IInfo Utama nfo Utama

Sejak akhir 2002 lalu industri kerajinan perak Indonesia, khususnya di Gianyar, mengalami stagnasi pasca keluarnya kebijakan pengenaan PPN 10% pada bahan baku perak. Perjuangan untuk penghapusan terus dilakukan tapi sayang hingga kini belum ada jalan keluar.
2 Gema Industri Kecil. Edisi XVIII - Juni 2007


Info Utama

Berbagai souvenir dari perak Gianyar: Ekspor sampai ke 40 negara


ndustrikerajinanperakdiKabupaten Gianyar Bali merupakan urat nadi masyarakatdaerahsentraproduk seni dan kerajinan di pulau dewata tersebut.darisekitar422.186jumlah penduduknya,menurutSusenas2004, sektorindustrikecildanperakmenyerap sebanyak60.972orangatau79,44% daritotaltenagakerjasektorindustridi Kabupaten Gianyar. SentrakerajinanperakdiGianyarini

terdapatdidesaCeluk,Batubulan,dan SingapadudiKecamatanSukawati.Tapi yangterbesarterdapatdidesaCeluk.di desayangpunyaluaswilayah247,56 hektardanberpenduduk2.749jiwaitu 90%penduduknyabekerjadibidang kerajinanperak.disanaterdapatsekitar 700-anunitusahadibidangindustri kerajinanperakyangmayoritasberskala ekspor. MasyarakatCeluksudahsangatterampildanterlatihdidalammembuat danmendesainperak,baikkalung,cincin, gelang,liontin,souvenirdansebagainya. Merekapunyatelentaseniyangdiwarisi darinenekmoyang.Cirikhasdesainperak Celukadalahpaduan‘jawan’Jawanadalah . butiran-butirankecilbulatyangmenempel di setiap jenis produk perak. desaindanukirankerajinanperak yangbermotifkantradisionalBaliinilah yangmenjadikeunggulanperajinperak desaCeluk.Sehinggakinimasihmampu bersaingdengandaerah-daerahlain. SelainCeluktidakadadaerahlainyang dapatmembuatjawan,termasukJogja. CirilainperakCelukGianyaradalah warnanyayangagakkehitam-hitaman atautidakputihbersihsepertiperak produksiKotaGedeJogja.Soalini,menurut nyomanRupadane,salahseorangperajin, bukandikarenakanbahanbaku-nyayang jelektapimemangsengajadibuatagak kehitam-hitaman. Soal kapan perak Celuk mulai berkembanghinggahariinitidakada catatanyangmampumenjelaskanhal itu.CumaperakCelukmulaimengalami “booming”kira-kiratahun1970-an,yaitu saatme-rekamengenalpasarasing/ ekspor. Terdapatsekitar40negaratujuan ekspornya, di antaranya Thailand, AmerikaSerikat,Kanada,inggris,irlandia, Perancis,Jerman,Spanyol,Austria,Belgia, Ceko,denmark,Hongaria,italia,Turki,

danJepang.Omzetnyapunlumayanbesar, berkisar antara 100 juta hingga 400 jutaanperbulanuntuksetiapperajin. Kekhasan dan keunikan perak Gianyarinitidakhanyadisukaiparaturis mancanegara,tapijugaolehparapetinggi negeriini.Sebutsaja,mantanPresiden Megawatisangatmenyukaiperhiasan perak produksi Gianyar. Munculnya permasalahan Tapisayang,sejak3-4tahunterakhir industrikerajinanperakCelukGianyar mengalamigonjang-ganjing,sehingga mempengaruhivolumeproduksinya.Selain karenafaktorbomBali1dan2yangsangat mempengaruhiturunnyaangkapenjualan lantaranberkurangnyakunjunganturis mancanegarakeBali,faktoryangtidak kalahberpengaruhnyaadalahpengenaan Pajak Pertambahan nilai (PPn) 10% padabahanbakuperakyangdipasokdari PT Aneka Tambang (Antam). Ketika Rini Soewandi menjabat Menperindag,paraperajinperakCeluk dimintauntukmembentukkoperasi, sehinggamerekamembentukkoperasi yangbernamaKoperasiPerajinPerak Celuk (KPPC). KPPC ini kemudian dijalinkankerjasamadenganPTAneka

Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

Tambanguntukmemasokbahanbaku perak.Sehinggasetiapminggukoperasi inimendapatpasokansebanyak0,5ton bahan baku perak dari Antam. Meskihargadiluarkoperasikerap tidakstabil,tapidikoperasiharganya tetapstabil,sehinggaKPPCberfungsi sebagai penyeimbang. Koperasi ini berjalanbagusselama2tahun.Waktu itu harga bahan baku perak dipatok Rp2100/gram,inisesuaidenganharga yang berlaku di pasar internasional. Perankoperasimulaiturunketika pemerintahmengenakanPPnsebesar 10%sejakakhir2002.Akibatkebijakan inihargaperakbegitusampaikekoperasi sudahtinggi.Anehnya,kebijakaninitidak berlakumerata,karenadiluarkoperasi

