesehatan Penimbunan zat-zat kimia (Chemical Storage) dalam jaringan/organ tubuh dapat terjadi di jaringan atau organ dimana efek zat – zat kimia akan terlihat. sulfur. Hal itu disebabkan senyawa- KIMIA LINGKUNGAN 25 . nitrogen. gizi. Kebanyakan dari reaksi – reaksi ini memerlukan enzim – enzim mikrosomal dan juga oksidase – oksidase yang terdapat dalam sitoplasma dan mitokondria. Terdapat dua macam reaksi oksidasi yaitu penambahan oksigen secara langsung pada unsur – unsur carbon. Pada jaringan atau organ tubuh logam Pb akan terakumulasi pada tulang. Selain itu juga apabila akumulasi pada tubuh semakin meningkat maka seberapa besar kemampuan tubuh dalam mengubah tingkat toksisitasnya masih kurang. Pewarna sintetik umumya sulit umtuk dilakukan proses metabolit yang menjadikannya kurang toksik. Salah satu storage depot yang penting adalah jaringan lemak (Adipose Tissue). merupakan satu – satunya reaksi biotransformasi yang terjadi di dalam tubuh. Adapun faktor – faktor yang mempengaruhi proses biotransformasi adalah : status kesehatan. melalui proses Dehidrogenasi. Meskipun jumlah Pb yang diserap oleh tubuh hanya sedikit ternyata logam Pb ini sangat berbahaya.mempermudah keterikatannya dengan senyawa anti oksidan yang mampu meningkatkan ROX. Disamping itu pada wanita hamil logam Pb dapat dapat melewati plasenta dan kemudian akan ikut masuk dalam sistem peredaran darah janin dan selanjutnya setelah bayi lahir Pb akan dikeluarkan bersama air susu. usia. Pada kasus timah hitam (Pb) dalam tubuh akan ditimbun dalam tulang tetapi manifestasi efek toksiknya akan terlihat pada jaringan – jaringan lunak (syaraf. Peranan Reduksi dalam biotransformasi umumnya adalah kurang begitu penting. Pada reaksi konjugasi grup – grup polar akan di tambahkan pada hasil reaksi pada fase satu. logam ini mampu menggantikan keberadaan ion Ca2+ (kalsium) yang terdapat pada jaringan tulang. Karena dalam bentuk ion Pb2+. dan lain. Oksidasi merupakan reaksi biotransformasi yang paling penting. Fase kedua adalah proses konjugasi.lain)..

disimpan dan kemudian ditampung dalam darah. utamanya bagi anak-anak. Dapat pula menimbulkan anemia dan bagi wanita hamil yang terpajan timbal akan mengenai anak yang disusuinya dan terakumulasi dalam ASI. dan kira-kira 30 % dari jumlah yang terisap melalui hidung akan diabsorbsi melalui saluran pernafasan akan tinggal di dalam tubuh karena dipengaruhi oleh ukuran partikel-partikelnya. . Paparan bahan tercemar Pb dapat menyebabkan gangguanpada organ sebagai berikut : . dan reproduksi. Tidak semua Pb yang terisap atau tertelan ke dalam tubuh akan tertinggal di dalam tubuh.Komponen Pb organik misalnya tetraethil Pb segara dapat terabsorbsi oleh tubuh melalui kulit dan membran mukosa. ataxia. Gangguan terhadap fungsi ginjal Logam berat Pb dapat menyebabkan tidak berfungsinya tubulus renal. Bentuk kimia Pb merupakan faktor penting yang mempengaruhi sifat-sifat Pb di dalam tubuh. sistem syaraf. kemampuan belajar.senyawa Pb dapat memberikan efek racun terhadap berbagai macam fungsi organ tubuh. fibrosis dan KIMIA LINGKUNGAN 26 . Dampak dari timbal sendiri sangat mengerikan bagi manusia. nephropati irreversible. seperti ginjal. stupor dan coma. Pb sebagai gas buang kendaraan bermotor dapat membahayakan kesehatan dan merusak lingkungan. mempengaruhi perilaku dan intelejensia. Kira-kira 5-10 % dari jumlah yang tertelan akan diabsorbsi melalui saluran pencernaan. merusak fungsi organ tubuh. sel tubulusatropi. Di antaranya adalah mempengaruhi fungsi kognitif. sclerosis va skuler. Pb yang terhirup oleh manusia setiap hari akan diserap.Pb organik diabsorbsi terutama melalui saluran pencernaan dan pernafasan dan merupakan sumber Pb utama di dalam tubuh. meningkatkan tekanan darah dan mempengaruhi perkembangan otak. Gangguan neurologi Gangguan neurologi (susunan syaraf) akibat tercemar oleh Pb dapat berupa encephalopathy. memendekkan tinggi badan. Pada anak-anak dapat menimbulkan kejang tubuh dan neuropathy perifer. penurunan fungsi pendengaran.

