A. Fraktur 1. Pengertian Fraktur adalah : terputusnya hubungan / kontinuitas jarin¬gan tulang (Syamsuhidayat, 1997).

Fraktur adalah terputusnya kontinuitas jaringan tulang atau tulang rawan yang umumnya disebabkan oleh rudapaksa. (Mansjoer, Arif. 1999) Fraktur adalah terputusnya kontinuitas tulang, tulang rawan sendi, tulang rawan epifisis, baik yang bersifat total maupun yang parsial. (Rasjad, Chairuddin. 2007) 2. Anatomi dan fisiologi a. Tulang dalam garis besarnya di bagi atas : 1) Tulang panjang Yang termasuk tulang panjang misalnya femur, tibia, fibula, ulna, dan humerus, dimana daerah batas disebut diafisis dan daerah yang berdekatan dengan garis epifisis di sebut metafisis. Daerah ini merupakan suatu daerah yang sangat sering ditemukan adanya kelainan atau penyakit, oleh karena itu daerah ini merupakan daerah metabolik yang aktif dan banyak mengandung pembuluh darah. Kerusakan atau kelainan perkembangan pada daerah lempeng episis akan menyebabkan kelainan pertumbuhan tulang. 2) Tulang pendek Contoh dari tulang pendek antara lain tulang vertebra dan tulang-tulang karpal. 3) Tulang pipih Yang termasuk tulang pipih antara lain tilang iga, tulang skapula, dan tulang pelvis. Tulang yang terdiri dari bagian yang kompak pada bagian luar yang disebut korteks dan bagian dalam yang bersifat spongiosa berbentuk trabekula dan di luarnya dilapisi oleh periosteum. Periosteum pada anak lebih tebal dari pada orang dewasa yang memungkinkan penyembuhan tulang pada anak lebih cepat dibandingkan dengan orang dewasa. b. Fungsi tulang sebagai struktur dan organ Tulang adalah jaringan yang terstruktur dengan baik dan mempunyai lima fungsi utama, yaitu : 1) Membentuk rangka badan 2) Sebagai tempat melekatnya otot 3) Sebagai bagian dari tubuh untuk melindungi dan mempertahankan alat-alat dalam, seperti otak, sumsum tulang belakang , jantung dan paru-paru 4) Sebagai tempat deposit kalsium, fosfor, magnesium dan garam 5) Sebagai organ yang berfungsi sebagai jaringan hemopoetik untuk memproduksi selsel darah merah, sel-sel darah putih dan trombosit. c. Sel-sel tulang dan fungsinya

Osteoblas merupakan salah satu jenis sel hasil diferensiasi sel mesenkim yang sangat penting dalam proses osteogenesis atau osifikasi. Sebagai sel, osteblas dapat memproduksi substansi organik intraseluler atau matriks dimana kasifikasi terjadi dikemudian hari. Jaringan yang tidak mengandung kalsium disebut osteoid dan apabila kalsifikasi terjadi pada matriks maka jaringan di sebut tulang. Sesaat setelah osteoblas dikelelengi oleh substsansi organik intraseluler disebut osteosit dimana keadaan ini terjadi di dalam lakuna. Sel yang bersifat multi nukleus tidak di tutupi oleh permukaan tulang dengan sifat dan fungsi resorpsi serta mengeluarkan tulang yang di sebut osteoklas. Kalsium hanya dapat dikeluarkan melalui tulang dari proses aktivitas osteoklasis yang menghilangkan matriks organik dan kalsium secara bersamaan dan di sebut deosifikasi. d. Anatomi Tangan Ada tiga macam tulang yang menyusun tangan, yaitu: 1) Tulang Pergelangan Tangan (Karpus) Pergelangan tangan terbentuk dari delapan tulang karpal irteguler yang tersusun dalam dua baris, dan setiap barisnya terdiri dari empat tulang. Barisan tulang karpal proksimal yang terdiri dari navicular(skafoid),lunatum, trikuetral(triangular),dan pisiform. Barisan tulang karpal distal yang terdiri dari: Trapezium, Trapezoid, Kapitatum, Hamatum. 2) Tangan (metacarpus) Tangan tersusun dari lima tulang metakarpal’dimana semua tulang metacarpal berukuran serupa kecuali tulang metacarpal pertama pada ibujari. Setiap tulang metacarpal memiliki sebuah dasar proksimal yang berartikulasi dengan barisan distal tulang karpal pergelangan tangan.kepala tulang metacarpal membentuk buku jari yang menonjol pada tangan. 3) Tulang – tulang jari (phalanges) Setiap jari memiliki tiga tulang yaitu tulang proksimal,tulang medial, dan tulang distal, kecuali ibu jari yang hanya memiliki tulang proksimal dan medial saja. ( Sloane, 2003 ) 3. Etiologi a. Trauma langsung : benturan pada tulang yang menyebabkan fraktur pada tempat benturan contoh : kecelakaan lalu lintas. b. Trauma tidak langsung : jika titik tumpul benturan dengan terjadinya fraktur berjauhan, jatuh dari ketinggian dengan berdiri atau duduk sehingga terjadi fraktur tulang belakang. c. Proses suatu penyakit Penyakit yang melemahkan tulang, misalnya metastase kanker atau osteomielitis. 4. Patofisiologi Daya

Tulang Fraktur

Perdarahan

5. Klasifikasi Fraktur a. Menurut jumlah garis fraktur 1) Simple fraktur 2) Multiple fraktur 3) Comminute fractur : hanya terdapat satu garis fraktur : terdapat lebih dari satu garis : terjadi banyak garis fraktur atau banyak fragmen kecil yang terlepas. b. Menurut garis fraktur 1) Fraktur inkomplit 2) Fraktur komplit 3) Hair line fraktur : tulang tidak terpotong secara total

Com) . : garis fraktur hampir tak tampak sehingga bentuk tulang tak ada perubahan.1 Tipe fraktur Sumber : (medicastrore. Menurut bentuk fragmen 1) Fraktur transversal 2) Fraktur oblique 3) Fraktur spiral : bentuk fragmen melintang : bentuk fragmen miring : bentuk fragmen melingkar 2. c.: tulang terpotong secara total.

Pada waktu yang sama pembentukan tuoang yang sebenarnya callus dibentuk dari aktvitas osteoblast dan osteoklast. kontaminasi besar misal : luka tembak Fraktur tertutup : fragmen tulang tak berhubungan dengan dunia luar. Sel-sel dari lapisan dalam periosteum berproliferasi pada sekitar fraktur. Fraktur terbuka : fragmen tulang sampai menembus kulit Fraktur terbuka dibagi menjadi 3 (tiga) tingkat : 1) Pecahan tulang menusuk kulit. Hal ini melindungi fragmen tulang tapi tidak memberikan kekuatan callus sementara ini meluas melebihi garis fraktur. Setelah beberapa hari kombinasi dari periosteum yang meningkat dengan fase granulasi membentuk collar di lujung fraktur. 5) Konsolidasi dan Remodelling. 2) Proliferasi sel. kehancuran otot kerusakan neurovaskuler. osteogenesis ini berlangsung terus. kontaminasi ringan. callus sementara meluas. . Proses ini terjadi selama 3-10 minggu. Setelah 24 jam suplai darah ke ujung fraktur meningkat. luka > 1 cm ( misal fraktur comminutive) 3) Luka besar sampai lebih kurang 8 cm. e. 4) Ossification Callus yang menetap / permanen menjadikan tulang kaku karena adanya penumpukan garam-garam calcium dan bersatu bersama ujung-ujung tulang. dimana sel-sel ini menjadi precusor dari osteoblast. luka < 1 cm. menganyam massa tulang dan cartilago sehingga diameter tulang melebihi normal. Sementara pembentukan cartilago dan matrik tulang diawali dari jaringan callus yang lunak. Tahap dan Proses Penyembuhan Tulang. kerusakan jaringan sedikit. 1) Haematoma Dalam 24 jam mulai pembekuan darah dan terjadi hematom di sekitar fraktur. 3) Pembentukan callus 6-10 hari setelah fraktur jaringan granulasi berubah dan memben¬tuk callus. Proses ossifikasi ini mulai dari callus bagian luar kemuadian bagian dalam dan terakhir bagian tenagh. Resiko terjadi infeksi lebih besar.d. Kelebihan-kelebihan tulang seperti dipahat dan diabsorbsi dari callus. 2) Kerusakan jaringan sedang. hematoma ini mengelilingi fraktur dan tidak di absorbsi selama penyembuhan tapi berubah dan berkembang menjadi granulasi. lapisan fibrosa periosteum melebihi tulang. Menurut hubungan antara fragmen dengan dunia luar. Proses pembentukan lagi ditentukan oleh beban tekanan dari otot. Callus ini bertambah banyak.

b. non union. Echymosis f. laserasi d. spasme otot h. sehingga ujung patahan saling bertumpuk. Rasa gemeretak ketika ujung tulang bergeser. Fungsileosa ( gangguan fungsi) g. 2) Pemendekan tonus otot-otot ekstremitas menarik patahan tulang. dan cross union). ekimosis sekitar lokasi cedera c. inkomplit. Kemungkinan lain : kehilangan sensasi mobilisasi yang abnormal Hypovolemik shock 7. dan sindroma compartement. Segera ( immediate) Komplikasi yang dapat terjadi segera setelah fraktur antara lain. Komplikasi a. shock neurogenik. kehilangan fungsi daerah yang cedera . delayed union. tetanus. penyembuhan tulang terganggu ( mal union. kerusakan organ. Deformitas.6. Gambaran Klinis Fraktur a. deformitas yang nampak jelas b. Pemeriksaan fisik 1) Mengidentifikasi tipe fraktur ( komplit. kerusakan syaraf. nekrosis. edema . perubahan warna kulit e. degenerasi sendi. b. Oedema e. Early complication Early komplikasi yang dapat terjadi : osteomyelitis. 2) Inspeksi daerah mana yang terkena:. dapat berupa : 1) Angulasi Karena adanya kekerasan mengakibatkan otot-otot ekstremitas menarik patahan tulang. Jika frakturnya terbuka ujung patahan tulang dapat terlihat di dalam luka. dan lain-lain). c. Krepitasi . emboli. Nyeri Nyeri tekan dan pembengkakan di sekitar bagian fraktur. c. a. d. Late complication Sedangkan komplikasi lanjut yang dapat terjadi antara lain stiffnes ( kaku sendi). dan injury / perlukaan kulit.

Dengan membalut plester yang lunak di atas tonjolan tulang biasanya dapat mencegah timbulnya ulserasi tekanan dan dapat memaksimalkan kemampuan gips tersebut untuk mempertahankan posisi fragmen fraktur. krepitasi c. Ca dan P 2) Radiologi : a. namun harus melewati sendi di atas dan di bawah fraktur. terpasang alat immobilisasi pada lokasi cedera.. adanya nyeri dan penyebaran b. b. Untuk melihat beratnya cedera/ lokasi b. kepucatan parestesi dan lenyapnya denyut nadi . Reduksi dan pemasangan gips seringkali dapat di selesaikan dalam jam sesudah terjadi cedera. Imobilisasi Imobilisasi untuk memungkinkan kesembuhan fragmen yang dipersatukan dengan cara : c. bengkak. Ht. semua ini adalah tanda-tanda dari disfungsi neurovaskuler. nadi. Untuk melihat perkembangan tulang. leuco. dingin d. gips digunakan untuk mempertahankan reduksi. maka suplai darah dan syaraf ke ekstremitas yang cedera harus benar benar diperhatikan. Yaitu saat pembengkakan jaringan lunak belum maksimal. LED. mengelilingi seluruh ekstremitas. Reposisi Setiap pergeseran atau angulasi pada ujung patahan harus direposisi dengan hati-hati melalui tindakan manipulasi yang biasanya dilakukan dengan anesthesi umum. Penatalaksanaan Kesembuhan fraktur dapat dibantu oleh aliran darah yang baik dan stabilitas ujung patahan tulang. Fiksasi eksterna. Fraktur di imobilisasi dengan bidai atau gips dan traksi. Pemeriksaan diagnostik 1) Laboratorium Hb. 9. . gips sebaiknya tidak berlaminasi dan sesuai dengan geometri tulang yang diberi gips tersebut. 8. selain itu proses reduksi juga dapat memberberat edema jaringan yang sudah ada. Namun karena gips dipasang berbentuk melingkar. Penggunaan gips dan traksi 1) Penggunaan gips Secara umum. observasi spasme otot sekitar daerah fraktur e. a. ekstremitas harus diletakkan lebih tinggi bagian distal ekstremitas yang mengalami cedera harus diperiksa berulang ulang guna mengawasi perkembangan nyeri.3) Palpasi : a.

gips tidak dapat digunakan lagi. Tekanan suplai darah dapat menimbulkan perubahan patologik yang tidak reversible bila dibiarkan selama satu setengah jam. 2. bukan dengan traksi kulit. Traksi dilakukan dengan menempelkan beban dengan tali pada ekstremitas biasanya lebih disukai traksi rangka dengan pin baja steril yang dimasuk¬kan melalui fragmen distal atau tulang yang lebih distal melalui pembedahan. 4. Gips tidak boleh longgar atau terlalu kecil. long leg. Mencegah dan memperbaiki deformitas. Tujuan pengunaan gips adalah : 1. Pada beberapa jam pertama setelah terjadi cedera. Mengimobilisasi . 2) Penggunaan Traksi Metode lain yang baik untuk mempertahankan reduksi ekstremitas yang mengalami fraktur adalah dengan traksi. mensupport.Semua keluhan penderita yang tetap dirasakan setelah reduksi harus benar-benar mendapat perhatian. melindungi selama proses penyem¬buhan tulang patah. Hal ini dapat menghilangkan nyeri lyang timbul dari nekrosis jarin¬gan. Bentuk bentuk traksi biasanya akan membuat ekstremitas yang patah terangkat lebih tinggi sehingga dapat mengurangi pembengkakan dan meningkatkan penyembuhan jaringan lunak. hip spica. silinder. dipasang paha kiri rangka sebaiknya menimbulkan gaya tarik yang segaris dengan sumbu panjang normal tulang pan¬jang yang patah. c) Ada tulang yang menonjol sebaiknya diberi lapisan khusus dan terlindung dengan baik. Bila sudah parah. Gips yang tidak pas dapat menimbulkan perlukaan. b) Berat ekstremitas maupun alat-alat penyokong sebaiknya seimban¬gan dengan pemberat untuk menjamin agar reduksi dapat dipertahan¬kan secara stabil dan mendukung ekstremitas yang patah. Perhatikan integritas kulit selama pemasangan gips. pemberian obat-obat narkotik secara berulang-ulang adalah suatu kontraindikasi. 3. short arm. Indikasi pemasangan gips: Macam-macam gips : short leg. d) Traksi dapat bergerak bebas melalui katrol e) Pemberat harus cukup tinggi diatas permukaan lantai dengan klien dalam posisi normal diatas tempat tidur sehingga perubahan posisi rutin tidak menyebabkan pemberat terletak dilantai sehing¬ga kehilangan regangan tali. . Sewaktu memasang atau mempertahankan traksi ada beberapa faktor penting yang harus dipertimbangkan: a) Tali utama. Yang perlu diperhatikan pada pemasangan gips: 1. 2.

2. Demikian juga jaringan sekitar. b) Mengistirahatkan sendi yang implamasi c) Koreksi deformitas. Fiksasi internal dilaksanakan dalam tehnik asepsis yang sangat ketat dan klien untuk beberapa saat mendapat antibiotik untuk pence¬gahan setelah pembedahan. k) Hindari komplikasi tirah baring. a. Open Reduksi intra fiksasi (ORIF) Pembedahan reduksi terbuka pada patah tulang keuntungannya tulang yang patah dapat terlihat. Fiksasi dilakukan dengan menyatukan patahan tulang dengan memasang plate. Fiksasi interna / pembedahan. wire atau sekrup dengan tindakan operasi. Transfixian screw / skreu tembus. Alat-alat fiksasi internal adalah : 1. . d) Menghilangkan nyeri karena spasmeotot. c) perlu penggunaan alat-alat yang banyak d) Indikasi penggunaan traksi : Tujuan Traksi: a) Mempertahankan/ memperbaiki alignment tulang paska fraktur. Pelat dan skup seperti neufeld dan kuntscher. Rumus untuk pemberian traksi : 1) dewasa 1/3 x BB 2) anak-anak 1/13 x BB d. Prinsip-prinsip: a) adekuat counter traksi b) adanya kekuatan melakukan beban traksi c) sesuai dengan poros d) semua sistem harus bebas dari fiksi / tersangkut e) klien teriformasi f) penilaian terus menerus terhadap kepatenan traksi g) Observasi neurovaskuler h) observai adanya nyeri i) firm matters untuk good aligment. e) Mengurangi dislokasi sendi.f) Traksi yang dipasang harus baik dan terasa nyaman Kerugian penggunaan traksi : a) perawatan rumah sakit lebih lama b) mobilisasi terbatas. j) Perineal care yang benar.