masihterdapatperakyangkodenyasama (logammulia)atausejenistapiharganya masih lebih murah. Menurut Ketua Koperasi Perajin PerakCeluk,inyomanRupadane,faktor pengenaanPPn10%sangatmenampar industrikerajinanperakCeluk.Gara-gara itukapasitasproduksidanhargajual “emasputih” mengalamipersoalanyang ini

sangatserius.Bahkanterdapatbeberapa unitusahayangtidakmampuberproduksi lagikarenasulitnyamencaripasarlantaran harga yang tidak kompetitif lagi. Memanghinggakinimasihbanyak unitusahayangtetapberproduksikarena merekamasihbisamendapatkanbahan bakudariblackmarketyangterdapat didenpasar.Cumamasalahnya,meski hargadariblackmarketlebihmurah,tapi kualitasnyatidaksebagusyangdipasok dariBuMnspesialislogamtersebut. niMadeWartari,pemilikartshop AristyaSilver,yangmenjadilangganan mantanPresidenMegawati,jugamengakui hal itu. Pengenaan PPn 10% sangat mempengaruhiusahanya.untungnya, usahanyatidakhanyadifokuskanpada perhiasan perak tapi juga emas dan permata.denganpolatersebutusahanya tetapbertahan,karenadisaatproduk perhiasanperakmengalamikelesuan terbantuolehlonjakanpenjualanemas dan permata. Rupadane,jugapunyasiasatlain. untukmengurangibiayaproduksidia menyiasatinyadenganmengurangikadar perakpadasetiapjenisproduknyaserta memadukannyadenganornamenlain, sepertikerang,agartetapterlihatcantik danmenarik.dengancarainiharganya dipastikanbisaterjangkauolehcalon pembeli. Selainitu,RupadanedanniMade


Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

Wartarijugasemakinrajinmenjajakan produknyakebeberapanegaradengan mengikutisetiapeventpameranyang digelardisana.Praktisnyaprodukperak inidibawa,karenacukuphanyadengan satukoper,menjadikanmerekabisa melalangbuanakeberbagainegara. Tidak hanya itu, mereka juga melengkapitrikmarketingnyadengan membuatwebsitekhususuntukdisplay anekaprodukperaknyaplusemail.dari situcalonpembeli,terutamabuyerasing, bisadenganmudahmengetahuijenis produk,desain,danhargadarisetiap produk perak mereka. Calonpembeliyangberminatdan tertarikdenganproduk-produkmereka cukupkirimemailpemesananbarang plustransferpembayarankerekening perusahaan,makabarangpunsegera didatangkanketempattujuanpembeli. Perjuangan tak henti untukmenyelamatkanindustrikerajinan perakdiGianyar,dinasPerindustrian, PerdagangandanKoperasiKabupaten tersebutterusmemperjuangkanpenghapusanataupenurunanPPn10%.“Kita akanterusberjuanghingga0%,”tandas drs.GedeWidarmaSuhartaMM,Kadis Perindagkop Gianyar. Bahkan,menurutnya,perjuangan yangdilakukansudahsampaikePresiden Megawatiwaktuitu.Tapisayang,lagi-lagi mentokditingkatpembahasanTimTarif dandPR.“SaatpertemuanseluruhKepala dinasdenganMenteriPerindustrianBapak Fahmiidrisbeberapawaktulalupersoalan inijugasudahkamilaporkan,”tambahnya. SakingseriusnyadinasPerindagkop untukmencarijalankeluardarikebuntuan ini,pengurusAsosiasiPerakGianyar pernahdiajakkelilingKalimantanTengah, untukmelihatkemungkinanterdapat perakrakyatdisanayangkemudianbisa dibeli dan dijadikan bahan baku.

Belumberhasilnyaperjuanganmereka hinggakini,disinyalirolehGedeWidarma, karenagaungperjuanganpelakuindustri peraktidakterlalukuat.Maklumsentra industri kerajinan perak diTanah Air yangbesarhanyaGianyardanJogja. Bandingkandenganindustrikerajinan emasyanghampirmeratadiseluruh indonesia.“Anehmemang,emastidak kenaPPn,tapiperakjustrukena.Padahal perakitukanhasilsampingandariemas,” keluh Gede Widarma. Melihatkenyataanini,direktorat industriKerajinan,direktoratJenderal industriKecildanMenengahdepartemen Perindustrian sendiri tidak tinggal diam.Merekajugaselalumembantu perjuangankalanganindustrikerajinan perakuntukmenghapuskanPPn10% tersebut. Hanyaitu,lagi-lagimentokdiditjen Pajak. “nasib perak memang tidak sebagus nasib emas,” kata Tri Reni Budiharti,direkturindustrikerajinan departemenPerindustrian.Sebelumini perakpernahterkenaPPntapikemudian bebas, lalu terkena lagi hingga kini. EmasbisatidakterkenaPPn,menurut Reni,karenabaranginimasukkategori hedgingtoo/atauinstrumeninvestasi yangsewaktu-waktubisadijualkembali. Sementaraperaktidakmasukkategori hedgingtoolkarenatidakdapatdijuallagi. Terlepasdariitusemua,yangjelas perjuanganuntukmembantukalangan industrikerajinanperakagartetapsurvive danmenjadikebanggaannegerisebagai warisanbudayabangsayangbercitarasa tinggi,plussebagaisumberpendapatan daerahdannasionalharustetapkita perjuangkan.Adakahyangsanggupjadi G “dewa penyelamat”? dhorifi Zumar
Cincin dan anting perak: Desainnya menarik, tidak kalah dengan emas 5 Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