Gangguan terhadap sistem syaraf Efek pencemaran Pb terhadap kerja otak lebih sensitif pada anakanak dibandingkan pada orang dewasa. . Logam berat Pb mempunyai efek racun terhadap gamet dan dapat menyebabkan cacat kromosom . Pada anak dengan kadar Pb darah (Pb-B) sebesar 40-80 μg/100 ml dapat timbul gejala gangguan hematologis. . halusinasi. mudah tersinggung. gampang tersinggung. Akan timbul gejala tidak spesifik berupa hiperaktifitas atau gangguan psikologis jika terpapar Pb pada anak berusi 21 bulan sampai 18 tahun. Paparan menahun dengan Pb dapat menyebabkan lead encephalopathy. Anemia ringan yang terjadi disertai dengan sedikit peningkatan kadar ALA ( Amino Levulinic Acid) urine. maka pengaruhnya pada profil psikologis dan penampilan pendidikannya akan tampak pada umur sekitar 5-15 tahun. Efek dominan dari keracunan Pb pada sistem hemopoitik adalah peningkatan ekskresi ALA dan CP (Coproporphyrine). Apabila pada masa bayi sudah mulai terpapar oleh Pb. b Contoh Kasus Merkuri 2. tremor. kesakitan dan kematian janin. Pada anak – anak juga terjadi peningkatan ALA dalam darah. sakit kepala. Gangguan terhadap sistem reproduksi Logam berat Pb dapat menyebabkan gangguan pada sistem reproduksi berupa keguguran. Gangguan terhadap sistem hemopoitik Keracunan Pb dapat dapat menyebabkan terjadinya anemia akibat penurunan sintesis globin walaupun tak tampak adanya penurunan kadar zat besi dalam serum. Gejala yang timbul pada lead encephalopathy antara lain adalah rasa cangung. gampang lupa. sukar konsentrasi dan menurunnya kecerdasan.sclerosis glumerolus.3-dimercapto-succinic acid (DMSA) KIMIA LINGKUNGAN 27 . namun belum tampak adanya gejala lead encephalopathy. Akibatnya dapat menimbulkan aminoaciduria dan glukosuria. dan jika paparannya terus berlanjut dapat terjadi nefritis kronis. dan penurunan pembentukan konsep. Gambaran klinis yang timbul adalah rasa malas.

( Khalil : 2011 KIMIA LINGKUNGAN 28 . Rusia dan Republik Rakyat China. yang tidak terkontaminasi merkuri. DMSA akan mengikat merkuri yang terikat pada gugus thiol pada sistein dan kemudian nantinya akan dikeluarkan bersama urine. Senyawa ini telah digunakan dalam penanganan keracunan merkuri sejak tahun 1950-an di Jepang. diekskresikan melalui urin dalam bentuk disulfida dengan gugus thiol sistein. seperti vitamin E dan vitamin C. Dalam upaya mempercepat proses pengeluaran merkuri dalam tubuh manusia. dalam upaya mengurangi gangguan kesehatan sebagai akibat pembentukan radikal bebas oleh merkuri. Serangkaian penelitian menunjukkan bahwa DMSA mampu mengeluarkan 65 % merkuri dari dalam tubuh manusia dalam selang waktu tiga jam (Patrick : 2002) DMSA relatif aman digunakan sebagai khelator. 90 % DMSA yang diabsorbsi tubuh.2.3-dimercapto-succinic acid (DMSA) merupakan senyawa organik yang larut dalam air. Dalam tubuh. DMSA Senyawa organik yang dikenal juga dengan nama dagang chemet ini merupakan khelator yang efektif dalam penanganan keracunan logam berat seperti timbal. DMSA juga dapat digunakan bersamaan dengan anti oksidan. manusia. Pada manusia normal. Sedangkan sisanya berada dalam bentuk bebas atau tanpa ikatan dengan gugus lain. DMSA dapat digunakan bersamaan dengan khelator lain seperti ALA (Alpha Lipoic Acid). Gambar 1. arsen dan merkuri. yang mengandung dua gugus tiol (-SH). dan sejak tahun 1970-an digunakan di Eropa dan Amerika Serikat.