Untuk mempertahan¬kan keutuhan organ tubuh digunakantransplantasi tulang. Prostetic implans / pencangkokan alat prostetik. b. tapi adakalanya dilakukan pada faktur dimana tulang tidak dapat lagi disatukan ( hancur ). Analgetik Diberikan untuk mengurangi rasa sakit yang timbul akibat trau¬ma. dan biasanya ditambah dengan suplemen vitamin. negatif. Penyakit yang dapat memperberat dan mempermudah terjadinya frak-tur : 1) Osteomyelitis acute 2) Osteomyelitis kronik 3) Osteomalacia 4) Osteo porosis 5) Gout dan gouty 6) Rheumatoid arthritis. adanya jaringan nekrotik di sekitar luka akan memperlambat proses pen-yembuhan. Fungsi penyangga badan (Weight Bearing ) diperbolehkan setelah terbentuk cukup callus. e. antipiretik. Pada fraktur tertutup jarang terjadi kontak langsung dengan udara luar. obat yang paling baik ditemukan . Prinsip pengobatannya antara lain antibiotik. Intermedullary rod / batang menembus sumsum. Pemberian antibiotika digunakan untuk menghambat terjadi infeksi lokal dan sistemik. Fisiotherapi dan mobilisasi Fisiotherapi dilakukan untuk mempertahankan supaya otot tidak mengecil. toxoid. Nyeri yang timbul dapat menyebabkan klien gelisah sampai dengan shock. keefektifan pengobatan ditentukan oleh : 1) Kontaminasi kuman terhadap luka. Pada fraktur terbuka umumnya luka kontak dengan udara luar yang banyak ditemukan bakteri gram positif dan gram. Prinsip pengobatan yang diberikan sesuai dengan jenis dan kondisi fraktur. 2) Adanya penyakit lain yang memper¬berat dan mempermudah terjadinya fraktur. seperti austin moore protesis. Antibiotik Pengobatan antibiotik pada fraktur tidaklah spesifik.3. Ungkapan rasa nyeri dan ketidaknyamanan. analgetik. Setelah fraktur mulai sembuh mobilisasi sendi dapat dimulai sampai ekstremitas betul-betul telah kembali normal. Ini akan juga mempengaruhi kerja otot terhadap tulang. Debridement Pembersihan luka fraktur terbuka dari jaringan nekrotik. c. Transplantasi tulang Jarang dilakukan. yang dikenal dengan shock analgetik. 4.

jenis kelamin. Identitas pasien dan keluarga : a) Nama Pasien. Konsep Asuhan Keperawatan Dalam melaksanakan asuhan keperawatan terhadap pasien. aspirin harus diminum setiap hari sesuai dengan kebutuhan individu dan pada beberapa orang boleh diberikan dosis ganda untuk efek yang diinginkan. umur. diagnosa keperawatan. observasi dan pemeriksaan fisik. pendidikan. agama. b. pekerjaan. Tahap pengkajian terdiri atas tiga kegiatan yaitu : a. “Proses keperawatan terdiri dari lima tahap : pengkajian. sosial dan spiritual. nama. Pemeriksaan fisik Kebiasaan sehari-hari : a) Pola nutrisi : Bagaimana kebiasaan klien dalam memenuhi nutrisi. umur/tanggal lahir. b) Nama ayah. alamat. Pengumpulan data yang akurat dan sistematik akan membantu me¬nentukan status kesehatan dan pola pertahanan pasien serta memudahkan perumusan diagnosa keperawatan. pendidikan. . frekuensi makan. Pengkajian Pengkajian adalah langkah awal dan dasar bagi seorang perawat dalam melakukan pendekatan secara sistematis untuk mengumpulkan data dan menganalisa sehingga dapat diketahui kebutuhan pasien terse¬but. Iritasi lambung memungkinkan kehilangan darah sedikit melalui saluran gastrointestinal akan dijumpai pada beberapa klien sehingga dapat menimbulkan anemia ringan . Pengumpulan data Pengumpulan data dilakukan secara sistematis. d) Saudara kandung. umur. pekerjaan. jumlah.secara umum efek samping : tinitus dan penurunan pendengaran yang reversible setelah obat bekerja . jika diberi aspirin harus dikombi¬nasi dengan antasid. agama. perawat memandang pasien sebagai individu yang utuh terdiri dari bio. B. alamat. pelaksanaan dan evaluasi. dan makanan tambahan. umur. sama baiknya dengan analgetik untuk mendapatkan efek ini. c) Nama ibu. secara umum dalam bentuk aspirin ( asetil salicilat asam ) Tujuan dari therapi aspirin adalah untuk mengatur kemampuan dosis obat sebagai efek anti inflamasi . kultur.” 1. Klien dengan iritasi lambung.adalah salisilate. perencanaan. psiko. agama. Griffith-Kenney dan Christensen (1986) mendefinisikan proses keperawatan sebagai aktifitas yang logis dan rasional untuk melakukan praktek keperawatan secara sistematis. kultur. mempunyai kebutuhan sesuai tingkat pertumbuhan dan perkembangannya. pendidikan. dan keterangan. sodium dapat digunakan. anak ke. bertujuan untuk mendapatkan data yang penting tentang pasien dengan cara wawancara.

dan lain-lain. 1) Deformity yang nampak jelas 2) Edema . e. jangan merubah posisi fraktur karena akan memperberat keadaan. pernah mengalami kecelakaan. c. Riwayat kesehatan masa lalu Apakah pernah dirawat di rumah sakit. Pemeriksaan fisik a. g. bau dan mulai kapan. panas. alergi obat dan makanan. Riwayat kesehatan keluarga Apakah keluarga ada yang menderita sakit menular pada saat ini. e) Pola dalam hygiene : kebiasaan mandi. warna. 4) Perubahan bentuk. apakah obstipasi dan bagaimana ciri faeces. pernah mendapatkan obatobatan atau tindakan operasi. lama tidur) d) Pola aktifitas : Kegiatan sehari-hari. dan suhu. memotong kuku. Proses pertolongan pertama yang dilakukan 1) Pemasangan bidai sebelum memindahkan klien dan pertahankan gerakan di atas / di bawah tulang yang fraktur sebelum dipindah-kan 2) Tinggikan ekstremitas untuk mengurangi edema 3) Bila fraktur terbuka. bengkak. f. c) Pola tidur : Kebiasaan tidur sehari-hari (jam tidur. 4) Bila fraktur tertutup. b. 5) Kehilangan fungsi 6) Apakah klien ada riwayat penyakit osteoporosis. d. kapan terjadi kecelakaan atau trauma 3) Bagaimana dirasakan. Inspeksi daerah mana yang terkena:. terbatasnya gerakan. menyikat gigi. untuk melihat perubahan warna. Riwayat perjalanan penyakit : 1) Keluhan utama klien datang ke RS atau tempat pelayanan keseha-tan 2) Apa penyebabnya. dan lain-lain.b) Pola eliminasi : Kebiasaan BAB/BAK. inkomplit. hentikan perdarahan dan tutup luka dengan kain yang bersih. 5) Kirim untuk pertolongan emergensi 6) Pantau daerah yang cedera dalam periode waktu pendek. ekimosis sekitar lokasi cedera 3) Laserasi . konsistensi. sakit waktu kecil. dan lain-lain. adanya nyeri. dan lain-lain). Mengidentifikasi tipe fraktur ( komplit. rambut. mengisi waktu luang. apakah keluarga mempunyai penyakit keturunan yang memerlukan perawatan.

Resiko terjadi gangguan pertukaran gas berhubungan dengan gangguan peredaran darah / emboli lemak. Resiko terjadi trauma berhubungan dengan kehilangan integritas tulang ( fraktur). bagaimana awal terjadinya. pernah berobat kemana saja. oedema. perubahan membran alveo¬lar / capiler. 5. Keluhan utama : adanya rasa nyeri.4) Perubahan warna kulit 5) Kehilangan fungsi daerah lyang cedera c. d. oedem. tindakan apa saja yang telah dilaukan. dingin 4) Observasi spasme otot sekitar daerah fraktur 5) Terpasang alat immobilisasi pada lokasi cedera. traksi tulang ). e. Gangguan mobilitas fisik berhubungan dengan kerusakan neuromus-cular. Adapun diagnosa keperawatan yang timbul pada pasien dengan fraktur menurut buku “Asuhan Keperawatan Pedoman Untuk Perencanaan dan Pendokumentasian Perawatan Pasien Edisi III” (Doenges. bentuk tulang yang tidak normal. cemas. 4. imobilisasi. 2000). Kurangnya pengetahuan tentang kondisi. Pengobatan : usaha yang dilakukan orang untuk kesembuhan pasien membawanya ke Puskesmas/rumah sakit/petugas kesehatan dan apa obat yang diberikan. luka terbuka. adanya trobus. 7. pergerakan fragmen tulang. menghilangkan. Diagnosa keperawatan Menurut Carpenito (1992) mendefinisikan diagnosa keperawatan adalah : “ Pernyataan yang menjelaskan status kesehatan atau masalah aktual atau potensial. Dkk adalah sebagai berikut : 1. nyeri. 3. Perawat menggunakan proses keperawatan dalam mengidentifikasi dan mensintesa data klinis dan menentukan intervensi keperawatan. Resiko terjadi gangguan integritas kulit / jaringan berhubungan dengan adanya fraktur pemasangan gips / traksi. prognosa dan pengoba¬tan berhubungan . stress. hipovolemia. Resiko terjadi infeksi berhubungan dengan tidak adekuatnya pertahanan primer ( rusak kulit. atau mencegah masalah klien yang ada pada tanggungjawabnya”. restriktif terapi. f. Kapan terjadinya cidera/kecelakaan. 6. Resiko terjadi disfungsi neuromusculer periferal berhubungan dengan trauma jaringan. terhambatnya aliran darah. jaringan prosedur invansif. untuk mengurangi. Palpasi : 1) Bengkak. 2. 2. yang berlebihan. trauma pada jaringan lunak. Nyeri berhubungan dengan spasme otot. 8. gangguan sirkula¬si. adanya nyeri dan penyebaran 2) Krepitasi 3) Nadi.

Merumuskan tujuan keperawatan yang akan dicapai b. Evaluasi pergerakan bidai untuk menghindari edema. Perencanaan adalah tahap ketiga dari proses keperawatan. maka rencana tindakan keperawatannya adalah sebagai berikut : 1. Perencanaan Setelah merumuskan diagnosa keperawatan. Rasional : Bidai mungkin digunakan luntuk memberikan immobi¬lisasi pada fraktur dan untuk . Pada bagian ini ditentukan sasaran yang akan dicapai dan rencana tindakan keperawatan dikembangkan. 3. Menetapkan kriteria evaluasi c. trochanter roll. Rasional : Kelembutan dan kelenturan alas dapat mempengaruhi bentuk gips yang basah. 3) Menunjukkan pertumbuhan callus yang baru pada bagian fraktur. Rencana Tindakan a. maka disusunlah peren-canaan keperawatan. Beri sanggahan pada fraktur dengan bantal. d. tidak terbiasa dengan sumber informasi. Rasional : Mencegah gerakan yang tidak perlu dan gangguan pada allignment. 2) Mendemonstrasikan mekanika tubuh untuk mempertahankan stabili-tas dan posisi tubuh. b. yang dimulai setelah data-data yang terkumpul sudah dianalisa. Hasil yang diharapkan : 1) Mempertahankan stabilisasi dan aligment fraktur. Letakkan klien pada tempat tidur ortopedis.dengan kurangnya penjelasan. c. a. salah menafsirkan informasi. mereduksi kemungkinan pengobatan. Resiko terjadi trauma berhubungan dengan kehilangan integritas tulang ( fraktur). bidai. Merumuskan intervensi keperawatan dan aktifitas keperawatan. Penempatan bantal yang tepat dapat mencegah penekanan sehingga menghindari deformitas pada gips. Rasional : Meningkatkan kemampuan. Anjurkan bed rest dengan memberikan penyangga saat mencoba menggerakkan bagian yang fraktur. Dari diagnosa keperawatan yang telah disusun di atas. pertahankan posisi netral dengan menahan bagian yang fraktur dengan bantalan pasir. papan kaki. Tahapan dalam perenca-naan ini terdiri dari : Menetapkan prioritas masalah berdasarkan pola kebutuhan dasar manusia menurut hirarki Maslow.

stress dan kecemasan. mengurangi edema dan mengur¬angi nyeri. traksi / immobilisasi karena penggunaan alat. pergerakan fragmen tu-lang. Rasional : . Pertahankan posisi dan integritas dari traksi. 2) Tinggikan dan sangga daerah luka. Rasional : Menjaga integritas tarikan pada traksi. Rasional : Menjamin traksi dapat dipergunakan dan menghin¬dari gangguan pada fraktur. Follow up pemeriksaan X-Ray. Rasional : Mengetahui proses tumbuhnya callus untuk menentu¬kan tingkat aktivitas l dan memerlukan perubahan atau tambahan therapi. Cek kembali pembatasan therapi yang diberikan. 2. e. Minyaki katrol dan cek tali. traksi ). 5) Evaluasi rasa nyeri lokasi dan karekteristik termasuk in¬tensitas ( skala 0 . Rasional : Meningkatkan aliran vena. Rasional : Tarikan pada traksi dilakukan pada tulang panjang yang fraktur dan kemudian menjadikan otot tegang sehingga memu¬dahkan aligment.mencegah terjadinya bengkak pada jaringan.10 ). bidai. 3) Hindari penggunaan sprei plastik/ bantal dibawah gips. Rasional : Memberikan rasa nyaman. 4) Tinggikan bagian depan tempat tidur. Rasional : Membantu menguatkan pertumbuhan tulang dalam masa penyembuhan. gips. h. Pertahankan fisiotherapi jika perlu. Rasional : Mengurangi lnyeri dan mencegah perubahan posisi tulang serta luka pada jaringan. g. f. i. Rencana Tindakan : 1) Lakukan imobilisasi ( bed rest. Pastikan bahwa semua klem/ penjepit berfungsi. Edema akan hilang dengan pemberian bidai. edema. Perhatikan juga rasa nyeri non verbal ( periksa tanda vital dan emosi / tingkah laku ). Nyeri berhubungan dengan spasme otot. Rasional : Menyebabkan rasa tidak nyaman karena menambah panas pada gips.

11) Anjurkan klien untuk menggunakan teknik relaksasi ( latih nafas dalam). sirkulasi. Rencana Tindakan : 1) Periksa kulit sekitar luka . 8) Beri pengobatan sesuai terapi sebelum melakukan aktivitas perawatan. Rasional : Meningkatkan relaksasi otot agar dapat berpartisipasi. memberikan alas yang lembut pada siku dan tumit. 6) Diskusikan masalah yang berhubungan dengan injury. Rasional : Memperbaiki sirkulasi umum. 3. menjaga alat tenun tetap kering . Rasional : Mengurangi penekanan pada daerah yang mudah terkena dan resiko untuk lecet dan rusak. Rasional : Mempertahankan kemampuan otot dan menghindari pembeng¬kakan pada jaringan yang luka. terbentuknya edema 2) Masase kulit dan tempat yang menonjol. mengurangi tekanan pada satu tempat dan kelelahan otot. Rasional : Memberikan informasi gangguan sirkulasi kulit dan masalah-masalah yang mungkin disebabkan oleh penggunaan traksi. 3) Rubah posisi selang-seling sesuai indikasi. gangguan sensasi . perdarahan.Monitor keefektifan intervensi. 7) Terangkan prosedur sebelum memulai. Resiko terjadi gangguan integritas kulit / jaringan berhubungan dengan compound fracture. immobilisasi fisik. 9) Lakukan latihan range of motion. Rasional : Meningkatkan sense of control dan mungkin dapat me¬ningkatkan kemampuan mengurangi rasa nyeri. Tingkat kecemasan dapat menunjukkan reaksi dari nyeri. perubahan posisi. Rasional : Mengijinkan klien untuk mempersiapkan mental agar dapat berpartisipasi dalam aktivitas. . pemasangan traksi. Rasional : Menolong mengurangi kecemasan. 10) Lakukan tindakan untuk meningkatkan rasa nyaman dengan masase. kemerahan. perubahan warna kulit.

edema yang berlebihan. 4. 5) Urin output yang adekuat. 2) Evaluasi adanya kualitas / kualitas dari pulsasi perifer distal yang luka melalui palpasi / doppler. Rencana Tindakan :. 3) Perabaan normal 4) Tanda vital stabil. 4) Kaji status neuromuskuler. Rasional : Mencegah perlukaan setiap anggota tubuh. Sianosis menandakan lemahnya aliran vena . warna kulit dan rasa dapat normal terjadi dengan adanya syndrome comparmental karena sirkulasi permukaan sering kali tidak sesuai. Kulit yang dingin menandakan lemahnya aliran arteri. terhambatnya aliran darah Hasil yang diharapkan: 1) Mempertahankan perfusi jaringan yang ditandai dengan terabanya pulsasi 2) Kulit hangat dan kering . dan untuk anggota tubuh yang kurang gerak efektif untuk mencegah penurunan sirkulasi.Rasional : Mengurangi penekanan yang terus menerus pada posisi tertentu 4) Kaji posisi splint ring traksi. perpusi melalui arteri yang besar dapat berlanjut setelah menambah tekanan dari sirkulasi arteriol / venol yang kolaps. Tanyakan . catat perubahan motorik/ fungsi sensorik. adanya trombus. Sebagai tambahan. kembalinya kapiler. 1) Lepas perhiasan pada daerah yang mengalami ganggguan Rasional : Dapat membatasi bila terjadi oedema. hypovolemia. Rasional : Berkurangnya / tidak adanya pulsasi menggambarkan adanya pembuluh darah yang luka dan memerlukan evaluasi status sirkulasi yang segera. Pulsasi perifer. Resiko terjadi destruksi neuromuskuler periferal berhubungan dengan trauma jaringan. Bandingkan dengan sisi yang normal . Rasional : Kembalinya warna dengan cepat ( 3-5 detik ) putih. Perlu disadari bahwa kadang kadang pulsasi dapat teraba walaupun sirkulasi terhambat oleh sumbatan kecil. 5) Pakai bed matras / air matras. warna kulit dan kehangatan bagian distal dari fraktur. Rasional : Salah posisi akan menyebabkan kerusakan kulit. 3) Kaji kembalinya kapiler.

kepada klien lokasi nyeri/ tidak nyaman. Rasional : Lemahnya rasa, kebal, meningkatnya/ penyebaran rasa sakit terjadi ketika sirkulasi ke saraf tidak adekuat atau adanya trauma pada saraf. 5) Tes sensasi dari syaraf peroneal dengan mencubit dorsal diantara jari kaki pertama dan kedua. Kaji kemampuan dorso fleksi jari-jari kaki. Rasional : Panjang dan posisi syaraf peroneal meningkatkan resiko terjadinya injury dengan adanya fraktur di kaki, oedema/ comparmental syndrome atau malposisi dari peralatan traksi. 6) Monitor posisi/ lokasi ring penyangga bidai Rasional : Peralatan traksi dapat menekan pembuluh darah atau syaraf, khususnya diaksila atau daerah selangkang, menyebabkan iskemik dan luka permanent. 7) Pertahankan elevasi dari ekstermitas yang cedera jika tidak kontraindikasi dengan adanya compartemen syndrome. Rasional : Mencegah aliran vena/ mengurangi oedema 4. Pelaksanaan Merupakan pelaksanaan rencana tindakan keperawatan yang telah ditentuan agar kebutuhan pasien terpenuhi secara optimal. Pelaksanaan tindakan keperawatan dapat dilaksanakan sebagian oleh pasien, perawat secara mandiri, atau bekerjasama dengan tim kesehatan lain. Dalam hal ini perawat adalah sebagai pelaksana asuhan keperawatan yaitu memberikan pelayanan perawatan dengan menggunakan proses keperawatan. Adapun langkah-langkah dalam tindakan keperawatan terdiri dari tiga tahap yaitu persiapan, pelaksanaan dan dokumentasi. Pada tahap persiapan, perawat harus memiliki keterampilan khusus dan pengetahuan untuk menghindari kesalahan dalam memberikan tindakan keperawatan pada pasien. Sebelum dilakukan tindakan keperawatan, perawat terlebih dahulu memberitahukan dan menjelaskan tentang maksud dan tujuan serta akibat tindakan yang akan dilakukan. Tahap pelaksanaan merupakan tindakan yang akan dilakukan sesuai dengan rencana dalam rangka mengatasi masalah keperawatan yang ada. Tahap dokumentasi yaitu tahap tindakan keperawatan yang telah di-lakukan baik kepada pasien ataupun keluarga, dicatat dalam catatan keperawatan. Pada pendokumentasian ini harus lengkap meliputi tang¬gal, jam pemberian tindakan, jenis tindakan, respon pasien, paraf serta nama perawat yang melakukan tindakan. Menurut Yoseph tahun 1994 “Pendokumentasian sangat perlu untuk menghindari

pemutarbalikan fakta, untuk mencegah kehilangan informasi dan agar dapat dipelajari oleh perawat lain. Semua tahap dalam proses keperawatan harus di-dokumentasikan.” Beberapa faktor dapat mempengaruhi pelaksanaan rencana asuhan keperawatan, antara lain sumber-sumber yang ada, pengorganisasian pekerjaan perawat serta lingkungan fisik untuk pelayanan keperawatan yang dilakukan. 5. Evaluasi Tahap evaluasi dalam proses keperawatan menyangkut pengumpulan data subyektif dan obyektif yang menunjukkan mengenai tujuan asuhan keperawatan sudah dapat dicapai atau belum, masalah apa yang sudah dipecahkan dan apa yang perlu dikaji lagi, direncanakan, dilaksanakan. Evaluasi merupakan tahap akhir proses keperawatan yang merupakan aktifitas berkesinambungan dari tahap awal (pengkajian) sampai tahap akhir (evaluasi) dan melibatkan pasien/keluarga. Evaluasi bertujuan untuk menilai efektifitas rencana dan strategi asuhan keperawatan. Evaluasi terdiri dari evaluasi proses, untuk menilai apakah prosedur dilakukan sesuai dengan rencana dan evaluasi hasil berfokus kepada perubahan perilaku dan keadaan kesehatan pasien sebagai hasil tindakan keperawatan. Ada tiga alternatif dalam menafsirkan hasil evaluasi yaitu : a. Masalah teratasi Masalah teratasi apabila pasien menunjukkan perubahan tingkah laku dan perkembangan kesehatan sesuai dengan kriteria pencapaian tu¬juan yang telah ditetapkan. b. Masalah sebagian teratasi Masalah sebagian teratasi apabila pasien menunjukkan perubahan dan perkembangan kesehatan hanya sebagian dari kriteria pencapaian tu-juan yang telah ditetapkan. c. Masalah belum teratasi Masalah belum teratasi, jika pasien sama sekali tidak menunjukkan perubahan perilaku dan perkembangan kesehatan atau bahkan timbul masalah yang baru.