7 ppm. bayi.4 hingga 9. Kesukaran diagnose tersebut disebabkan oleh karena panjangnya periode laten dari mulai terpapar sampai timbulnya gejala dan tidak jelasnya bentuk gejala yang timbul. yang mirip dengan kelainan psikiatrik.Pada studi epidemiologi ditemukan bahwa keracunan metil dan etil merkuri sebagian besar di sebabkan oleh konsumsi ikan yang di peroleh dari daerah tercemar atau makanan yang berbahan baku tumbuhan yang disemprot dengan pestisida jenis fungisida alkil merkuri. Penelitian Eto (1999). ditemukan juga deformitas KIMIA LINGKUNGAN 29 .6%-81. c Kasus Flour InsidensiFluorisisgigi di 10 desaIndia Tengah yang ditelitisecararinci. Berdasarkan temuan Diner dan Brenner (1998) serta Frackelton dan Christensen (1998) dikatakan bahwa diagno se klinis keracunan tidaklah mudah dan sering dikaburkan dengan diagnose Hg kelainan merupakan gangguan psikologik berupa rasa cemas dan kadang timbul sifat psikiatrik dan autisme.8%-70. menyimpulkan bahwa efek keracunan Hg tergantung dari kepekaan individu dan faktor genetik.4% padaanak-anakdan 13. dan orang tua. Pada tahun 1968 Katsuna melaporkan adanya epidemic keracunan Hg di Teluk Minamata. untuklokasi yang sama. sebesar 1 ppm. Gejala yang timbul akibat keracunan agresi. Hg dapat anak-anak. semuanyadiatasstandar yang berlaku. Selain Fluorosis gigi. Individu yang peka terhadap keracunan Hg adalah anak dalam kandungan (prenatal). kadar Hg pada ikan di Teluk Minamata sebesar 11 µg/kg berat basah dan di sungai Agano sebesar 10 µg/kg berat basah.7% pada orang dewasa. berkisarantara 22. Di Irak pada tahun 1971-1972 terjadi keracunan alkil merkuri akibat mengkonsumsi gandum yang disemprot dengan alkil merkuri yang menyebabkan 500 orang meninggal dunia dan 6000 orang masuk rumah sakit. dan pada tahun 1967 terjadi pencemaran Hg di sungai Agano di Nigata. Pada saat terjadi epidemi. apabilakadarfluor rata-rata dalam air diurutdari yang terkecilhingga yang terbesaradalah 1.

Penelitian di Indonesia menunjukkanadanya Fluorosis gigi yang ditemukansekitargunungapi. Penyakit retak panggul terjadi karena meminum air yang mengandungfluor yang mampu meningkatkan risiko retak panggul hingga dua kali lipat bagi pria dan wanita lanjut usia hanya dengan 0. infeltirasi. Kemudian terdapat efek kronis. Studi yang dilakukan National Cancer Institute Toxicological Program menemukan bahwa fluorida bisa digolongkan sebagai karsinogen. maka sapi tersebut terpaksa harus disembelih. Fluorosis yang mengancam kesehatan ini memiliki efek akut dan kronis.89 ppm.kerangka. kanker. Dari berbagai uji toksisitas yang telah dilakukan banyak sekali fakta bahwa fluorida sangat membahayakan pengguna. Ilmuwan FDA (Food and Drug Administration) melaporkan adanya korelasi kuat antara penurunan tingkat fertilitas wanita dalam rentan gusis 10-49 tahun dengan peningkatan level fluorida. karena tidak sanggup lagi berdiri.000 kematian akibat kanker karena fluorida pada tahun 1988. Dalampenelitian yang sama. ditemukan pula bahwa fluorosis gigianakmulaitampakpada intake F> 1 mg tiaphari (Indah. Kepala Kimiawan di National Cancer Institute AS. 1970). kerusakan otak. Di Segalaherang. Apabila terjadi patah tulang pada ternak sapi misalnya. Keracunan Fluor demikian telah merugikan banyak peternak (Shupe. sekitar Gunung Tangkuban parahu didapat insiden Fluorosis anak sebesar 41.1 ppm kandungan fluor konsumsi tiap saat. dan Alzheimer.7% dan sekitar Gunung Ijen di Asembagussebesar 100% (Suwondo.47-2. 1989). yaitu retak panggul. 1979). memiliki kadar fluor tinggi yaitu sekitar 38 ppm dan mengakibatkan kematian massal puluhanjuta orang karena menderita artritis parah. melaporkan setidaknya 40. Ciater. Terakhir penelitian Varnier J A yang dilaporkan dalam Wall Street KIMIA LINGKUNGAN 30 . Ternyatahubunganstatistikkadar F didalam air teh di Segalaherang yang mengandung F sebesar 22. Keracunan Fluor akibatemisi F keudara dari berbagai industri seringkali menyebabkan Fluorosis padat ernas. Efek akut yang ada terjadi pada konsumsi air minum dari air sumur yang belum diuji di India Tengah.