BAB III TINJAUAN KASUS Pada bab ini penulis akan menguraikan tentang asuhan keperawatan klien dengan Fraktur Communitif Metakarpal IV dan V manus dextra di ruang Cempaka RSUD Abdul Wahab Syahranie Samarinda, yang dimulai sejak tanggal 21 Juli sampai dengan 23 Juli 2009. Adapun pelaksanaan asuhan keperawatan ini dilakukan tahap demi tahap, dimulai dari

pengkajian, perumusan diagnosa keperawatan, perencanaan, pelaksanaan dan evaluasi yang disebut dengan tahap proses keperawatan.

Pengertian Fraktur :
 

Fraktur (patah tulang) adalah terputusnya kontinuitas struktur tulang dan ditentukan sesuai jenis dan luasnya. (smeltzer S.C & Bare B.G,2001) Fraktur adalah setiap retak atau patah pada tulang yang utuh.( Reeves C.J,Roux G & Lockhart R,2001 )

Jenis Fraktur : Agar lebih sistematis, jenis fraktur dapat dibagi berdasarkan :

Lokasi Fraktur dapat terjadi pada tulang di mana saja seperti pada diafisis, metafisis, epifisis, atau intraartikuler. Jika fraktur didapatkan bersamaan dengan dislokasi sendi, maka dinamakan fraktur dislokasi. Luas Terbagi menjadi fraktur lengkap (komplit) dan tidak lengkap (inkomplit). Fraktur tidak lengkap contohnya adalah retak. Konfigurasi Dilihat dari garis frakturnya, dapat dibagi menjadi transversal (mendatar), oblik (miring), atau spiral (berpilin/ memuntir seputar batang tulang). Jika terdapat lebih dari satu garis fraktur, maka dinamakan kominutif, jika satu bagian patah sedangkan sisi lainnya membengkok disebut greenstick. Fraktur dengan fragmen patahan terdorong kedalam ( sering terjadi pada tulang tengkorak dan wajah) disebut depresi, fraktur dimana tulang mengalami kompresi ( terjadi pada tulang belakang ) disebut kompresi. Hubungan antar bagian yang fraktur Antar bagian yang fraktur dapat masih berhubungan (undisplaced) atau terpisah jauh (displaced). Hubungan antara fraktur dengan jaringan sekitar Fraktur dapat dibagi menjadi fraktur terbuka (jika terdapat hubungan antara tulang dengan dunia luar) atau fraktur tertutup (jika tidak terdapat hubungan antara fraktur dengan dunia luar).

posisi tubuh saat berlangsungnya trauma. · Faktor intrinsik yaitu meliputi kapasitas tulang mengabsorpsi energi trauma. riwayat fraktur sebelumnya. obat-obatan yang dikomsumsi. Grade II : luka lebih luas tanpa kerusakan jaringan lunak yang ekstensif. merokok. kelenturan. .Fraktur terbuka dibedakan menjadi beberapa grade yaitu : Grade I : luka bersih. riwayat alergi. Etiologi : Terjadinya fraktur akibat adanya trauma yang mengenai tulang yang kekuatannya melebihi kekuatan tulang. pekerjaan. Grade III : sangat terkontaminasi. arah serta kekuatan tulang. dan mengalami kerusakan jaringan lunak ekstensif. panjangnya kurang dari 1 cm. densitas serta kekuatan tulang. riwayat osteoporosis serta riwayat penyakit lainnya. Faktor-faktor yang mempengaruhi terjadinya fraktur : · Faktor ekstrinsik yaitu meliputi kecepatan dan durasi trauma yang mengenai tulang. Pengkajian Riwayat Penyakit : Dilakukan anamnesa untuk mendapatkan riwayat mekanisme terjadinya cidera.

pada daerah yang dicurigai fraktur. Pemeriksaan radiologis (rontgen). bisa juga akibat penanganan fraktur yang disebut komplikasi iatrogenik.Pemeriksaan Fisik : 1. rotasi. yang terdiri dari :     Mencakup dua gambaran yaitu anteroposterior (AP) dan lateral. Kompikasi Umum : . angulasi. Memuat dua extremitas (terutama pada anak-anak) baik yang cidera maupun yang tidak terkena cidera (untuk membandingkan dengan yang normal) Dilakukan dua kali. Urinalisa. Golongan darah (terutama jika akan dilakukan tindakan operasi). 3. pemendekan. Kreatinin (trauma otot dapat meningkatkan beban kreatinin untuk kliren ginjal). Faktor pembekuan darah. meliputi:      Darah rutin. Pemeriksaan laboratorium. krepitasi. Pemeriksaan Penunjang : 1. Inspeksi (look) Adanya deformitas (kelainan bentuk) seperti bengkak. warna kulit. capillary refill test. 3. Palpasi daerah ektremitas tempat fraktur tersebut. 2. di bagian distal cedera meliputi pulsasi arteri. yaitu sebelum tindakan dan sesudah tindakan. harus mengikuti aturan role of two. Palpasi (feel) Adanya nyeri tekan (tenderness). Gerakan (moving) Adanya keterbatasan gerak pada daerah fraktur. fragmen tulang (pada fraktur terbuka). 2. Memuat dua sendi antara fraktur yaitu bagian proximal dan distal. pemeriksaan status neurologis dan vaskuler di bagian distal fraktur. Komplikasi : Penyebab komplikasi fraktur secara umum dibedakan menjadi dua yaitu bisa karena trauma itu sendiri. Pemeriksaan arteriografi dilakukan jika dicurigai telah terjadi kerusakan vaskuler akibat fraktur tersebut.

Mengembalikan fungsi seperti semula . Mempertahankan posisi yang ideal dari fraktur. 4. Komplikasi ini dapat terjadi dalam waktu 24 jam pertama pasca trauma. Atropi otot karena imobilisasi sampai osteoporosis. Ada beberapa komplikasi yang terjadi yaitu :           Infeksi. fiksasi eksternal. jika komplikasi terjadi setelah satu minggu pasca trauma disebut komplikasi lanjut. 3. sedangkan bidai maupun gips hanya dapat digunakan untuk fiksasi yang bersifat sementara saja.Syok hipovolemia (karena perdarahan yang banyak). fiksasi internal. dan setelah beberapa hari atau minggu dapat terjadi gangguan metabolisme yaitu peningkatan katabolisme. Membuat tulang kembali menyatu Tulang yang fraktur akan mulai menyatu dalam waktu 4 minggu dan akan menyatu dengan sempurna dalam waktu 6 bulan. 2. Terganggunya gerakan aktif otot karena terputusnya serabut otot. yaitu kerusakan kartilago sendi. Untuk mengurangi nyeri dapat diberi obat penghilang rasa nyeri. Trauma pada jaringan disekitar fraktur menimbulkan rasa nyeri yang hebat bahkan sampai menimbulkan syok. Lepuh di kulit karena elevasi kulit superfisial akibat edema. serta dengan teknik imobilisasi. karena penekanan jaringan lunak oleh gips. Seperti pemasangan traksi kontinyu. Osteomielitis yaitu infeksi yang berlanjut hingga tulang. syok neurogenik (karena nyeri yang hebat). Dekubitus. koagulopati diffus. Mengurangi rasa nyeri. gas ganggren. Komplikasi Lokal : Jika komplikasi yang terjadi sebelum satu minggu pasca trauma disebut komplikasi dini. emboli lemak. Delayed union yaitu penyambungan tulang yang lama. Sindroma kompartemen karena pemasangan gips yang terlalu ketat sehingga mengganggu aliran darah Penatalaksanaan : Penatalaksanaan fraktur mengacu kepada empat tujuan utama yaitu: 1. gangguan fungsi pernafasan. tetanus. terutama pada kasus fraktur terbuka. yaitu pemasangan bidai / spalk. Non union yaitu tidak terjadinya penyambungan pada tulang yang fraktur. Artritis supuratif. trombosit vena dalam (DVT). maupun memasang gips.

Jika dirontgen. yang akan mempersiapkan fase reparatif. Proses Penyembuhan Tulang : Fase Inflamasi : Fase ini berlangsung mulai terjadinya fraktur hingga kurang lebih satu sampai dua minggu. yang meliputi aktifitas osteoblas dan osteoklas yang menghasilkan perubahan jaringan immatur agar menjadi matur. 8 terjadi secara nyata dengan mencantumkan faktor apa saja yangmendukung. Osteoblas mengakibatkan mineralisasi kalus lunak menjadi kalus keras serta menambah stabilitas fraktur. Hematom fraktur diisi oleh kondroblas dan fibroblas yang akan menjadi tempat matrik kalus. Fraktur dapat disebabkan oleh pukulan langsung . makrofag.Bab kelima penutup berisikan kesimpulan tentang hasil daritinjauan kasus serta saran saran untuk meningkatkan mutu asuhankeperawatan.alternatifpemecahan masalah yang rasional. Ditandai dengan diferensiasi dari sel mesenkim pluripotensial. BAB IITINJAUAN TEORITIS Definisi Fraktur menurut Mansjoer.Fraktur terbuka bila terdapat hubungan antarafragme tulang dengan dunia luar kaena adanya perlukaan dikulit.frakturterbuka terbagi atas tiga derajat yaitu : . Definisi Fraktur menurut Suddarth (2001).gayameremuk. yang berfungsi untuk membersihkan jaringan nekrotik. osteoklas. Pada awalnya terbentuk kalus lunak. Peningkatan aliran darah menimbulkan hematom diikuti invasi sel-sel peradangan yaitu neutrofil.Arief (2000). sel fagosit.bagaiman cara menanggulangi masalah. Jika dirontgen maka garis fraktur mulai tidak tampak.dan bahkan kontraksi ototekstrem(Suddarh. terbentuknya tulang lamelar sehingga menambah stabilitas daerah fraktur. klasifikasi fraktur dapat dibagi menjadidua yaitu .dkk (2000) adalah terputusnyakontunuitas tulang dan atau tulang rawan yang umumnya disebabkan olehrudapaksa.2001).Imobilisasi dalam jangka waktu yang lama dapat menyebabkan atrofi otot dan kekakuan pada sendi.Fraktur tertutup bila tidak tedapat hubungan antara fragmen tulang dengan dunia luar.Menurut Mansjoer.gerakan puntir mendadak. Fase Reparatif : Dapat berlangsung beberapa bulan.adalah terputusnyakontinuitas tulang dan ditentukan sesuai jenis dan luasnya. Maka untuk mencegah hal tersebut diperlukan upaya mobilisasi. terdiri dari jaringan fibrosa dan kartilago dengan sejumlah kecil jaringan tulang. garis fraktur lebih terlihat karena telah disingkirkannya material nekrotik.. Fase Remodeling : Fase ini bisa membutuhkan waktu berbulan-bulan hingga tahunan untuk merampungkan penyembuhan tulang.

atau komunutif ringan2) Derajat II :laserasi >1cm. Kominutif adalah fraktur dengan tulang pecah menjadi bebrapafragmen. Patologik dimana fraktur yang terjadi pada daerah tulangberpenyakit (kista tulang. krepitus.seperti kecelakaanmobil.membagi jenis jenis fraktur yaitu sebagaiberikut. 2007).pembengkakan lokal.hilangnya fungsi.pemendekan ekstrmitas.tidak luas.pembuluh darah.Frakturkominutif sedang.kerusakan jaringan lunak sedikit.kontaminasi sedang3) Derajat III : jaringan lunak yang menutupi fraktur tulang tidak adekuatwalaupun terdapat laserasi luas.olahraga atau karena jatuh. Fraktur complete adalah patah pada seluruh garis tengah tulangdan biasanya mengalami pergeseran (berbeser dari posisi normal). sumsum tulang dan jaringan lunak.sederhana. avulse adalahtertariknya fragmen tulang oleh ligament atau tendo pada perlekatannya Epifiseal adalah fraktur melalui epifis.penyakit osteoporosis.tumor). kerusakan tulang dan jaringansekitarnya. Kompresi adalah fraktur dimana tulang mengalami kompresi (terjadi pada tulangbelakang).Etiologi Fraktur merupakan akibat dari cedera. Depresi adalah fraktur dengan fragmen patahan terdorong kedalam (sering terjadi pada tulang tengkorak dan tulang wajah). dan perubahan warnaPatofisiologi fraktur adalah fraktur akan terjadi kerusakan di korteks. terjadinya respon inflamsi akibat sirkulasi jaringannekrotik adalah ditandai dengan vasodilatasi dari plasma dan leukoit.et al(2001)adalahnyeri.9 1) Derajat I : luka <1cm.transversal.Ketika terjadi kerusakan tulang.kerusakan jaringan lunak.Suddarth et. tahap . Keadaan ini menimbulkan hematom pada kanal medullaantara tepi tulang dibawah periostium dengan jaringan tulang yangmengatasi fraktur. Greenstick adalah fraktur dimana salah satu sisi tulag patahsedang sisi lainnya membengkok.oblik. Akibat dari haltersebut adalah terjadi perdarahan.Manifestasi klinis fraktur menurut Suddath. tubuh mulai melakukan prosespenyembuhan untuk memperbaiki cidera. Spiral adlah fraktur memuntir seputar batangtulang.kehilangan jaringan lunak dengafraktur tulang yang terpapar atau kontaminasi massif.tidak ada lukaremukFraktur .deformitas.al (2001).Fraktur terjadi jika tenaga yang melawantulang lebih besar dari pada kekuatan tulang (Susi. Fraktur Incomplete adalah patah hanya terjadi pada sebagian garistulang.luka padapembuluh arteri / saraf perifer yang harus diperbaiki tanpa melihatkerusakan jaringan lunak. Impaksi adalah fraktur dimanafragmen tulang terdorong kef ragmen tulang lainnya. Transversal adalah fraktur sepanjanggaris tengah tulang.

masalah tersebut meliputikegagalanmekanis (pemasangan dan stabilisasi yang tidak memadai.brace.yaitu .Moh. yang bila berlangsung lama bisa menyebabkan syndromacomportement.yaitu . kemudian menstimulasi histamin pada otot yang iskhemik danmenyebabkan protein plasma hilang dan masuk ke interstitial.sedangkan metode memepertahankanimobilisasi adalah alat eksterna yang terdiri . Edema yang terbentuk akan menekanujung syaraf.kehilangan tulang.asupan darah yang memadai.kegagalan material(alatyng rusak).dan sindromkompartemen yang berakibat kehilangan fungsiekstremitas permanenyang jika tidak ditangan I segera.ini menunjukkan tahapawal penyembuhan tulang.sedangkan factoryang menghambat penyembuhan tulang antara lain .metode untuk mencapai reduksi terdiri . PENGKAJIAN .Faktor faktor yang mempengaruhi penyembuhan tulang menurutSuddarth et al (2001).2001 komplikasi fraktur terbagidua.kompikasi awal lainnya yangberhubungan denganfraktur adalah infeksi .lansia.pin dangips.namun pada kebanyakan pasien alat tersebut tidak di angkatsehingga dapat menimbulkan gejala.Prinsip penatalaksanaan fraktur yang di gunakan ada beberapametode. sehingga meningkatkan tekanan 11 kapiler.imobilisasi fragmen tulang.balutan.berkaratnyaalat.infeksi.kontak fragmen tulangmaksimal.dan reduksi terbuka.et al (2001) prinsip penatalaksanaan fraktur adalahmengembalikan fragmen tulang ke posisi anatomis normal(reduksi).yang bias berakibat fatal dalam beberapa jam setelah cedera.komplikasi awal frakturadalah syok. Hematommenyebabkan dilatasi kapiler di otot.plat.traksi.penyatuan terlambat atau tidakada penyatuan diakibatkan dengan infeksi sistemik dan distraksi (tarikan jauh)fragmen tulang.Tujuan dari pengobatan adalah untuk menempatkan ujung ujung daritulang patah tulang supaya saling berdekatan dan untuk menjaga agarujung tulang tetap menempel sebagaimana mestinya.keganasanlocal.Necrosis avasculer tulang.imobilisasi tidak memadai.(Kartono.waktuoptimal untuk bertindak adalah sebelum 6 – 7 jam ( golden periode ) 12 Menurut Suddarth et al. Hematon yang terbentuk bisa menyebabkanpeningkatan tekanan dalam sumsum tulang yang kemudian merangsangpembebasan lemak dan gumpalan lemak tersebut masuk kedalampembuluh darah yang mensuplai organ-organ yang lain.mempercepat pengembalian fungsi dan kekuatan normalbagian yang terkena (rehamilitatif). Hal inimenyebabkan terjadinya edema.Sedangkan komplikasi lambat yaitu .yang dapt terjadidalam 48 jam atau lebih.bebat.yaitukomplikasi awal dan komplikasi lambat.nutrisi yang baik.alatfiksasi interna biasanya diambil setelah penyatuan tulangtelahterjadi.batang.penundaan waktu dapat mengakibatkan komplikasi infeksi. A.reaksi terhadap alat fiksasi interna .mempertahankan reduksi sampai terjadi penyembuhan(imobilisasi).menyebabkan inflamasi local.factor yang mempercepat penyembuhanfraktur diantaranya.danPenatalaksanaan pada fraktur terbuka harus dilakukan secepatmungkin.emboli lemak .terjadi jika tulangkehilangan asupan darah dan mati.alat interna terdiri.reduksitertutup.trauma local stenstif.traksi.fiksator eksterna.2005)Menurut Suddarth.case.sekrup.nail.respon alergi.kawat.trombo emboli dan KID.