2006). Dampak Arsen Terhadap Kesehatan Manusia KIMIA LINGKUNGAN 31 . D. akan menunjang percepatan mobilisasi unsur-unsur berpotensi racun. Sumber pencemaran arsen juga dapat berasal dari: 1. Pencemaran arsen terdapat di sekitar pelelehan logam (tembaga dan timah hitam).Pusat listrik tenaga panas bumi (geothermal) yang dapat menyebabkan kontaminasi arsen pada udara ambient.Pupuk yang di dalamnya mengandung arsen. yang mempunyai sifat sangat beracun.Pembakaran kayu yang diawetkan oleh senyawa arsen pentavalen. limbah unsur pencemar kemungkinan tersebar di sekitar wilayah tersebut dan dapat menyebabkan pencemaran lingkungan.Journal menyebutkan bahwa fluorida menyebabkan kerusakan otak dan mal fungsi koordinasi tubuh setelah termagnifikasi. 2. Tingginya tingkat pelapukan kimiawi dan aktivitas biokimia pada wilayah tropis. dapat menaikkan kadar arsen di udara. Arsen merupakan salah satu hasil sampingan dari proses pengolahan bijih logam non-besi terutama emas. Selanjutnya dapat memasuki sistem air permukaan atau merembes ke dalam akifer-akifer air tanah setempat. Bahaya pencemaran lingkungan ini terbentuk jika tailing yang mengandung unsur tersebut tidak ditangani secara tepat. 3. Ini terjadi di negara-negara yang memproduksi emas dan logam dasar (Herman.Z. Ketika tailing dari suatu kegiatan pertambangan dibuang di dataran atau badan air. d Arsenik Pencemaran Arsen dalam Lingkungan Pembakaran batubara dan pelelehan logam merupakan sumber utama pencemaran arsen dalam udara.