edema dan cedera pada jaringan lunak.tidak ada nyeri akibatkerusakan syaraf. tes diagnostik.angulasi abnormal.imobilisasi.pemendekan.Menurut Doenges. Nyeri (akut) berhubungan dengan spase otot. harus memperhatikan data dasarpasien.kebas / kesemutan(parestesi)Tanda : deformitas local . catatan kesehatanklien.alat traksi. Neurosensori ejala : hilang gerakan / sensasi.diagnosa keperawatan pada pasienfraktur adalah sebagai berikut . Pemeriksaan rontgen : menentukan lokasi.perdarahan.scan CT/MRI :Memperlihatkan fraktur juga dapat digunakan untuk mengidntifikasi jaringan lunak.Pengkajian adalah langkah awal dari tahapan proseskeperawatan. Dalam pengkajian.spasme otot.b.dari pembengkakan jaringan.hipovolemi Resiko tinggi terhadap kerusakan pertukaran gas berhubungandengan perubahan aliran :darah/emboli lemak.5. Pemeriksaan Diagnostika.f.1999).gerakan fragmentulang.rotasikrepitasi.sekrup. akumulasi ekskresi/secret.6. Kerusakan mobilitas fisik berhubungan dengan kerusakan rangkaneurovascular: nyeri/ketidaknyamanan.tomogram.avulse jaringan. Kreatinin : trauma otot meningkatkan beban kreatinin untukklirens ginjal. Resiko tinggi terhadap disfungsi neurovascular perifer berhubungandengan penurunan / interupsi aliran darah :cedera vaskulerlagsung. Informasi yang didapat dari klien adalah data primer.7.edema paru.pembentukan thrombus.e. Penyuluhan / PembelajaranGejala : Lingkungan cedera7. Kerusakan jaringan / integritas kulit berhubungan dengan cederafraktur tebuka. Nyeri / KenyamananGejala : nyeri berat tiba tiba pada saat cedera (mungkinterlokalisasi pada area jaringan / kerusakan tulang .Agitasi (mungkin berhubungan dengan nyeri / ansietasatau trauma lain)4.stress / ansietas3. bedah perbaikan. informasi atau laporan laboratorium. Arteriogram :Dilakukan bila kerusakan vascular di curigai.6.spasme / kram otot (setelah imobilisasi)5.. sirkulasi.terlihat kelemahan / hilang fungsi.edema berlebihan.pemasangan traksi pen.Hidayat (2001).nyeri)2. perubahan sesasi.dkk (1999).spasme otot.dapatberkurang pada imoblisasi).fraktur itu sendiri. Aktivitas dan istirahatTanda : keterbatasan / kehilangan fungsi pada bagian yangterkena (mungkin segera .atau terjadisecara sekunder. Resiko tinggi terhadap infeksi berhubungan . Profil koagulasi :perubahan dapat terjadi pada kehilangandarah tranfusi multiple atau cedera hati. Resiko tinggi terhadap trauma berhubungan dengan kehilanganintegritas tulang (fraktur)2.1. keluargadan orang yang terdekat atau anggota tim kesehatan merupakanpengkajian data dasar. Hitung darah lengkap :Ht mungkin meningkat(hemokonsentrasi)atau menurun (perdarahan bermakna padasisi frakturatau organ jauh pada trauma multiple).Peningkatan jumlah SDP adalah respon stress normal setelah trauma.dkk (1999)dengan asuhan keperawatan padaklien Fraktur didapatkan data sebagai berikut :1. B.perubahanwarna. KeamananTanda : Laserasi kulit.Menurut Doenges.memfokuskan dan mengatasi kebutuhan spesifik pasien serta responterhadap masalah actual dan resiko tinggi (Doenges et al. Diagnosa Keperawatan Diagnosa keperawatan adalah cara mengidentifikasi.kongesti. Skan tulang.intertitsil./luasnya fraktur.pembengkakan local (dapat meningkat secarabertahap atau tiba tiba).perubahan membranalveolar/kapiler . SirkulasiTanda : hipertensi(kadang kadang terlihat sebagai respon terhadapnyeri / ansietas)atau hipotensi(kehilangan darah)3. kawat. dan datayang didapat dari orang lain adalah data skunder.c.

R : Meningkatkan stabilitas.prognosis.mematahkan gips yang sudahkering. Rencana Tindakan Intervensi keperawatan adalah deskripsi untuk perilaku spesifikyang diharapkan dari pasien dan/atau tindakan yang harus dilakukanoleh perawat.3 Sokong fraktur dengan bantal.atau mepengaruhi penarikan traksi.1.mematahkan gips yang sudahkering. Traksi tulang memungkinkan Kriteria hasil : Menunjukan mekanika tubuh yangmeningkatkan stabilitas pada sisi fraktur.Posisi yang tepat dari .pertahankan posisi netral padabagian yang sakitdengan bantal pasir.R : Mencegah gerakan yang tak perlu dan perubahan.atau mepengaruhi penarikan traksi.1.posisi.berikansokongan sendi diatas dan dibawah fraktur bilabergerak/membalik.1 Pertahankan tirah baring/ekstremitas sesuai indikasi.mematahkan gips yang sudahkering.pembebat.berikansokongan sendi diatas dan dibawah fraktur bilabergerak/membalik. Intervensi 1. Kriteria hasil : Menunjukan mekanika tubuh yangmeningkatkan stabilitas pada sisi fraktur.1.R : Traksi memungkinkan tarikan pada aksis panjang frakturtulang dan mengatasi tegangan otot untuk memudahkanposisi/penyatuan.atau mepengaruhi penarikan traksi.1. trauma jaringan.dengan tidakadekuatnya pertahanan primer kerusakan kulit.1.3 Sokong fraktur dengan bantal. Resiko tinggi terhadap trauma berhubungan dengan kehilanganintegritas tulang (fraktur) a.3 Sokong fraktur dengan bantal.kebutuhanpengobatan berhubungan dengan kurang terpajan / mengingat.R : Meningkatkan stabilitas.marlynn.2 Letakan papan dibawah tempat tidur/tempatkan pasien padatempat tidur ortopedik. Traksi tulang memungkinkan Kriteria hasil : Menunjukan mekanika tubuh yangmeningkatkan stabilitas pada sisi fraktur.berikansokongan sendi diatas dan dibawah fraktur bilabergerak/membalik. C.1 Pertahankan tirah baring/ekstremitas sesuai indikasi. Intervensi 1.R : Meningkatkan stabilitas.pembebat.pertahankan posisi netral padabagian yang sakitdengan bantal pasir.1999).salah interprestasi informasi/tidak mengenal sumber informasi.4 Pertahankan posisi/integritas traksi.1.R : Tempat tidur lembut dapat mengakibatkan deformasi gipsyang masih basah. c. Tujuan : Mempertahankan stabilisasi dan posisi fraktur.1.Posisi yang tepat dari bantal juga dapat mencegahtekanan deformitas yang kering. (doenges.posisi.menurunkan kemungkinangangguan posisi/penyembuhan.pembebat.Posisi yang tepat dari bantal juga dapat mencegahtekanan deformitas yang kering.posisi.2 Letakan papan dibawah tempat tidur/tempatkan pasien padatempat tidur ortopedik.2 Letakan papan dibawah tempat tidur/tempatkan pasien padatempat tidur ortopedik.4 Pertahankan posisi/integritas traksi. Kurang pengetahuan tentang kondisi .menurunkan kemungkinangangguan posisi/penyembuhan. Intervensi 1.R : Mencegah gerakan yang tak perlu dan perubahan.menurunkan kemungkinangangguan posisi/penyembuhan.pertahankan posisi netral padabagian yang sakitdengan bantal pasir.1 Pertahankan tirah baring/ekstremitas sesuai indikasi. c.1.R : Tempat tidur lembut dapat mengakibatkan deformasi gipsyang masih basah.R : Tempat tidur lembut dapat mengakibatkan deformasi gipsyang masih basah.a. c.terpajan pada lingkungan8.R : Traksi memungkinkan tarikan pada aksis panjang frakturtulang dan mengatasi tegangan otot untuk memudahkanposisi/penyatuan.R : Mencegah gerakan yang tak perlu dan perubahan.

c.1. Hipovolemia.R : Mempertahankan kekuatan/mobilitas otot yang sakit danmemudahkan resolusi inflamasi pada jaringan yangcedera. latihan nafas dalam. perhatikan fungsimotorik/sensorik. NSAID injeksi contoh ketorolak (toradol).2.R : Traksi memungkinkan tarikan pada aksis panjang frakturtulang dan mengatasi tegangan otot untuk memudahkanposisi/penyatuan.d. kesemutan. ataurelaksan otot. Kriteria hasil :Terabanya nadi. Traksi tulang memungkinkan 20 R : Memungkinkan pasien untuk siap secara mental untukaktivitas juga berpartisipasi dalam mengontrol tingkatketidaknyamanan. imajinasi visualisasi. Resiko tinggi terhadap disfungsi neurovascular perifer berhubungandengan penurunan/interupsi aliran darah: cedera vaskulerlangsung. dan kehangatan distal padafraktur.10 Berikan obat sesuai indikasi: narkotik dan analgesik nonnarkotik .1 Evaluasi adanya/kualitas nadi perifer distal terhadap cederamelalaui palpasi/Doppler.bantal juga dapat mencegahtekanan deformitas yang kering.R : Penurunan nadi menggambarkan cedera vaskuler danperlunya evaluasi medik segera terhadap status sirkulasi. Sianosis diduga adagangguan vena.R : Gangguan perasaan kebas.8 Dorong menggunakan teknik manajemen stress. contoh siklobenzaprin (flekseril). warna kulit.2 Kaji aliran kapiler. peningkatan /penyebaran nyeri terjadi bila sirkulasi pada saraf tidakadekuat atau saraf . a. dan haluaran urine adekuat. yang mungkin menetapuntuk periode lebih lama.R : Diberikan untuk menurunkan nyeri atau spasme otot. kulit hangat/kering.R : Kembalinya warna harus cepat (3-5 detik). Warna kulitpucat menunjukan gangguan arterial.9 Lakukan dan awasi latihan rentang gerak pasif / aktif.2. bandingkan dengan ekstremitas yangsakit. contohrelaksasi progresif. dapat meningkatkankoping dalam manajemen nyeri. pembentukan thrombus. Minta pasien untuk melokalisasinyeri/ketidaknyamanan.3 Lakukan pengkajian neuromuskuler.4 Pertahankan posisi/integritas traksi. Tujuan : Mempertahankan perfusi jaringan b. Intervensi 21 3.3. tanda vitalstabil.2.3.R : Memfokuskan kembali perhatian. edema berlebihan.

R :Panjang dan posisi saraf perineal meningkatkan resikocedera pada adanya fraktur kaki. pembengkakan pada dorsofleksi kaki. dan peningkatan nyeri. contoh kadarprotrombin.3. kulit dingin.3. 22 R : Alat traksi dapat menyebabkan tekanan pada pembuluhdarah/saraf.7 Selidiki tanda iskemia ekstremitas tiba tiba.11 Berikan kompres es sekitar fraktur sesuai indikasi.3.mengakibatkan iskemia dan kerusakan saraf permanen.5 Awasi posisi/lokasi cincin penyokong bebat.edema paru.12 Awasi Hb/Ht.3. pemeriksaan koagulasi.R : Membantu dalam kalkulasi kehilangan darah danmembutuhkan keefektifan terapi penggantian.3. Ambulasi sesegera mungkin. a.R : Perdarahan/pembentukan edema berlanjut dalam otottertutup dengan fasia ketat dapat menyebabkan gangguanaliran darah dan iskemia miositis atau sindromkompartemen. kongesti.3. terutama pada aksila dan lipat paha.R : Dislokasi fraktur sendi dapat menyebabkan kerusakanarteri yang berdekatan. frekuensipernapasan dan GDA dalam batas normal. terjadinyaparestesia. perhatikan tanda-tanda pucat/sianosisumum. Resiko tinggi terhadap kerusakan pertukaran gas berhubungandengan perubahan aliran: darah/emboli lemak.8 Dorong pasien untuk secara rutin latihan jari/sendi distalcedera. Perubahanmembran alveolar/kapiler: interstisial.e. perlu intervensi darurat untuk memperbaikisirkulasi.10 Awasi tanda vital. edema/sindromkompartemen. perubahan mental. danperubahan nadi distal. contoh penurunansuhu kulit.R : Ketidakadekuatan volume sirkulasi akan mempengaruhisistem perfusi jaringan.rusak.R : Menurunkan edema/pembentukan hematoma.6 Perhatikan keluhan nyeri ekstrem untuk tipe cedera ataupeningkatan nyeri pada gerakan pasif ekstremitas. b. Tujuan : Mempertahankan fungsi pernafasan adekuat. 23 R : Terdapat peningkatan potensial untuk tromboflebitis danemboli paru pada pasien imobilisasi selama 5 hari ataulebih. dengan akibat hilangnya alirandarah distal.4 Tes sensasi syaraf perifer dengan menusuk pada keduaselaput antara ibu jari pertama dan kedua. yangdapat mengganggu sirkulasi. . tegangan otot/nnyeri tekan dengan eritema.3.3. Kriteria hasil : Tidak adanya dispnea/sianosis.9 Selidiki nyeri tekan.R : meningkatkan sirkulasi dan menurunkan pengumpulandarah khususnya pada ekstremitas bawah.3.

4. dispnea. terjadinya sianosissentral.R : Takipnea. letargi. dan emboli.4. lipase serum. palatum keras.2 Auskultasi bunyi napas perhatikan terjadinya ketidaksamaan.R : Ini dapat mencegah terjadinya emboli lemak yang erathubungannya dengan fraktur.3 Atasi jaringan cedera/tulang dengan lembut. contoh atelektasis. pada aksila. meluas keabdomen/tubuh. mukosa mulut.stupor. penggunaan otot bantu.6 Observasi sputum untuk tanda adanya darah.R : Meningkatkan sediaan O 2 untuk oksigenasi optimal jaringan. Perhatikanstridor.R : Meningkatkan ventilasi alveolar dan perfusi.Reposisi dengan sering.bunyi hiperesonan. kacau.4 Instruksikan dan bantu dalam latihan nafas dalam dan batuk.4.7 Bantu dalam spirometri insentif.4.4. Kalsium. .R : Anemia.10 Berikan obat kortikosteroid. Intervensi 24 4. yang tampak dalam 2 – 3 hari setelah cedera. khususnya selamabeberapa hari pertama.gelembung lemak dalam darah/urine/sputum danpenurunan jumlah trombosit sering berhubungan denganemboli lemak.9 Awasi hasil Hb.1 Awasi frekuensinya pernafasan dan upayanya.4. trombosit.R : Memaksimalkan ventilasi/oksigenasi dan meminimalkanatelektasis.5 Perhatikan peningkatan kegelisahan.4. kantungkonjungtiva dan retinaR : Ini adalah karakteristik paling nyata dari tanda embolilemak.4. LED.8 Berikan tambahan O 2 bila diindikasikan.R : Perubahan adanya bunyi adventisius menunjukkanterjadinya komplikasi pernafasaan.R : Steroid telah digunakan dengan beberapa keberhasilanuntukj mencegah emboli lemak.pneumonia. lemak.c. dan perubahan dalam mental dantanda dini insufisiensi pernafasan dan mungkin hanyaindikator terjadinya emboli paru. hipokalsemia.4. 25 R : Gangguan pertukaran gas/adanya emboli paru dapatmenyebabkan penyimpangan pada tingkatkesadaranpasien seperti terjadinya hipoksia/asidosis.dan inspeksi kulituntuk ptekie diatas garis puting. retraksi. juga adanya gemericik/ronki/mengi daninspirasi mengorok/bunyi sesak napas. peningkatan LED dan kadar lipase.

5. penggunaan analgesic.R : Menurunkan resiko kontraktur fleksi panggul. dan mencegah komplikasi.R : Meningkatkan aliran darah ke otot dan tulang untukmeningkatkan tonus otot. c. tangan/kaki.Imam Download this Document for FreePrintMobileCollectionsReport Document Kerusakan mobilitas fisik berhubungan dengan kerusakan rangkaneuromuskuler: nyeri/ketidaknyamanan. 27 5.6 Awasi TD dengan melakukan aktivitas.5.R : Pasien mungkin dibatasi oleh pandangan diri/persepsi diritentang keterbatasan fisik aktual.5.R : Mencegah/menurunkan insiden komplikasikulit/pernafasan. Berikan prifvasi.5.R : Mencegah/menurunkan insiden komplikasikulit/pernafasan.2 Instruksikan pasien untuk/bantu dalam rentang gerak pasif/aktifpada ekstremitas yang sakit dan yang tak sakit. Tujuan : Meningkatkan/mempertahankan mobilitas padatingkat paling tinggi yang mungkin.R : Meningkatkan kekuatan otot dan sirkulasi. dan perubahandalam kebiasaan diet dapat memperlambat peristaltik .R : Menurunkan resiko kontraktur fleksi panggul.4 Tempatkan dalam posisi telentang secara periodik bilamungkin.5. Awasi kebiasaan eliminasi dan berikanketeraturan dalam defekasi rutin. mempertahankan gerak sendi.8 Auskultasi bising usus. meningkatkankesehatan diri langsung.3 Berikan papan kaki. Kriteria hasil : Mempertahankan posisi fungsional. Perhatikan keluhanpusing. penggunaan analgesic.5 Bantu/dorong dalam perawatan diri/kebersihan. gulungantrokanter/tangan yang sesuai.5.pneumonia). a. (contoh dekubitus.6 Awasi TD dengan melakukan aktivitas.5.7 Ubah posisi secara periodik dan dorong untuk latihanbatuk/napas dalam.9 Dorong peningkatan masukan cairan sampai 20003000ml/hari.R : Hipotensi postural adalah masalah umum menyertai tirahbaring lama dan dapat memerlukan intervensi khusus. Tempatkan dalam posisi telentang secara periodik bilamungkin.R : Berguna dalam mempertahankan posisi fungsionalekstremitas. bila traksi digunakan untuk menstabilkan frakturtungkai bawah. (contoh dekubitus. meningkatkankesehatan diri langsung.termasuk air asam/ jus.7 Ubah posisi secara periodik dan dorong untuk latihanbatuk/napas dalam.8 Auskultasi bising usus.pneumonia). dan perubahandalam kebiasaan diet dapat memperlambat peristaltik danmengakibatkan konstipasi.R : Hipotensi postural adalah masalah umum menyertai tirahbaring lama dan dapat memerlukan intervensi khusus. terapi restriktif (imobilitastungkai). Intervensi 5. Perhatikan keluhanpusing.5.1 Kaji derajat imobilitas yang dihasilkan oleh cedera/pengobatandan perhatikan persepsi pasien terhadap imobilisasi.R : Meningkatkan kekuatan otot dan sirkulasi.5. bila traksi digunakan untuk menstabilkan frakturtungkai bawah. Berikan prifvasi. bebat pergelangan.5 Bantu/dorong dalam perawatan diri/kebersihan.5.R : Tirah baring. b.mencegah kontraktur/atrofi dan resorpsikalsium karenatidak digunakan. Awasi kebiasaan eliminasi dan berikanketeraturan dalam defekasi rutin.5.R : Tirah baring.

R : Mencegah kerusakan kulit yang disebabkan oleh tertutuppada kelembaban di bawah gips dalam jangka lama. c.R : Memberikan informasi tentang sirkulasi kulit dan masalahyang mungkin disebabkan oleh alat dan/ataupemasangan gips. sirkulasi. 6./babet atau traksi. memutih. Perubahan sensasi. tonus. memajankan pada sirkulasi udara.R : Tekanan dapat menyebabkan ulsrasi.6.2 Ubah posisi dengan sering. laksatif)sesuai indikasi. karbohidrat. memutih. enema. . perubahan warna.R : Berguna dalam membuat aktivitas individual/programlatihan. Gosok perlahan denganalkohol. memajankan pada sirkulasi udara.danmengakibatkan konstipasi.5. khususnya padaakhir .R : Pada adanya cedera muskuloskeletal. kelabu.6.9 Dorong peningkatan masukan cairan sampai 20003000ml/hari.perdarahan. pemasangan traksi pen. dan konstipasi. dan kekuatan. b.ini dapat mempengaruhi massa otot. akumulasiekskresi/sekret. dan/atau bedak dengan jumlah sedikit borat ataustearat seng. kemerahan. kemerahan.5. dan area bersih. menurunkan resiko infeksiurinarius.2 Ubah posisi dengan sering. Tujuan : Menyatakan ketidaknyamanan hilang.R : Memberikan gips tetap kering. fraktur tebuka./babet atau traksi.kawat.6.5. benda asing. nekrosis.R : Dilakukan untuk meningkatkan evakuasi usus.5 Observasi untuk potensial area yang tertekan.6 Beri bantalan (petal) pada akhir gips dengan plester tahananair. sekrup.3 Bersihkan kulit dengan sabun dan air. Gosok perlahan denganalkohol.4 Tingkatkan pengeringan gips dengan mengangkat linen tempattidur.R : Mengurangi tekanan konstan pada area yang sama danmeminimalkan resiko kerusakan kulit. pembentukan batu.1 Kaji kulit untuk luka terbuka.Pertahankan penurunan kandungan protein sampai setelahdefekasi pertama.4 Tingkatkan pengeringan gips dengan mengangkat linen tempattidur. Kerusakan jaringan/integritas kulit berhubungan dengan cederatusuk. Kriteria hasil : Mencapai penyembuhan luka sesuai waktu. dan/ataukelumpuhan saraf. Intervensi 29 6. Imobilisasi fisik. Pasien dapat memerlukan bantuan jangkapanjang dengan gerakan.R : Mengurangi tekanan konstan pada area yang sama danmeminimalkan resiko kerusakan kulit. benda asing.g.11 konsul dengan ahli terapi fisik/okupasi dan/atau rehabilitasispesialis. kelabu.6.12 Lakukan program defekasi (pelunak feses.R : Memberikan informasi tentang sirkulasi kulit dan masalahyang mungkin disebabkan oleh alat dan/ataupemasangan gips.R : Memberikan gips tetap kering. dan/atau bedak dengan jumlah sedikit borat ataustearat seng. 6. khususnya padaakhir dan bawah bebatan/gips. dan aktivitas.10 Berikan diit tinggi protein. bedah perbaikan.5.perdarahan.termasuk air asam/ jus 28 R : Mempertahankan hidrasi tubuh.6.3 Bersihkan kulit dengan sabun dan air. kekuatan.5 Observasi untuk potensial area yang tertekan. vitamin. dan mineral.6.6. perubahan warna. dan area bersih.R : Mencegah kerusakan kulit yang disebabkan oleh tertutuppada kelembaban di bawah gips dalam jangka lama.1 Kaji kulit untuk luka terbuka. a. nutrisi yangdiperlukan untuk penyembuhan berkurang dengan cepat.

dan pengobatan. c. Intervensi 7.2 Kaji sisi pen/kulit perhatikan keluhan peningkatan nyeri/rasaterbakar atau adanya edema. contoh: Antibiotik IV/topical. kemerahan atau abrasi.R : Tekanan dapat menyebabkan ulsrasi.6.R : Dapat mengindikasikan timbulnya infeksi lokal/nekrosis jaringan.salah interprestasi informasi/tidak mengenal sumber informasi. dan kebutuhanpengobatan berhubungan dengan kurang terpajan/mengingat. b. prognosis. a.9 Berikan irigasi luka/tulang dan berikan sabun basah/hangatsesuai indikasi.sesuai prosedur. Tujuan : Menyatakan pemahaman kondisi. dan siapkan untuk membuka sistem balutan. prognosis.R : Memungkinkan pengurangan tekanan dan memberikanakses untuk perawatan luka/kuli 31 h. kulturdan sensitivitas luka/serum/tulang. diduga ada iritasikulit.6 Selidiki nyeri tiba-tiba/keterbatasan gerakan dengan edemalokal/eritema ekstremitas cedera. reflek tendon dalam dan kemampuan untukberbicara : Kekakuan otot. Kurang pengetahuan tentang kondisi. a.7.8 Bersihkan kulit dengan air sabun hangat.3 Tutupi pada akhir gips peritoneal dengan plastik.R : Meminimalkan tekanan pada kaki dan sekitar tepi gips.8 Berikan obat sesuai indikasi.R : Gips yang lembab. nekrosis. skan radioisotope. LED.7.7.5 Kaji tonus otot. .R : Anemia dapat terjadi pada osteomielitis.7.R : Bila area di bawah plester nyeri tekan. dan disfagiamenunjukkan terjadinya tetanus. trauma jaringan. katup ganda atau jendela. Resiko tinggi terhadap infeksi berhubungan dengan tidakadekuatnya pertahanan primer.9 Letakan bantalan pelindung dibawah kaki dan diatas tonjolantulang.R : Tanda perkiraan infeksi gangren.12 Buat gips dengan katup tunggal. leukositosisbiasanya ada dengan proses infeksi.R : Antibiotik spektrum luas dapat digunakan secaraprofilaktik atau dapat ditujukan pada mikroorganismekhusus. Kriteria hasil : Bebas drainase purulen atau eritema.6. bau drainase yang tidak enak.6.6.7.7.R : Meminimalkan tekanan pada area ini. Tujuan : Mencapai penyembuhan luka sesuai waktu.6 Beri bantalan (petal) pada akhir gips dengan plester tahanan Air 30 R : Memberikan perlindungan efektif pada lapisan gips dankelembaban.6.6.7 Awasi pemeriksaan laboratorium.R : Pen atau kawat tidak harus dimasukkan melalui kulit yangterinfeksi.i. dandemam.1 Inspeksi kulit untuk adanya iritasi atau robekan kontinuitas.7 Balik pasien dengan sering untuk melibatkan sisi yang tak sakitdan posisi tengkurap dengan kaki pasien diatas kasur.dan bawah bebatan/gips.R : Debridemen lokal/pembersihan luka menurunkanmikroorganisme dan insiden infeksi sistemik.7. dan/ataukelumpuhan saraf.10 Palpasi jaringan yang di plester tiap hari dan catat adanyanyeri tekan atau nyeri. drainase/bau tak enak. spasme tonik otot rahang.6. eritema. yang dapat menimbulkan osteomielitis. perubahanwarna kulit.7.R : Dapat mengindikasikan terjadinya osteomielitis. dapat meningkatkan per tumbuhanbakteri. krepitasi.R : Mencegah cedera pada bagian tubuh lain.R : Menurunkan kadar kontaminasi kulit. kerusakan kulit.4 Observasi luka untuk pembentukan bula.11 Tekuk ujung kawar atau tutup ujung kawat/pen dengan karetatau gabus pelindung/tutup jarum. darah lengkap.terpajan pada lingkungan.

Evaluasi Keperawatan Menurut carpenito (1998).meningkatkan kembalinya aktivitas sehari-hari secara dini. kemerahan.menggunakan penggunaanketerampilan relaksasi. R : Penyembuhan fraktur memerlukan waktu tahunan untuksembuh lengkap. Mengkaji kulit untuk luka terbuka. Terabanya nadi.Evaluasi yang diharapkan pada klien dengan fraktur adalah sbb: Menunjukan mekanika tubuh yang meningkatkan stabilitas padasisi fraktur.Kriteria hasil : Melakukan dengan benar prosedur yangdiperlukan dan menjelaskan alasan tindakan.R : Menurunkan resiko trauma tulang/jaringan dan infeksiyang dapat berlanjut menjadi osteomielitis.R : Penyusunan aktivitas sekitar kebutuhan dan yangmemerlukan bantuan.8.R : Mencegah kekakuan sendi. dan harapan yang akan datang E. Intervensi 8.7 Kaji ulang perawatan pen/luka yang tepat.4 Identifikasi tersedianya sumber pelayanan di masyarakat. evaluasi statuskemajuan klien kearah pencapaian. drainase/bau tak enak. Mengkaji sisi pen/kulit perhatikan keluhan peningkatan nyeri/rasaterbakar atau adanya edema.bunyi hipersonan.contoh tim rehabilitasi. Sasaran dan evaluasi mengenaistatus dari kejasian rencana keperawatan.kulit hangat tanda vital .8.9 Anjurkan penggunaan pakaian yang adaptif.1 Kaji ulang patologi. Mempertahankan tirah baring/ekstremitas sesuai indikasi.8.R : Membantu aktivitas berpakaian/kerapian.8.5.R : Banyak fraktur memerlukan gips. pelayanan perawatan dirumah.7. Mengkaji ulang patologi.8.R : Penggunaan yang hati-hati dapat mempercepatpengeringan.2. bebat. eritema.3 Buat daftar aktivitas dimana pasien dapat melakukannyasecara mandiri dan yang memerlukan batuan. dan kerjasama pasien dalam programpengobatan membantu untuk penyatuan yang tepat daritulang.8. Melakukan pengkajian fungsi neuromuskuler. D. kontraktur.Tahap implementasi keperawatan pada klien dengan Frakturmenurut Doenges.hal hak yang harus diperhatikanketika melakukan implementasi adalah implementasi dilakukan menurutdengan rencana tindakan yang valid.latihan nafas dalam.2 Beri penguatan metode mobilitas dan ambulasi sesuai instruksidengan terapi fisik bila diindikasikan.6 Diskusikan pentingnya perjanjian evaluasi klinis.8. benda asing.Pelaksanaan.8. Menunjukan teknik santai. c. dan kelelahan otot.4. prognosis. dan harapan yang akan datangR : Memberikan dasar pengetahuan dimana pasien dapatmembuat pilihan informasi. Mengauskultasi bunyi nafas prhatikan terjadinyaketidaksamaan.R : Memberikan bantuan untuk memudahkan perawatan diridan mendukung kemandirian. prognosis. Menginstruksikan pasien dalam rentang gerak pasif/aktif padaekstremitas yang sakit dan yang tidak sakit. Pelaksanaan atau implementasi adalah merupakan perencanaankeperawatanoleh perawat dank lien.dkk (1999) sbb:1.5 Dorong pasien untuk melanjutkan latihan aktif untuk sendi diatas dan di bawah fraktur. evaluasi mencakup 3 pertimbanganyang berbeda: evaluasi mengenai stasus klien.8 Anjurkan penggunaan pengering rambut untuk mengeringkanarea gips yang lembab.imajinasi visualisasi.3.berikansokongan sendi diatas dan dibawah fraktur bila bergerak /membalik Mendorong menggunakan teknik manajemen stress.perdarahan dan perubahan warna. atau penjepitselama proses penyembuhan.perhatikan fungsimotorik/sensorik dan minta pasien untuk melokalisasinyeri/ketidaknyamanan. juga adanya gemericik/ronki/bunyissesak nafas.8.6.mampu berpartisipasi dalam aktivitas / tidur / istirahat dengan tepat.menunjukan pembentukan kalus/mulai penyatuanfraktur.contohrelaksasi.3.

rasa kaku (+). gerakan ekstensi pasif (+) pada sendi DIP digiti V. Klien paham/mengerti tentang informasi yang di berikan perawat mallet finger (disebut juga jari palu.4.s8.haluaran urineadekuat.5. Kelainan pada jari palu mempengaruhi sendi interphalanx distal (DIP) dan merupakan akibat dari adanya cedera tertutup pada mekanisme ekstensor dekat insersinya ke dalam phalanx distal. ± 10 hari yang lalu. TERAPI Penatalaksanaan mallet finger pada pasien ini adalah secara operatif (ORIF). DIAGNOSIS Mallet finger digiti V manus sinistra et causa fraktur avulsi phalanx distal digiti V. merah dan sakit bila digerakkan selama ± 5 hari. 0.sianosis. jari kelingking pasien terbentur saat hendak menangkap helm yang jatuh dari motor. Pada pemeriksaan rontgen manus sinistra AP.eritema. kemudian dilakukan fiksasi DIP dengan K-wire no. sendi DIP tetap dalam keadaan fleksi. gerakan ekstensi aktif (-). nyeri (-). drop finger. bengkak. Kata Kunci : Mallet finger.frekuensi dan seri GDA dalam batasnormal. Sebelumnya. Tidak adanya dispnea. Kemudian jari kelingking tersebut membaik dengan sendirinya. nyeri tekan (-).7. mengeluh jari kelingking tangan kirinya bengkok dan tidak dapat diluruskan pada bagian ujung dekat kuku. Tidak ada tanda tanda infeksi.6. drop finger.dan demam. DISKUSI Berbagai cedera fleksi pada jari saat jari memegang dalam posisi ekstensi berisiko terjadi cedera pada mekanisme ekstensor pada sendi distal interphalanx (DIP). lateral didapatkan fraktur avulsi phalanx distal digiti V dengan soft tissue swelling di dorsal articulatio interphalanx distal. baseball finger. Jari tersebut menjadi bengkok (menekuk ke arah dalam). Mekanisme klasik dari cedera . namun jari tetap bengkok dan tidak bisa diluruskan. 40 tahun. baseball finger) merupakan salah satu kelainan bentuk jari dimana bagian ujung jari menekuk ke arah dalam dan tidak dapat lurus sendiri. sendi interphalanx distal HISTORY Seorang wanita. sianosis (-). Kehilangan kontinuitas tendon ekstensor pada sendi DIP menyebabkan sendi berada dalam posisi fleksi abnormal. Bebas drainage purulent. Pada pemeriksaan status lokalis regio manus sinistra didapatkan digiti V tampak menekuk ke arah dalam (posisi fleksi abnormal) pada sendi DIP dengan hiperekstensi sendi PIP. merupakan karakteristik dari mallet finger. Meningkatkan kemampuan dalam melakukan aktivitasmeningkatkan kekuatan/fungsi yang sakit dan mengkompensasibagian tubuh6. Dilakukan reposisi DIP digiti V manus sinistra. jari palu. Walaupun usaha untuk mengekstensikan jari dilakukan secara aktif.stabil. edema (-).

RA. Bagian Ilmu Penyakit Bedah.1. REFERENSI Mauffrey.The Internet Journal of Orthopedic Surgery. Metode ini merupakan standar baku emas dengan morbiditas yang minimal pada sebagian besar pasien dengan cedera mallet tertutup.3. dilakukan fiksasi Kirschner wire (K-wire) melewati sendi DIP pada posisi ekstensi dengan sendi PIP pada posisi ekstensi.emedicine. dilakukan splinting pada sendi DIP dalam posisi ekstensi selama 6-8 minggu. terdapat fraktur yang melibatkan lebih dari sepertiga permukaan sendi atau pasien dengan cedera mallet terbuka. Terdapat dua metode terapi pada mallet finger. Pada umumnya. voli. Diakses dari www. C. Terdapat dua metode terapi pada mallet finger. eneral Anestesi dengan LMA selama Tindakan ORIF Pada Pasien dengan Status Fisik ASA II Abstract . Terapi secara pembedahan dianjurkan untuk lesi mallet akut dan kronik pada pasien yang gagal dengan terapi konservatif. KESIMPULAN Mallet finger merupakan salah satu kelainan bentuk jari dimana sendi DIP berada dalam posisi fleksi abnormal. biasanya terjadi pada saat berolahraga seperti softball. yaitu terapi konservatif dan operatif. Tujuan utama dari semua metode terapi adalah untuk mengembalikan kontinuitas tendon yang cedera dengan kesembuhan fungsi yang maksimum. Meals. Splint yang digunakan dapat berupa plaster cast (gips jari). tidak dapat bekerja dengan adanya splint pada jari. 2006. stack splint atau thermoplastic splint. RS Jogja. 2009.com PENULIS Alfa Zudia Meitadevi. Pada terapi konservatif. walaupun usaha untuk mengekstensikan jari dilakukan secara aktif. Mallet finger.ini adalah jari sedang memegang secara kaku pada posisi ekstensi atau mendekati ekstensi maksimum ketika jari tersebut terbentur pada bagian ujungnya. yaitu terapi konservatif dengan penggunaan splint dan terapi operatif dengan reposisi dan fiksasi. Mallet finger: a review. atau basket dimana bagian ujung jari membentur bola.

ORIF open fraktur phalang proximal digiti IV-V manus dextra dengan riwayat CKR dengan status Fisik ASA II TERAPI Penatalaksanaan Pre Operasi : Infus RL 20 tetes per menit.Laki-laki 27 tahun. asma. Keyword : general anestesi. Pasien didiagnosis open fraktur os phalanx proximal digiti IV dan V manus dextra dan direncanakan tindakan ORIF. Pasien didiagnosis open fraktur phalang proximal digiti IV-V manus dextra dan akan dilakukan ORIF. Dilakukan general ansetesi dengan Laringeal mask airway ( LMA ). sevoflurane 2%. nadi 76x/menit. Ketorolac 30 mg. keluhan utama jari keempat dan kelima tangan kanan patah setelah kecelakaan antara motor dan motor 1 hari SMRS. Anestesi umum adalah tindakan meniadakan nyeri secara sentral disertai hilangnya kesadaran dan bersifat pulih kembali. alergi dan diabetus melitus. respirasi 16 x/menit dan afebris. Pemeriksaan Rontgen Manus dextra didapatkan fraktur os phalanx proximal digiti IV dan V manus dextra. Maintenance: infus 2cc/kgBB/jam dengan ringer Laktat. kepala pasien terbentur dan pasien tidak ingat saat jatuh. sirkulasi (2). dengan keluhan utama jari keempat dan kelima tangan kanan patah setelah kecelakaan. LMA adalah alat supra glotis airway. respirasi (2). Teknik anestesi: General Anestesi. dengan teknik semiclosed. ORIF HISTORY Seorang pasien laki-laki umur 27. Dari penmriksaan fisik didapatka TD 120/80. nafas spontan assist dengan LMA nomer 4. Post Operasi : dilakukan penilaian aldrette score: kesadaran (1). pasien lupa posisi jatuh dan bagaimana jatuhnya. Awasi vital sign dan keadaan . warna (2). Tidak ada riwayat hipertensi. ORIF dilakukan dengan anestesi umum. untuk mengendalikan jalan nafas dan proteksi reflek-reflek jalan nafas maka digunakan LMA sebagai manajemen airwaynya. N2O dan O2 50%:50%. obat-obatan: Ondansentron 4 mg. rontgen thorak dan EKG dalam batas normal. Pasien juga mengeluhkan adanya bengkak pada jari-jari tangan kanannya. kemaudian pasien terjatuh. puasa 8 jam. didesain untuk memberikan dan menjamin tertutupnya bagian dalam laring untuk ventilasi spontan dan memungkinkan ventilasi kendali pada mode level (< 15 cm H2O) tekanan positif. Induksi: Propofol 140 mg. Berdasarkan ini pasien dalam status fisik ASA II (pasien dengan kelainan sistemik ringan yang tidak berhubungan dengan pembedahan. aktivitas (2). Terdapat luka robek pada jari ke empat pasien dan luka lecet pada tangan kanan. Tabrakan dari arah berlawanan. Hasil pemeriksaan fisik. LMA. laboratorium. dan pasien masih dapat melakukan aktivitas sehari-hari) dengan riwayat cedera kepala ringan . Selama anestesi umum. Pasien ini dalam status fisik ASA II. DIAGNOSIS Pre Op. Premedikasi: Midazolam 4 mg. Saat kecelakaan pasien terbentur dan pasien tidak ingat saat jatuh. fentanyl 50 μg.