WHO menetapkan ambang aman tertinggi arsen dalam air tanah sebesar 50 ppb (www. Dosis rendah akan mengakibatkan kerusakan jaringan. luka di hati dan ginjal.( Wijanto. 2005). gunakan sabun. Kalau bahan kimianya sudah tertelan. Salah satu akibat yang merugikan dari arsen adalah apabila dalam air minum mengandung unsur arsen melebihi nilai ambang batas. gangguan fungsi jantung. mual. yang dapat mengakibatkan kematian. Gejala keracunan kronis yang ditimbulkannya pada tubuh manusia berupa iritasi usus. sebaiknya diberi antidotumnya. korban diberi ipekak untuk merangsangnya muntah. nyeri. 2009). yaitu suntikan intramuskuler KIMIA LINGKUNGAN 32 . kerusakan pembuluh darah. minum kurang lebih 250 ml air dan jangan memaksakan muntah.wikipedia. Pemberian katartik atau karboaktif dapat bermanfaat. Baju yang terkontaminasi harus dilepaskan. kerusakan syaraf dan sel. Kemudian segera ke dokter untuk mendapat pertolongan medis. masukkan air dalam jumlah yang cukup besar ke dalam mulut untuk mencuci. Arsen inorganik telah dikenal sebagai racun manusia sejak lama. Untuk keracunan akut yang belum berlangsung 4 jam. Bila melalui mulut. atau sampai tidak ada kandungan bahan kimia di atas kulit. Sementara bila racun masuk ke pencernaan. Sedangkan untuk keracunan yang sudah berlangsung lebih lama (termasuk juga keracunan kronik). Bila perlu. Berikut ini adalah implikasi klinik akibat tercemar oleh arsen: Cara Mengatasi Keracunan Arsenik Pertolongan pertama (standart treatment) bila kulit kita terpapar arsenik: cuci permukaan kulit dengan air mengalir secara kontinu kurang lebih 10 menit. kelainan kulit atau melanoma serta kanker usus. Tetapi. Air tanah biasa digunakan sebagai sumber air minum bagi kelangsungan hidup manusia. pada umumnya efek yang timbul adalah iritasi saluran makanan.org. air jangan tertelan. muntah dan diare. Selain itu mengakibatkan penurunan pembentukan sel darah merah dan putih. yaitu bila kadarnya melebihi 100 ppb dalam air minum. Dapat juga dilakukan bilas lambung apabila ia tidak dapat minum. Segera cari pertolongan medis. Cara mengatasi keracunan arsenik berbeda antara keracunan akut dan kronik.

Zat yang mengandung belerang dalam bawang putih dapat mengurangi kadar arsen dalam jaringan dan darah.dimerkaprol 3-5 mg/kgBB 4-6 kali sehari selama 2 hari. KIMIA LINGKUNGAN 33 . Selain itu. ada penelitian menarik yang dilakukan oleh Keya Chaudhuri dan rekan-rekannya dari Indian Institute of Chemical Biology di Kolkata dalam jurnal Food and Chemical Toxicology.com. Mereka melakukan uji coba pada tikus.terselubung. Dimercaprol jauh lebih beracun daripada succimer. Pengobatan dilanjutkan 2-3 kali sehari selama 8 hari ( www. Tikus yang diberi makan ekstrak bawang putih kandungan arsenik dalam darah dan hatinya berkurang 40 persen dan 45 persen dari arsen juga di keluarkan lewat air seni tikus tersebut. 2009).blogspot. Dimercaprol dan asam dimercaptosuccinic adalah agen chelating yang mengambil arsenik dari protein darah dan digunakan untuk mengobati keracunan arsenik akut. Sehingga mereka yang tinggal di daerah yang beresiko terkontaminasi arsenik dalam air disarankan untuk mengonsumsi satu sampai tiga siung bawang putih per hari sebagai pencegahan keracunan arsen. Metode kimia dan sintetik saat ini digunakan untuk mengobati keracunan arsenik.

industry bahan kimia. . yang masuk ke dalam perairan. Proses pencemaran air oleh logam berat melalui interaksi suatu komponen lingkungan daratan. Kesimpulan : Pencemaran adalah masuknya atau dimasukkannya makhluk hidup dankomponen lain yang berasal dari alamiah atau aktivitas manusia ke dalam komponen ( air. yang bisa merusak lingkungan khususnya perairan. . Cara pengendalian pencemaran air oleh logam berat dengan Pengolahan limbah industri sebelum dibuang ke tempat pembuangan. limbah industri. Contohnya PP No. di mana buangan limbah dari daratan akan bermuara ke laut. limbah pertanian dan perumahan. . Sumber-sumber pencemaran adalah partikel kimia.BAB III PENUTUP 3.2 Saran Saran dari penyusun adalah kita telah mengetahui logam berat itu berbahaya jika masuk dalam tubuh dan hendaknya kita bias mengontrol keluar masuknya limbah yang mengandung logam berat. pertambangan (emas).Sedangkan indikator terjadinya pencemaran lingkungan dapat dilihat dari aspek kimia-fisika pencemran air dan aspek kimia pencemaran. KIMIA LINGKUNGAN 34 . tanah dan udara) sehingga tidak sesuai lagi dengan peruntukannya.1 . 20/1990 tentang Pengendalian Pencemaran Air. Berdasarkan pembahasan tersebut dapat disimpulkan bahwa 3.

You're Reading a Free Preview

Download
scribd
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->