Setelah dilakukan Pemeriksaan fisik lengkap. analgesi. ketika pemakaian ET menjadi suatu indikasi. masuk dalam kategori ASA II karena adanya riwayat cedera kepala ringan. Pada anestesi umum harus memenuhibeberapa hal ini yaitu hipnotik. N2O dan sevoflurane. dan relaksasi otot lurik yang cukup. analgesia cukup. relaksasi otot diperlukan untuk mengurangi tegangnya tonus otot sehingga akan mempermudah tindakan pembedahan. Infus RL 20 tetes per menit. Teknik anestesi umum dengan LMA. stabilisasi otonom. jenis anestesi yang paling baik digunakan dalam operasi ORIF ini adalah general anestesi. pemeriksaan laboratorium. Keuntungan penggunaan LMA diabanding ET adalah kurang invasiv. Pada pasien ini diberikan maintenance oksigen. Induksi anestesi adalah tindakan untuk membuat pasien dari sadar menjadi tidak sadar. dan ketamin.umum. efek laringospasme dan bronkospasme minimal. Pada pasien ini diberikan premedikasi midazolam 4 mg fentanyl 50 μg. karena insersi LMA akan mengakibatkan laryngospasme. LMA juga tidak dapat dilakukan pada pasien dengan reflek jalan nafas yang intack. disertai hilangnya kesadaran dan bersifat pulih kembali atau reversible. posisi supine. Diberikan analgetik berupa injeksi ketorolac 30 mg tiap 8 jam secara intravena mulai jam 20. mudah penggunaanya. LMA bukanlah suatu penggantian ET.Rumatan anestesi biasanya mengacu pada trias anestesi yaitu tidur ringan. Dipilih manajemen jalan nafas dengan LMA karena pertimbangan lama operasi yang tidak begitu lama. Untuk mengurangi mual muntah pasca bedah sering ditambahkan premedikasi suntikan intramuscular untuk dewasa dengan ondansetron 4 mg. dan pasien masih dapat melakukan aktivitas sehari-hari.V manus dextra pasien dianjurkan oleh dokter untuk dilakukan tindakan Open Reduction Internal Fixation. DISKUSI Pada kasus ini pasien datang dengan keluhan utama jari keempat dan kelima tangan kanan patah setelah pasien mengalami kecelakaan lalu lintas. Untuk menjamin jalan nafas pasien selama tidak sadar. Dan diketahui bahwa kondisi pasien cukup baik dan memenuhi persyaratan operasi. minimal trauma pada gigi dan laring. dan tidah membutuhkan agen relaksasi otot untuk pemasangannya. ASA II diinterpretasikan bahwa pasien dengan kelainan sistemik ringan yang tidak berhubungan dengan pembedahan. LMA sebagai alternatif dari ventilasi face mask atau intubasi ET untuk airway management.00 dan diberikan anti muntah berupa injeksi ondansentron 4 mg tiap 8 jam bila perlu. status fisik pra anestesi. dan pemeriksaan penunjang thorax foto dengan teliti dan lengkap diketahui pasien mengalami fraktur phalang proximal digiti IV. Obat – obatan untuk induksi anestesi diantaranya adalah tiopental. maka dilakukan pemasangan LMA. propofol. karena LMA tidak dapat digunakan pada pasien yang membutuhkan bantuan ventilasi dalam jangka waktu lama. Oksigen diberikan . karena dinilai lebih aman dan lebih tidak invasive disbanding dengan pemasangan Endotracheal Tube (ET). sehingga memungkinkan dimulainya anestesi. Anestesi umum adalah tindakan anestesi yang dilakukan dengan cara menghilangkan nyeri secara sentral. Berdasarkan status fisik pasien tersebut.

R. Indian Journal Anesthesia.4) nafas spontan assist. N2O sebagai analgetik dan isoflurane untuk efek hipnotik. R. aktivitas. 2. Dachlan. Muhiman. Pulih dari anestesi umum pasien dikelola di unit perawatan pasca anestesi. Mikhail MS. Selama di unit parawatan pasca anestesi pasien dinilai tingkat pulih-sadarnya untuk kriteria pemindahan ke ruang perawatan biasa. Morgan GE.Murray M. FK UI. 2006. mengigil atau bahkan perdarahan. mual-muntah. Jakarta:Bagian Anestesiologi dan Terapi Intensif. Suryadi. respirasi (2).. Clinical Anesthesiology 4th edition. gangguan kardiovaskular. 49(4): 275-280 APORAN PENDAHULUAN ASUHAN KEPERAWATAN PADA PASIEN FRAKTUR .. J. Dachlan. Latief Said. Sunatrio.. gelisah. Sood. 4. Anestesiologi. tanpa keluhan dan mulus. aktivitas (2). sirkulasi/kardiologi (2). M. R. DAFTAR PUSTAKA 1. 3. yang dinilai adalah kesadaran. LMA didesain untuk memberikan dan menjamin tertutupnya bagian dalam laring untuk ventilasi spontan dan memungkinkan ventilasi kendali pada mode level tekanan positif. McGraw Hill. dan kardiologi atau tekanan darah. dan pemeriksaan status preoperatif pasien ASA II. New York. Petunjuk Praktis Anestesiologi. warna kulit.untuk mencukupi oksigenasi jaringan. Namun kenyataannya sering dijumpai hal-hal yang tidak menyenangkan akibat stress pasca bedah atau pasca anestesi misalnya gangguan nafas. 2005.. dan warna kulit (2). Untuk itulah perlu dilakukan pengawasan ketat. Laringeal Mask Airway and Its Variants. Thaib. KESIMPULAN Berdasarkan hasil anamnesa dan pemeriksaan fisik pasien didiagnosa dengan open fraktur phalang proximal digiti IV-V manus dextra dengan riwayat CKR dilakukan operasi ORIF dengan teknik general anestesi inhalasi dengan pemasangan LMA (no. KA. respirasi. FK UI. LMA adalah salah satu alternatif manajemen airway selama prosedur pembedahan dibawah general anestesi.. Pada pasien ini kesadaran (1). Jakarta:Bagian Anestesiologi dan Terapi Intensif. Jayashere. Idealnya bangun dari anestesi secara bertahap.

pembuluh darah atau organ yang ikut terkena. PENGERTIAN Fraktur adalah terputusnya kontinuitas jaringan tulang atau tulang rawan yang umumnya disebabkan oleh rudapaksa ( Arif Mansjoer. 2. fraktur dapat diklasifikasikan menjadi : 1. 5. dimana kulit dari ekstremitas telah ditembus. biasanya disebabkan oleh trauma ( Sylvia A. Fraktur inkomplit Diskontinuitas jaringan tulang dengan garis patahan tidak menyebrang sehingga masih ada korteks yang utuh. 1995 ).1999) Berdasarkan perluasannya Fraktur diklasifikasi menjadi dua yaitu : 1. 3. Doenges. maka segmen itu akan stabil dan biasanya mudah dikontrol dengan bidai gips. 4. Berdasarkan bentuk garis patahan.A. fraktur ini tidak stabil dan sulit diperbaiki. . Fraktur oblik Fraktur yang garis patahnya membentuk sudut tulang. 4. Fraktur adalah pemisahan atau patahnya tulang ( Marilyn E. 3. Fraktur tertutup Fraktur yang fragmen tulangnya mempunyai hubungan dengan dunia luar. Fraktur green stick Fraktur tidak sempurna dan sering terjadi pada anak-anak. Fraktur komplit Terjadi bila seluruh tubuh tulang patah atau kontinuitas jaringan luas sehingga tulang terbagi dua bagian dan garis patahnya menyebrabg dari satu sisi ke sisi yang lain sehingga mengenai seluruh korteks. dibedakan menjadi empat yaitu : 1. Price. Fraktur patologis Fraktur yang disebabkan oleh adanya penyakit lokal pada tulang sehingga kekerasan dapat menyebabkan fraktur terjadi pada daerah-daerah tulang yang telah lemah oleh karena tumor atau proses patologik lainya.2000 ) Fraktur adalah patah tulang . Fraktur spiral Fraktur yang hanya menimbulkan sedikit kerusakan jaringan lunak dan fraktur semacam ini cenderung cepat sembuh dengan imobilasasi luar. Fraktur komplikata Fraktur yang disertai kerusakan jaringan saraf. 2. 2. Berdasarkan hubungan fragmen tulang dan jaringan sekitar. Korteks tulang hanya sebagian yang masih utuh. Fraktur kompresive Fraktur yang terjadi ketika dua tulang menumbuk tulang ketiga yang berada diantaranya. Fraktur linier atau transversal Fraktur yang garis patahannya tegak lurus terhadap sumbu panjang tulang. demikian juga periosteum. Fraktur terbuka Fraktur yang fragmen tulangnya pernah berhubungan dengan dunia luar. pada fraktur ini segmen-segmen tulang yang patah direposisi atau direduksi kembali ketempat semula.

risiko kerusakan integritas kulit Trauma langsung dan tak langsung akan menyebabkan terjadinya tekanan eksternal pada tulang . Trauma tidak langsung Jatuh bertumpu pada lengan yang menyebabkan patah tulang klavikula. Etiologi lain 1) Trauma tenaga fisik ( Tabrakan. benturan ) 2) Penyakit pada tulang ( proses penuaan. Nyeri bila digeser e. Spasme otot 3. Nyeri tekan d. patah tulang pada tempat benturan. Tanda dan gejala a. b.defisit perawatan diri .B. c. b.kerusakan mobilitas fisik Nyeri . kanker tulang ) 3) Degenerasi spontan 2. Bengkak akibat trauma dan perdarahan yang mengikuti. mungkin terdapat kelainan bentuk pada lokasi yang terkena. Funsiolaesia c. Trauma langsung Benturan pada lengan bawah yang menyebabkan patah tulang radius dan ulna. g. patah tulang tidak pada tempat benturan melainkan oleh karena kekuatan trauma diteruskan oleh sumbu tulang dan terjadi fraktur di tempat lain. PATOFISIOLOGI 1. Etiologi a. Deformitas. Krepitasi. dirasakan pada tulang fraktur yang disebabkan oleh pergeseran dua segmen ( suara gemetar ) f. Skema patofisiologi Trauma langsung dan tidak langsung Tekanan eksternal yang lebih besar dari yang dapat ditahan oleh tulang Perubahan kontinuitas pembedahan situasi baru Aliran darah jaringan tulang Pasca op Pre op Risiko terhadap Kerusakan Pertukaran gas cedera cemas Jaringan lunak Terpasang alat Kurang Spasme otot fiksasi internal pengetahuan sekunder .

Ditempat patah terbentuk bekuan fibrin dan berfungsi sebagai alat untuk melekatnya sel-sel baru. Creatinin Trauma otot meningkatkan beban creatinin untuk klirens ginjal. matur yang disebut kalus. a. sel-sel darah putih dan sel mast berakumulasi menyebabkan peningkatan aliran darah ketempat tersebut. MRI. PENATALAKSANAAN MEDIS 1. Konservatif fiksasi eksterna Alatnya : Gips. 3. Reposisi / setting Tulang Berarti pengambilan Fragmen tulang terhadap kesejahteraannya. Reaksi peradangan hebat terjadi setelah timbul fraktur. C.yang tekanannya lebih besar dari yang dapat ditahan oleh tulang. pembuluh darah dan persarafan. Penyembuhan memerlukan waktu beberapa minggu sampai beberapa bulan. b. WBC ( kadang meningkat karena proses infeksi ) 5. CT SCAN. SCAN Tulang. Anteragram/menogram Menggambarkan arus vaskularisasi. a. Imobilisasi Untuk mempertahankan reposisi sampai tahap penyembuhan. lokasi dan Tipe. flat screw. Sewaktu tulang patah maka sel-sel tulang akan mati. D. Rehabilitasi Pemulihan kembali / pengembalian fungsi dan kekuatan normal bagian yang terkena Daftar Pustaka . Fagositosis dan pembersihan sisa-sisa sel mast dimulai. otot. Reposisi tertutup dilakukan dengan mengembalikan fragmen tulang keposisinya dengan memanipulasi dan traksi manual. Tulang dikatakan fraktur bila terdapat interuksi dari kontinuitas tulang dan biasanya disertai cedera jaringan disekitarnya yaitu ligamen. Bekuan fibrin direabsopsi untuk membentuk tulang sejati. ORIF ( Open reduction Internal fictation ) Alatnya : Pen. fragmen tulang direposisi. Traksi b. Reposisi terbuka dengan pendekatan bedah. Penyembuhan dapat terganggu atau terlambat apabila hematoma fraktur tulang / kalus rusak sebelum tulang sejati terbentuk atau apabila sel-sel tulang baru rusak selama proses kalsifikasi dan pergeseran. Tomogram Untuk mendeteksi struktur fraktur yang kompleks. 3. perdarahan biasanya terjadi disekitar tempat patah dan kedalam jaringan lunak sekitar tulang tersebut. 4. tendon. 2. Bidai. deformitas. PEMERIKSAAN PENUNJANG 1. HCT (sering rendah karena perdarahan ). 2. Pemeriksaan Lab ( DL ) Untuk pasien fraktur yang perlu diketahui antara lain : HB. Sinar X ( rontgen ) Dapat melihat gambaran fraktur.

dimana potensial untuk terjadi infeksi (Sjamsuhidajat. 2. misalnya jatuh dengan tangan berjulur dan menyebabkan fraktur klavikula. FRaktur adalah terpisahnya atau patahnya tulang (Doenges. b.Marilyn.J. lambat dan sakit atau nyeri. 2000). 1999). Konsep Fraktur A. Fraktur yang disebabkan kontraksi keras yang mendadak dari otot yang kuat. Jakarta : EGC Mansjoer. Rakhitis : suatu penyakit tulang yang disebabkan oleh defisiensi Vitamin D yang mempengaruhi semua jaringan skelet lain. Oerswari. b. Rencana Asuhan Keperawatan Edisi Ketiga.(Arif Mansjoer. c.L.Sylvia . 2000). Jakarta : EGC Doenges. Fraktur terbuka adalah fragmen tulang meluas melewati otot dan kulit. 3. biasanya disebabkan oleh defisiensi diet.Jilid II. 1989).Jakarta : EGC Diposkan oleh Kumpulan Asuhan Keperawatan di 21:37 TINJAUAN TEORI I.arief. Cedera langsung berarti pukulan langsung terhadap tulang sehingga tulang patah secara spontan. Pengertian Fraktur Fraktur adalah putusnya hubungan normal suatu tulang atau tulang rawan yang disebabkan oleh kekerasan. Edisi 6. Jakarta : Media Aesculapius Price.Capernito. 2000). Secara spontan : disebabkan oleh stress tulang yang terus menerus misalnya pada penyakit polio dan orang yang bertugas dikemiliteran.1999.1999. Cederaatraumatik.Konsep Klinis dan Proses – Proses Penyakit. B. Fraktur tertutup (closed) adalah bila tidak terdapat hubungan antara fragmen tulang dengan dunia luar. 2000). Pemukulan biasanya menyebabkan fraktur melintang dan kerusakan pada kulit diatasnya. Fraktur atau patah tulang adalah terputusnya kontinuitas jaringan tulang atau tulang rawan yang umumnya disebabkan oleh rudapaksa (Mansjoer. Cedera tidak langsung berarti pukulan langsung berada jauh dari lokasi benturan. c. Tumor tulang (jinak atau ganas) : pertumbuhan jaringan baru yang tidak terkendali dan progresif. (E. Patofisiologis .2000. FrakturaPatologik Dalam hal ini kerusakan tulang akibat proses penyakit dimana dengan trauma minor dapat mengakibatkan fraktur dapat juga terjadi pada berbagai keadaan berikut : a.1995. Kapita Selekta Kedokteran. cedera traumatik pada tulang dapat disebabkan oleh : a. Infeksi seperti osteomielitis : dapat terjadi sebagai akibat infeksi akut atau dapat timbul sebagai salah satu proses yang progresif. . tetapi kadang-kadang dapat disebabkan kegagalan absorbsi Vitamin D atau oleh karena asupan kalsium atau fosfat yang rendah. Buku Saku Diagnoasa Keperawatan. Fraktur terbuka (open/compound)adalah bila terdapat hubungan antar fragmen tulang dengan dunia luar karena adanya perlukaan dikulit. Etiologi Penyebab fraktur dapat dibagi menjadi tiga yaitu 1. (Mansjoer.

Keadaan ini menimbulkan hematom pada kanal medulla antara tepi tulang dibawah periostium dengan jaringan tulang yang mengatasi fraktur. kemudian menstimulasi histamin pada otot yang iskhemik dan menyebabkan protein plasma hilang dan masuk ke interstitial. kerusakan tulang dan jaringan sekitarnya. tubuh mulai melakukan proses penyembuhan untuk memperbaiki cidera.Tek. sehingga meningkatkan tekanan kapiler. Hematom yang terbentuk bisa menyebabkan peningkatan tekanan dalam sumsum tulang yang kemudian merangsang pembebasan lemak dan gumpalan lemak tersebut masuk kedalam pembuluh darah yang mensuplai organ-organ yang lain. Patofisiologi Ketika patah tulang. yang bila berlangsung lama bisa menyebabkan syndroma comportement. Pathways Inkontinuitas tulang pergeseran fragmen tulang Perubahan jaringan sekitar kerusakan fragmen tulang Pergeseran frag tlg laserasi kulit spasme otot Tek. Akibat dari hal tersebut adalah terjadi perdarahan.C. Kapiler reaksi stres klien perdarahan pelepasan histamin melepaskan katekolamin Kehilangan Protein plasm Memobilisasi volume cairan hilang Asam lemak . D. Edema yang terbentuk akan menekan ujung syaraf. sumsum tulang dan jaringan lunak. tahap ini menunjukkan tahap awal penyembuhan tulang. Hematom menyebabkn dilatasi kapiler di otot. Hal ini menyebabkan terjadinya edema. pembuluh darah.Sum2 tlg > tinggin dari kapiler Deformitaas putus pena/arteri peningk. akan terjadi kerusakan di korteks. Terjadinya respon inflamsi akibat sirkulasi jaringan nekrotik adalah ditandai dengan vasodilatasi dari plasma dan leukosit. Ketika terjadi kerusakan tulang.

tranversal. 2) Fraktur segmental garis patah lebih dari satu tetapi saling berhubungan 3) Fraktur multiple garis patah lebih dari satu tetapi pada tulang yang berlainan. d) Kontaminasi ringan. Klasifikasi fraktur berdasarkan bentuknya a. c) Fraktur sederhana. Klasifikasi Fraktur 1. yaitu : 1) Derajat I a) Luka kurang dari 1 cm b) Kerusakan jaringan lunak sedikit tidak ada tanda luka remuk. 2) Derajat II a) Laserasi lebih dari 1 cm b) Kerusakan jaringan lunak.htm) E. obliq atau kumulatif ringan. 3) DerajatdIII . 2.edema bergabung dengan trombosit Penekanan \ Pembuluh Darah Emboli Penurunan Perfusi Menyumbat Jaringan Pembuluh darah (http://blog. Jenis khusus fraktur 1) Bentuk garis patah 1) Garis patah melintang 2) Garis patah obliq 3) Garis patah spiral 4) Fraktur kompresi 5) Fraktur avulse 2) Jumlah garis patah 1) Fraktur komunitif garis patah lebih dari satu dan saling berhubungan. fraktur terbuka dibagi menjadi tiga derajat. b. bila tidak terdapat hubungan antara fragmen tulang dengan dunia luar. Fraktur tertutup (closed).ilmu keperawatan. bila terdapat hubungan antara fragemen tulang dengan dunia luar karena adanya perlukaan di kulit.com/asuhan-keperawatan-pada-klien-dengan fraktur. avulse c) Fraktur komuniti sedang. Fraktur terbuka (open/compound). tidak luas.

Terjadi 6 – 10 hari setelah injuri b. Callus permanent akhirnya terbentuk tulang kaku dengan endapan garam kalsium yang menyatukan tulang yang patah c. 5) G. hematom disekitar fraktur Setelah 24 jam suplai darah di sekitar fraktur meningkat 2) Fase granulasi jaringan a. d. otot dan neurovaskuler serta kontaminasi derajat tinggi. Bengkak Edema muncul secara cepat dari lokasi dan ekstravaksasi darah dalam jaringan yang berdekatan dengan fraktur. 3. F. Tenderness/keempukan 6. Terjadi 1 – 5 hari setelah injury b. Pada tahap phagositosis aktif produk neorosis c. Nyeri mungkin disebabkan oleh spasme otot berpindah tulang dari tempatnya dan kerusakan . Granulasi terjadi perubahan berbentuk callus 4) Fase ossificasi a. Penekanan tulang 2. Tanda Dan Gejala 1.Terjadi kerusakan jaringan lunak yang luas meliputi struktur kulit. Echumosis dari Perdarahan Subculaneous 4. Hematome berubah menjadi granulasi jaringan yang berisi pembuluh darah baru fogoblast dan osteoblastq 3) Fase formasi callus a. Mulai pada 2 – 3 minggu setelah fraktur sampai dengan sembuh b. b. Deformitas Daya tarik kekuatan otot menyebabkan fragmen tulang berpindah dari tempatnya perubahan keseimbangan dan contur terjadi seperti : a. Fase consolidasi dan remadelling Dalam waktu lebih 10 minggu yang tepat berbentuk callus terbentuk dengan oksifitas osteoblast dan osteuctas. Tahap Penyembuhan Tulang Proses penyembuhan luka terdiri dari beberapa fase yaitu : 1) Fase hematom Yaitu Dalam waktu 24 jam timbul perdarahan. c. Frakturaincomplete Patah hanya terjadi pada sebagian dari garis tengah tulang. Rotasiapemendekanatulang. edema. Frakturacomplete Merupakan patah pada seluruh garis tengah tulang dan biasanya mengalami pergerseran (bergeser dari posisi normal). Spasme otot spasme involunters dekat fraktur 5.

traksi dan teknikfiksator externa. mempertahankan fragme tulang pada psisi yang sebenarnya selama penyembuhan. ROM aktif untuk meningkatkan kekuatan otot. derajat keparahan. 3. Rekognisi yaitu dilakukan dalam hal diagnosis dan penilaian fraktur. 7. Jenis traksi ada dua macam yaitu traksi kulit biasanya menggunakan perekat sepanjang extremitas kemudian dibalut.struktur di daerah yang berdekatan. Penatalaksanaan 1. Kehilangan sensasi (mati rasa. Retensi yaitu setelah fraktur direduksi. Kegunaan traksi adalah mengurangi patah tulang. mungkin terjadi dari rusaknya saraf/perdarahan) 8. Traksi Yaitu secara umum dilakukan dengan menempatkan beban dengan tali paaada extremitas klien.tindakan ini dapat dilaksanakan secara efektif didalam ruang gawat darurat atau ruang bidai gips. Imobilisasi dapat dilakukan dengan fiksasi external meliputi gips. dan reduksi terbuka pada reduksi ini insisi dilakukan dan fraktur dilurskan selama pembedahan dibawah pengawasan langsung. ROM aktif dan pasif. Jenis reduksi ada dua yaitu reduksi tertutup merupakan metode unuk mensejajarkan fraktur atau meluruskan fraktur. Pada saat pembedahan berbagai alat fiksasi internal digunakan pada tulang yang fraktur. Rehabilitasi merupakan proses pengembalian tulang kefungs dan struktur semula dengan cara . bidai. Reduksi Merupakan proses manipulasi pda tulang yang fraktur untukmemperbaiki kesejajaran dan mengurangi penekanan serta meregangkan saraf da pembulh darah. (Smeltzer. perawat atau mesin CPM (continous pasive motion). penarikan biasanya menggunakan katrol dan beban. Prinsipnya adalah mengetahui riwayat kecelakaan. Tempat tarikan disesuaikan sedemikian rupa sehingga arah tarikan segaris dengan sumbu tarikan tulang yang patah. 2001) G. katrol dan beban. memperbaiki deformitas. ROM dapat dilakukan pada therapist. Fisioterapi Alat untuk remobilisasi mencakup exercise terapiutik. Shock hipovolemik hasil dari hilangnya darah H. ujung plester dihubungkan dengan tali untuk ditarik. 2. ROM pasif mencegah kontraktur pada sendi dan mempertahankan ROM normal pada sendi. Prinsip Penanganan Fraktur Ada 4 dasar penangan fraktur yaitu : 1. untuk mengurangi nyeri selama tindakan penderita dapat diberikan narkotik IV sedatif atau blok saf lokal. fragmen tulang harus dimobilisasi atau dipertahankan dlam posisi dan kesejajaran ang benar sampai terjadi penyatuan. Pergerakan abnormal 9. 4. Traksi skelet biasanya menggunakan pin steinmen atau kawat kirshner yan lebih halus biasanya disebut kawat k yan ditusukkan pda tulang kemudia pin tesebut ditarik dengan tali. jenis kekuatan yang relepan dan deskripsi tentang peristiwa yang terjadi oleh penderita sendiri. 3. memobilisasikan tubuh bagian jaringan lunak. Reduksi yaitu usaha atau tindakan manipulasi fragmen-fragmen sepertileak asalnya. 2.

Keberhasilan proses keperawatan sangat bergantung pada tahap ini meliputi : 1. (predisposisi untuk hipoglikemia/ketoasidosis). marah. apakah rasa sakit menjalar atau menyebar. pekerjaan. apakah seperti terbakar. takut.ihubungan.golongan darah. Breathing Kelemahan menelan/ batuk /melindungi jalan napas. Circulation TD dapat normal atau meningkat . nyeri tersebut bisa akut atau kronk tergantung lamnya serangan.kdiagnosakmedis. . Airway Adanya sumbatan/obstruksi jalan napas oleh adanya penumpukan sekret akibatikelemahanmreflekmbatuk. atau tertusuk. 2.imisalnyaifinancial. kapan. c. Konsep Asuhan Keperawatan Pada Klien Dengan Fraktur A. 2) Quality of Pain : sepertapa nyeri yang dirasakan atau yang digambarkan klien. Pengumplan Data Yaitu a. Polai Fungsi Kesehatan a. tanggal masuk Rumah sakit. Diusahakan untuk meminimalkan atrofi disuase dan meningkatkan peredaran darah. Integritasaego Gejala : perasaan cemas. membrane mukosa yang kering (pembatasan pemasukkan / periode puasa pra operasi). 3) Region : apakah rasa sakit bisa mereda. apakah bertambah buruk. agama. 4) Severity ( scale) of paint : seberapa jauh ras nyeri yang dirasakan kien bisa berdasarkan skala nyeri atau klien menerangkan seberapa jauh rasa sakit mempengaruhiifungsinya. Keluhan Utama pada umunya keluhn utama pada kasus fraktur adalah nyeri. berdenyut. bahas yang digunakan seari-hari. bunyi jantung normal pada tahap dini. untuk memperoleh pengkajian yang lengkap tentang rasa nyeri klien digunakan : 1) Provoking ncident Apakahapakah ada peristiwa yang menjadi faktor persifitasiknyeri. apatis . Makanan/cairan Gejala : insufisiensi pancreas/DM.isianosisipadaitahapilanjut. hipotensi terjadi pada tahap lanjut. (FKUI. Identias klien meliputi nama.igayaihidup. timbulnya pernapasanyang sulitidan/ atauitak iteratur. dingin. isuarai nafasi terdengar ironchi / aspirasi. b. jenis kelamin. b. Latihan isometric dan setting otot. factor-faktor stress multiple. umur. e.melakukan ROM aktif dan pasif seoptimal mungkin sesuai dengan kemampuan klien. 5) Time : berapa lama nyeri berlangsung. disritmia. kulit dan membran mukosa pucat. malnutrisi (termasuk obesitas). alamt. dan dimana rasa saki terjadi atau lokasi rasa sakit tersebut. 2. Pengkajian Pengkajian adalah langkah awal dan dasar dalam proses keperawatan secara menyeluruh. NRM. d. stimulasi simpatis. peningkatan ketegangan/peka rangsang . pendidikan. takikardi. status perkawinan. 1995). Tanda : tidak dapat istirahat. suku bangasa.

Leher : tidak ada penonjolan. tidak ada nafas cuping hidung. Penggunaan alcohol (risiko akan kerusakan ginjal. mukosa mulut tidak pucat. . Munculnya kanker / terapi kanker terbaru . reguler atau tidaknya tergantung pada riwayat penyakit klien yang berhubungan dengan paru. antihipertensi. dan juga potensial bagi penarikan diri pascaioperasi). Keamanan Gejala : alergi/sensitive terhadap obat. Mata : tidak ada gangguan tidak anemis Karen tidak terjadi perdarahan. makanan. somnolen. Telinga : tes weber masih dalam keadaan normal. tidak ada odema. bengkak. odema. Mulut dan faring : Tidak ada pembesaran tonsil. plester. suhu sekitar daerah trauma meningkat. Hidung : tidak ada deformitas. Riwayat keluarga tentang hipertermia malignant/reaksi anestesi . 3. demam. Defisiensi immune (peningkaan risiko infeksi sitemik dan penundaan penyembuhan) . Pemeriksaan head totoes System integumen : terdapat eritema. dekongestan. antiinflamasi. bronchodilator.nyeri tekan. g. Torak: Ins: Ada retraksi dinding dada. 2) Kesakitan keadaan penyakit : akut kronok. kondisi yang kronis/batuk. atau obat-obatan rekreasional. Palpasi : pergerakan sama atau simetris. kardiotonik glokosid. apatis. tidak ada benjolan. h. berat. 3) Tanda-tanda vital tidak normal Karena ada gangguan baik fungsi/bentuk.tidak ada nyeri tekan. b. gusi tidak terjadi perdarahan. Wajah : wajah terlihat menahan sakit. Keadaan umum baik atau buruknya yang dicatat adalah tanda-tanda seperti : 1) Kesadaran penderita : composmentis. Tanda : menculnya proses infeksi yang melelahkan . antidisritmia. koma gelisah tergantung pada keadaan klien. ringan. sedang. antibiotic. analgesic. dan biasanya pada kasus fraktur biasanya akut. simetris. Pernapasan Gejala : infeksi. Riwayatitransfuseidarah/reaksiitransfuse. Penyuluhan/Pembelajaran Gejala : pengguanaan antikoagulasi. Paru : Inspeksi : pernafasan meningkat. antikonvulsan atau tranquilizer dan juga obat yang dijual bebas. Pemeriksaan Fisik a. fermitus teraba sama. steroid. dan larutan . merokok.f. yang mempengaruhi koagulasi dan pilihan anastesia. Kepala : tida ada gangguan yaitu normo cephalic. spoor. tidak ada perdarahan. diuretic. gerakan dada simetris. Riwayat penyakit hepatic (efek dari detoksifikasi obat-obatan dan dapat mengubah koagulasi) . reflek menelan ada.

untuk mengetahui lokasi fraktur dan garis fraktur secara langsung. Perkusi : timpani. gerakan fragmen tulang. simetris. Anus. Risiko infeksi berhubungan dengan stasis cairan tubuh. perubahan status metabolik. terdapat jaringan nekrotik. skor C1.Tidak ada hernia. B. prognosis dan kebutuhan pengobatan berhubungan dengan keterbatasan kognitif. Tidak teraba masa. tidak ada suara tambahan lainnya. 3) Artelogram dicurigai bila ada kerusakan vaskuler 4) Hitung darah lengkap HT mungkin meningkat ( hemokonsentrasi ) atau menrurun ( perdarahan bermakna pada sisi fraktur atau organ jauh pada traumammultiple) Peningkatan jumlah SDP adalah respon stres normal setelah trauma 5) Profil koagulasi perubahan dapat terjadi pada kehilangan darah transfusi multiple atau cedera hati (Doenges. 4. luka/kerusakan kulit. Inguinal. . . turgor kulit buruk. mengetahui tempat dan type fraktur biasanya diambil sebelum dan sesudah dilakukan operasi dan selama proses penyembuhan secara periodic. salah interpretasi informasi. prosedur invasif dan jalur penusukkan. Auskultasi : suara nafas vesikuler. bentuk datar. Pemeriksaan Penunjang 1) FotoaRontgen. kelemahan. Genetalia. tidak ada wheezing. 1994) Diagnosa keperawatan yang muncul pada pasien dengan fraktur (Wilkinson. tidak ada pembesaran limfe. edema dan cedera pada jaringan. kerusakan sirkulasi dan penurunan sensasi dibuktikan oleh terdapat luka / ulserasi. 2) Skor tulang tomography. Diagnosad Keperawatan Diagnosa keperawatan adalah suatu penyatuan dari masalah pasien yang nyata maupun potensial berdasarkan data yang telah dikumpulkan (Boedihartono.Perkusi : sonor. 2006) meliputi : 1. ansietas 2. insisi pembedahan. alat traksi/immobilisasi. Kurang pengetahuan tantang kondisi. stress. ronche. Jantung : Inspeksi : tidak tanpak iktus Palpasi : Nadi meningkat Auskultasi : suaa S1 dan S2 tunggal. tidak ada pembesaran hepar. penurunan berat badan. 3. Kerusakan integritas kulit berhubungan dengan tekanan. Abdomen Inspeksi tidak distensi. ada pantulan gelombang pantulan cairan Peristaltic usu normal ± 20 kali/menit. kurang terpajan/mengingat. 2000). Mr1 : dapat digunakan mengidentifikasi kerusakan jaringan lunak. tidak ada kesulitan BAB c. respons inflamasi tertekan. Nyeri berhubungan dengan terputusnya jaringan tulang.

Nyeri adalah pengalaman sensori serta emosi yang tidak menyenangkan dan meningkat akibat adanya kerusakan jaringan aktual atau potensial. Jelaskan pada klien penyebab dari nyeri R/ memberikan penjelasan akan menambah pengetahuan klien tentang nyeri. digambarkan dalam istilah seperti kerusakan . 2.Nyeri berkurang atau hilang . Tujuan : Mencapai penyembuhan luka pada waktu yang sesuai. Tujuana:anyeriadapataberkurangaatauahilang. R/ mengetahui sejauh mana perkembangan luka mempermudah dalam melakukan tindakan yang tepat. Kaji tingkat intensitas dan frekwensi nyeri R/ tingkat intensitas nyeri dan frekwensi menunjukkan skala nyeri c. dimana analgesik berfungsi untuk memblok stimulasi nyeri. Intervensi Intervensi adalah penyusunan rencana tindakan keperawatan yang akan dilaksanakan untuk menanggulangi masalah sesuai dengan diagnosa keperawatan Diagnosa (1) 1. Intervensi : a. Tanda-tanda vital dalam batas normal atau dapat ditoleransi. Observasi tanda-tanda vital. Melakukan kolaborasi dengan tim medis dalam pemberian analgesik R/ merupakan tindakan dependent perawat. Intervensi a. . warna. d. serta jumlah dan tipe cairan luka. Kaji kulit dan identifikasi pada tahap perkembangan luka. awitan yang tiba-tiba atau perlahan dari intensitas ringan samapai berat dengan akhir yang dapat di antisipasi atau dapat diramalkan dan durasinya kurang dari enamabulan. ukuran. R/ mengidentifikasi tingkat keparahan luka akan mempermudah intervensi. alat traksi/immobilisasi.C.Klien tampak tenang. edema dan cedera pada jaringan. Kriteria Hasil : . Lakukan pendekatan pada klien dan keluarga R/ hubungan yang baik membuat klien dan keluarga kooperatif b. gerakan fragmen tulang. Nyeri berhubungan dengan terputusnya jaringan tulang. Kaji lokasi. stress. bau. ansietas. R/ untuk mengetahui perkembangan klien e. luka bersih tidak lembab dan tidak kotor. Kerusakan integritas kulit adalah keadaan kulit seseorang yang mengalami perubahan secara tidak diinginkan. b. Kriteria Hasil : tidak ada tanda-tanda infeksi seperti pus.

R/ untuk mengurangi risiko infeksi nosokomial. g. c. Tujuan : infeksi tidak terjadi/terkontrol. Kolaborasi untuk pemberian antibiotik. sepertiaHbadankleukosit. perubahan sirkulasi. R/ penurunan Hb dan peningkatan jumlah leukosit dari normal bisa terjadi akibat terjadinya proses infeksi. efek prosedur dan proses pengobatan. R/ suhu tubuh yang meningkat dapat diidentifikasikan sebagai adanya proses peradangan. Setelah debridement. e. prognosis dan kebutuhan pengobatan berhubungan dengan keterbatasan kognitif kurang terpajan atau mengingat salah interpretasi informasi. prosedur invasif dan kerusakan kulit. Lakukan perawatan luka dengan teknik aseptik. R/ tehnik aseptik membantu mempercepat penyembuhan luka dan mencegah terjadinya infeksi. kateter. Berikan perawatan luka dengan tehnik aseptik. 4. 3. R/ balutan dapat diganti satu atau dua kali sehari tergantung kondisi parah/ tidak nya luka. Kriteria hasil : Tidak ada tanda-tanda infeksi seperti pus. b. ganti balutan sesuai kebutuhan. R/ mengidentifikasi tanda-tanda peradangan terutama bila suhu tubuh meningkat. Lakukan perawatan terhadap prosedur inpasif seperti infus. Intervensi dan Implementasi : a. Jika pemulihan tidak terjadi kolaborasi tindakan lanjutan. Kriteria Hasil : . R/ antibiotik mencegah perkembangan mikroorganisme patogen. Pantau peningkatan suhu tubuh. e. Luka bersih tidak lembab dan tidak kotor. misalnya debridement. d. R/ mengendalikan penyebaran mikroorganisme patogen.c. R/ agar benda asing atau jaringan yang terinfeksi tidak menyebar luas pada area kulit normal lainnya. R / antibiotik berguna untuk mematikan mikroorganisme pathogen pada daerah yang berisiko terjadi infeksi. Pantau tanda-tanda vital. Risiko infeksi berhubungan dengan tidak adekuatnya pertahanan perifer. agar tidak terjadi infeksi. Kolaborasi pemberian antibiotik sesuai indikasi. gunakan plester kertas. Tanda-tanda vital dalam batas normal atau dapat ditoleransi. Kurang pengetahuan tentang kondisi.adll. f. Jika ditemukan tanda infeksi kolaborasi untuk pemeriksaan darah. kadar gula darah yang tinggi. Tujuan : pasien mengutarakan pemahaman tentang kondisi. Balut luka dengan kasa kering dan steril. d. drainasealuka.

klien dan keluarganya akan merasa tenang dan mengurangi rasa cemas. b. R/ dengan mengetahui penyakit dan kondisinya sekarang. Memulai perubahan gaya hidup yang diperlukan dan ikut serta dalam regimen perawatan. R/ diet dan pola makan yang tepat membantu proses penyembuhan. d. R/ mengetahui seberapa jauh pengalaman dan pengetahuan klien dan keluarga tentang penyakitnya. Minta klien dan keluarga mengulangi kembali tentang materi yang telah diberikan. Kaji tingkat pengetahuan klien dan keluarga tentang penyakitnya. Berikan penjelasan pada klien tentang penyakitnya dan kondisinya sekarang. R/ Mengetahui seberapa jauh pemahaman klien dan keluarga serta menilai keberhasilan dari tindakan yang dilakukan.NTB 6 – 05 – 2010 . BAB III TINJAUAN KASUS ASUHAN KEPERAWATAN PADA KLIEN An”M” DENGAN DIAGNOSA MEDIS FRAKTUR OSS NASAL DI RUANGAN IGD DI RSUP. c.Melakukan prosedur yang diperlukan dan menjelaskan alasan dari suatu tindakan. Intervensi : a. Anjurkan klien dan keluarga untuk memperhatikan diet makanan nya.

1. P: Inkontinuitas jaringan Q: Nyeri tajam R: Terlokalisasi pada dairah nasal S: 5 (0-5) Klien tampak menangis 3.5 • Devisiasi septal nasal • Tampak perdarahan aktif pada luka sobek • Klien tampak menangis • Nasal tampak odema A: • Ibu klien menyatakan kalau klien tidak ada riwayat alergi pada suatu zat (obat/makanan/minuman dll) M: • Ibu klien menyatakan sebelum di bawa ke RSUP NTB IGD klien diolesi dengan minyak atau obat tradisional pada dairah yang luka atau nasal P: • Ibu kiien menyatakan sebelumnya klien tidak pernah mengalami peerdarahan atau fraktur dan .reg :07803 Pendidikan : SD Pekerjaan :Alamat :Suweta b. SAMPEL S: • Tampak luka sobek pada dairah nasal 1x1x0. Identitas Klien Nama :An”M” Umur :8 thn Jenis klamin :Laki-laki Status :Agama :Islam No. Pengkajian a. Identitas Penanggung Jawab Nama :Tn”K” Umur :50 thn Jenis klamin :Laki-laki Hubungan :Ayah Pekerjaan : PNS Alamat :Suweta 2. Keluhan Utama Nyeri pada dairah nasal (klien tampak menangis) dan luka sobek pada ½ bagian nasal anterior.

00 wita 4. Dan klien di temukan dalam keadaan sadar dan menangis.ibu klien menyatkan kalau sebelumnya bentuk nasal klien tidak depisiasi L: • Makan /minnum terakhir pada tanggal 6-5-2010 pada pukul 08.2 Give comport : Mengatur posisi klien dengan posisi supinasi Menganjurkan orang tua klien untuk selalu mendmpingi klien Head to toes .5 ddengan kedalaman 0. 1) Kepala /leher • Rambut Ins: Distribusi rambut tampak merata. RR: 21x/m Birthing : RR:21x/m dengan irama nafas reguller dank lien dapat bernafas dengan sepontan Cirkulation : Perdarahan aktif melalui luka sobek (pada nasal (sianosis (-)) Disebelity : KU: baik .5 cm pada nasal. warna rambut hitam. Tinggi tangga 4 m. ABCDEFG Air way : Tidak ada tanda – tanda sumbatan pada jalan nafas spt perdarahan pada meatus nasal . klien tamapak dapat bernafas dengan normal tampa ada keluhan seperti sesak dll. kejadian pada tanggal 6-5-2010 pada pukul 10.00 wita E: • Klien turun dari tangga rumah dan kemungkinan terjatuh dari tangga rumah tsb (ibu klienn menyatkan tidak ada orang yang sempat melihat waktu klien terjatuh daari tangga ) klien sudah ditemukan di lantai dalam posisi duduk dan perdaarahan pada nasal (melallui luka sobek). bersih . luka tampak bersih Full vital sign : TD:.RR: 21x/m N: 80x/m S: 37.rambut pendek dan tampak rapi Pal:- .nasal tampak depisiasi Kesadaran: E4 V5 M6 Extpouse : Luka sobek diperkirakan karena terbentur pada lantai tangga rumah dengan luas luka sobek 1x1x0.NTB (IGD) pada pukul 11.45 wita dan sampai di RSUP.

• Abdomen Ins: Bentuk supely. bentuk bibir simetris. tikdak ada tanda – tanda trauma pada areal servikal. Pal:• Hidung Ins: Nasal tampak depisiasi. vesikuler) tidak ada suara nafas tambahan. suarda jantung normal (BJ I dan BJ II) dengan irama regular dengan frekwensi 80 x/m. RR:21x/m. lesi (-) Aus . • Mulut /gigi/lidah Ins: Tidak ada tanda –tanda trauma pada dairah oral. perdarahan (-). othorea (-). Pal: Tidak ada tanda – tanda nyeri . reflek cahaya (+) dengan refleks isokor.5 cm . tampak luka sobek dengan luas 1x1x0.batlle sign (-). mukosa bibir atau mulut tampak lembab. Pal: Nyeri tekan pada areal nasal dengna sekala 5 (0-5). Meatus nasal tamapak bersih. secret (-) . tampak perdarahan aktif pada nasal (melalui luka sobek). retraksi (-). tidak ada tanda-tanda trauma pada areal toraks. meatus akustikus tampak bersih. Pal:• Wajah Ins: Bentuk wajah opal . ikterik (-). Pal: Nyeri tekan (-). jumlah iga lengkap Per: Dullness (+).tanda trauma atau infeksi pada dairah mata . tidak ada lesi .• Kepala Ins: Tidak ada tanda –tanda lesi/trauma pada dairah kepala . warna gigi putih dengan jumlah gigi lengkap Pal:• Telinga Ins: Tidak ada tanda-tanda trauma pada areal akustikus . B/U 13x/m Pal : Nyeri tekan (-). Per:- . benjolan (-) • Mata Ins: Buka mata sepontan. resonan (+) Aus: Suara nafas normal (brongkial. Letak luka sobek pada ½ bagian corpus nasal anterior fars median. letak kedua mata sietris. pollip (-). bentuk simetris.dan wajah tampak simetris Pal:• Leher Ins: Devisisasi (-). Pal: Nyeri tekan (-) • Toraks Ins : Benruk normal (simetris ) dengan perbandingan dada (panjang dan lebar 2:1).brongkovesikuler. dan tidak ada tanda – tanda trauma abdomen. tidak ada tanda.

sianosis (-) Pal : Akral hangat +/+ 5.• Genetalia Tidak tekaji • Ekstrimitas Ins: Pergerakan aktif.P: inkontinuitas jaringan kulit dan tulang . tidak ada tanda – tanda trauma /fraktur pada dairah extrimitas. lesi (-). Analisa Data Sign Etiologi Problem DS: .klien tampak menangis .T: continue Inkontinuiotas jaringan Ransangan syaraf pucini Gangguan rasa nyaman (nyeri) DS: .R: nyeri terlokalisasi pada dairah hidung .S: 5 (0-5) .Ibu klien menyatkan menyatkan kalau klien jatuh dari tangga rumah DO: .klien merasa nyeri pada dairah hidung DO: .

Tampak perdarahan aktif pada hidung (melalui luka sobek) . Diagnosa a. skala nyeri 5 (0-5).5 . Gangguan rasa nyaman (nyeri) berhubungan dengan ransangan saraf nyeri (pucini) ditandai dengan klien mengeluh nyeri pada dairah hidung. devisiasi corpus nasal. tampak perdarahan aktif melalui luka..Nasal tampak odema Deselerasi Trauma langsung Inkontinuitas jaringan (tulang dan kulit ) 6.klien tampak menangis. . P: Inkontinuitas jaringan kulit dan tulang.Devisiasi corpus nasal .Luka tampak bersih . Inkontinnuitas jaringan kulit dan tulang berhmbungan dengan deselerasi ditandai dengan adanya luka sobek pada dairah hidung.Tampak luka sobek pada dairah nasal dengan luas luka 1x1x0. b.

Obs.Kolaborasi dalam pemberian terapi obaat-obatan.7.Klien tampak lebih tenang . TTV .Ciptakan lingkungan senyaman mungkin .Untuk menambah kenyamanan pada klien .00 Setelah di berikan perawatan selama ± 60 menit diharapkan rasa nyer dapat menurun dengna criteria hasil : .Untuk menurunkan rasa nyeri dan meningkatkan kerja sama tim Setelah di berikan perawatan selama ± 60 menit diharapkan inkontinuitas jaringan dapat .Untuk menenrukan intervensi selanjutnya .Klien menytakan kalau rasa nyeri dapat menurun .Kemungkinan adanya perubahan pada nilai TTV .Berikan / ajarkan teknik distraksi dan relaksasi pada keluarga dan klien . Rencana Hari /tggl No Dx Tujuan dan criteria hasil Rencana Rasional 06/05 2010 11.Sekala nyeri menurun .Observasi nyeri . X-ray dll .

Luka dirawat .Melalui tindakan yang salah / tidak sesui dengan prosedur dapat menyababkan anak menjadi trauma.Untuk menentukan intervensi selanjutnya .Kolaborasi dalam melakukan hathing dan obat-obatan . Keadaan luka .Untuk mempermudah melakukan perawatan .Untuk meningkatkan kerja sama tim .Obs.teratasi dengan criteria hasil: .Lakukan perawatan sebelum 6 jam dari waktu kejadian .Siapkan alat-alat perawatan luka .Infeksi nasokomial dapat terjadi malalui kontak langsung dengan klien dan melalui alat – alat yang di gunakan . .Rawat luka .Perdarahan dapat di control .Minimalkan infeksi nasokomial .Kurangi dampak hospitalisasi .

8.N:80x/m .2 .Mengatur posisi klien senyaman mungkin .S:37.Menganjurkan orangtua klien untuk ikut serta dalam perawatan klien .Mengobserpasi nyeri .15 1 . TTV .TD:.10 11.Menciptakan lingkungan senyaman mungkin .Klien menyatakan merasa sakit pada dairah hidung saja . Tindakan Keperawatan Hari/ tggl No dx Tindakan Respon Hasil 6/5/10 11.Mengobservasi Suasana hati klien .Mengobs.

Klien di posisikan dengan tidur terlentang (supinasi) .Ibu klien tampak selalu mendampingi klien .40 11. 11.Memasang sampiran .50 11.RR:21x/m .Klien tampak tenang dan lebih kooperatif..Membatasi jumlah pengunjung . klien tampak berhenti menangis.55 .30 11.25 11.

12.30 13.Mengobservasi Keadaan luka .05 12.30 2 .Menyiapkan alat untuk merawat luka .

5 dengan kedalaman luka 0.Merawat luka .Berkolaborasi dalam pemberian obat dan X-ray .5 cm dan denan panjang 0.Hanscond .Betadine .5 cm.Plaster .Gunting plaster .Bengkok .9 % .Menutup luka hathing . .Membuang alat habis pakai/disposable pada tempatnya .Meminimalis dampak hospitalisasi .Has steril .Luka di rawat dengan teknik anti septik/steril .Di indikasikan untuk melakukan hathing .Memasukkan kembali alat-alat yang telah digunakan ke dalam apen. luka tampak bersih dan keluar perdaraha aktif pada dairah luka sobek .Membersihkan alat-alat yang telah digunakan/ yang telah terkontaminasi ..Luka pada nasal dengan luas luka 1x1x0.Melakukakan hathing .Menyiapkan alat hathing .Memastikan alat yang digunakan dalam keadaan seteril .Berkolaborasi dalam melakukan hathing dan obat-obatan .Cairan NaCl 0.

Obat yang diberikan: .Amoxilin sirup . Alat yang telah digunakan dibersihkan dan diseterilkan kembali .Setiap akan melakukan tindakan petugas terlebih dahulu memberi penjelasan pada klien dan keluarga klien.. .Parasetamol sirup .Hathing set .Luka hathing di olesi dengan betadin dan di tutup dengan has steril.Alat-alat disposible dibuang pada tempatnya. .Alat diambil dari dalam open/klep .Hasil X-ray: Fraktur oss nasal .Hathing 1 kali dengan teknik hathing terputus dengan arah horizontal dan .

Klien tampak berhenti menangis .Sampiran di pasang .Alat –alat yang di pakai masih dalam keadaan steril.Pengunjung dibatesi (maximal 2 orang ) .Parasetamol dan Amoxilin sirup .40 S: O: .Klien tampak lebih tenang dan lebih kooperatif . Evaluasi Hari /Tggl No Dx Evaluasi 06/05 /2010 11. .2 .S:37.Ibu klien selalu mendampingi klien .Hasil X-ray : fraktur oss nasal. .Luka di bersihkan .N:80x/mnt .Tampak luka sobek pada nasal .Klien di posisikan dengan posisi telentang (supinasi) .RR:21x/mnt 13.Luka di hathing 1x dengan teknik hathing terputus dan dengan arah horizontal dan di tutup dengan has steril.Alat.Obat yang di berikan : .klien menyatakan merasa nyeri pada dairah hidung saja O: .TTV ..9.20 S: . .alat yang terkontaminasi di bersihkan (dicuci) dan di sterilkan kembali.TD:. .

Dalam teori untuk masing-masing masalah keperawatan terdiri dari 6 diagnosa keperawatan yaitu : 1. 4. Inkontinuitas jaringan/kerusakan jaringan berhubungan dengan deselerasi.BAB IV PEMBAHASAN ASUAHN KEPERAWATAN PADA Tn. 3. 3. mengatur dan memilih data yang dikumpulkan. “M” DENGAN DIAGNOSA MEDIS OPEN FRAKTUR DIGITI MANUS DI RUANG IRD RSUP NTB TANGGAL 6 MEI 2010 1. Kurang pengetahuan tantang kondisi. luka/kerusakan kulit. PENGKAJIAN Merupakan tehnik pegumplan data dan merupakan proses dinamis yang meliput tiga aktivitas dasar yaitu mengumpulkan data. 2. kerusakan sirkulasi dan penurunan sensasi. prosedur invasif dan jalur penusukkan. Sedangkan diagnosa yang ditemukan dalam kasus ada dua diagnosa yaitu : a. 2. b. Pada gambaran kasus perencanaan disusun sesuai dengan langkah-langkah yang terdapat pada landasan teori. criteria. Kerusakan integritas jaringan berhubungan dengan tekanan. . standar dan intervensi. 1998). tanda gejala. insisi pembedahan. dan etiologinya. dan mendokumentasikan data dalam format yang dapat dibuka kembali. Risiko infeksi berhubungan dengan stasis cairan tubuh. Jadi. salah interpretasi informasi. dalam perencanaan. 1998). Ganngguan rasa nyaman nyeri b/d terputusnya kontinuitas jaringan. prognosis dan kebutuhan pengobatan berhubungan dengan keterbatasan kognitif. perubahan status metabolik. respons inflamasi tertekan. Nyeri berhubungan dengan terputusnya kontinuitas jaringan tulang. DIAGNOSA KEPERAWATAN Diagnosa keperawatan meruapakan pernyataan tentang faktor-faktor yang memperhatikan respon atau tanggapan yang tidak sehat dan menghalangi perubahan yang diharapkan (Nasrul Efendi. antara landasan teori dengan gambaran kasus kami tidak jauh beda karena rencan yang ada dalam teori kami gunakan dalam perencanaan kasus. PERENCANAAN Perencanaan merupakan kumpulan tindakan yang ditentukan oleh perawat untuk dilaksanakan guna memecahkan masalah kesehatan dan masalah keperawatan yang diidentifikasi (Nasrul Efendi. Pembahasan : Pada pengkajian ada kesamaan antara teori dengan pengkajian kasus seperti keluhan. tujuan. kurang terpajan/mengingat. yaitu diagnosa keperawatan.

4. IMPLEMENTASI Pelaksanaan merupakan suatu tindakan keperawatan yang bertujuan untuk mengatasi atau mencegah masalah kesehatan yang dihadapi keluarga sesuai dengan rencana asuhan keperawatan yang telah dibuat (Nasul Effendi. 1998) pada asuhan keperawatan Tn “M” langsung dilakukan evaluasi pada hari itu juga sesuai dengan masalah yang ada yaitu gangguan nyaman nyeri dan gangguan integritas jaringan. Sedangkan pada gambaran kasus. dan semua masalahnya teratasi sebagian. 5. 1998). EVALUASAI Evaluasi merupakan tahap yang menentukan apakah tujuan tercapai atau tidak (Nasrul effendi. tahap pelaksanaan sesuai dengan landasan teori dimana penulis menerapkan rencana asuhan keperawatan yang telah disusun pada tahap perencanaan. BAB V .

Dari hasil hasil idetifikasiyang telah dilakukan ditemukan ada dua diagosa dan salah satu diagnosa yaitu gangguan inegritas jaringan yang membutuhkan penanganan yang akurat karena diagnosa ini sangat beresiko terjadinya infeksi apabila tidak ditangani dengan akurat. kami juga berharap kepada pembimbing untuk terus mendukung dan membantu dalam memberikan bimbingan kepada para mahasiswa yang melaksanakan praktek klinik untuk dapat menerapkan teori yang telah didapatkan dari institusi masing-masing dalam memberikan asuhan keperawatan. . Asuhan keperawatan yang diberikan dilaksanakan berdasarkan rencana asuhan yang telah dibuat sesuai dengan tingkat kebutuhan klien agar asuhan yang diberikan dapat mengatasi masalah yang diaami klien.PENUTUP A. Evaluasi asuhan keperawatan yang dilakukan kepada klien sesuai dengan konsep teori yang ada untuk mengetahui sejauh mana perkembangan tindakan yang telah dilakukan pada klien dengan masalah fraktur. rencana. dan evaluasi. tindakan. berdasarkan data dari hasil pengkajian telah dapat diintrprestasikan dan ditetapkan diagnosa. SARAN Kami mengharapkan kepada RSUP NTB pada umumnya dan ruang IRD pada khususnya untuk terus meningkatkan mutu pelayanan kesehatan terutama dalam pelayanan klien yang membutuhkan pelayanan dengan segera atau gawat darurat sehingga dapat mencegah hal-hal yang tidak kita inginkan. KESIMPULAN Pengkajian pada klien dengan open fraktur dilakukan untuk mendapatkan informasi dan datan yang akurat. B. oleh karena itu perlu diberikan informasi kepada klien dan keluarganya tentang masalah yang dihadapi klien.

Sign up to vote on this title
UsefulNot useful