Drs. Gede Widarma Suharta MM
(Kepala dinas Perindagkop Gianyar):

Perajin perak di Gianyar, cukup terlatih dalam hal desain dan membuat produk. Tapi mereka mendapat kendala dalam masalah bahan baku dengan diberlakukannya PPN 10% untuk bahan baku perak.



erajinperakdiGianyar,terutama didalamketerampilandesaindan membuatperakmerekasudah sangatterlatih.Merekapunyatelentaseni yangdiwarisidarinenekmoyang.Cirikhas desainperakCelukpakai‘jawan’.Jawan adalahbutiran-butirankecilbulatyang menempeldisisisetiapprodukperhiasan. SelainCeluktidakadayangbisamembuat

jawan, termasuk Jogja. didesaCelukini90%penduduknya bekerjadibidangkerajinanperak.Soal kapanperakCelukmulaiberkembang hinggahariinitidakadacatatanyangbisa menjelaskanhalitu.Cumakalauperak Celukmengalami“booming”itukira-kira tahun1970-an,mulaimengenalpasar asing.

Kalaumasalahmodal,diCelukini tidakmenjadimasalahkrusial.Karena paraperajinrata-ratasudahpunyadana untukmembelibahanbakuperak.Cuma yangmenjadikendalaadalahbahan bakuperak.initerjadisejakpemerintah pusat memberlakukan PPn (Pajak Pertambahahnnilai)sebesar10%sejak tahun 2002/2003. Bahan baku perak di lapangan sebenarnya ada dalam jumlah yang banyak. Hanya saja harganya sering tidakterjangkauolehperajinkarena sering“dimainkan”Ketikaperajinbanyak . mendapatordermakaperakhilangdari pasaran,sehinggamerekamengalami kesulitan mendapatkannya. PerjuanganuntukpenghapusanPPn perakyangdilakukanpengurusAsosiasi PerakGianyar(APG)danKoperasiPerajian PerakGianyar(KPPG)sebenarnyasudah sampaikePresidenMegawatiwaktuitu. Tapilagi-lagipembahasannyamentokdi Tim Tariff dan dPR. Saatpertemuankepala-kepaladinas PerindagseluruhindonesiadenganBapak MenteriPerindustrian,Fahmiidrisjuga sudahpernahkamisampaikansoalPPn 10%peraktersebut.Tapibeliausendiri tampaknyaagakkesulitan,karenamesti


Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

berkoordinasidenganinstansiterkait, sepertidepkeu,ditjenPajakmaupun dPR. Ternyatagaungpebisnisperakkalah kuatdibandingpebisnisemaskarena emas toh tidak terkena PPn 10%. Mungkinkarenasentraperakyangbesar hanyaduadaerah,yaituGianyardan Jogja,sehinggakurangkuat,sementara emas hampir seluruh indonesia. SelainsoalPPn,masalahlainyang adadiindustrikerajinanperakGianyar adalahsoalsistempengerjaan.Ketika perajinmenerimaorderperakkhasBali dalamjumlahbesardalamwaktuyang sempit,makamerekarata-ratamenyerah karenakesulitan.Misalnya,mendapatkan order100piecesdalamwaktuseminggu, makamerekatidakbisamengerjakan, karenamerekatidakbisamembuatdalam bentuk massal. inikarenaperajinperakCelukbelum terlatihuntukmembuatmassproduct. Sehinggasekarangkitalatihuntukbisa menggunakanmesincastingagarmereka bisamemproduksidengancepatdalam jumlah besar. Saat ini pemasaran perak Celuk kalauhanyamengandalkanartshop, ataumenunggutamudatangsudahtidak mungkinlagikarenadalamseharibelum tentupengunjungdatang.Terutama setelah tragedi Bom Bali 1 dan 2. Sekarangupayayangdilakukanpara perajinadalahberjualankeluarnegeri. Merekapasarkanlewatwebsiteatau onlinetrading.danlewatcarainisangat membentuparaperajin.Berkatterobosan ini mereka bisa survive. nilai ekspor perak Gianyar kalau dinilai masih lebih rendah dari kayu. nilainyakira-kira40%daritotalekspor produkkerajinanGianyar.Tapikalau

perbandinganantaranilaipenjualanuntuk pasarlokal/nasionaldanekspor,maka hampir85%perakGianyaruntukpasar ekspor.YangterbanyakadalahThailand, Jepang, Amerika dan Eropa. PerandinasuntukmembantupermasalahanperajinperakGianyaradalah denganmencobamembangkitkanstakeholder,membangkitkandanmemfasilitasipembentukanasosiasi,ataumembangkitkankoperasiperak.Jadilebih banyak ke fungsi fasilitasi. dalamprosespemberdayaanmereka, kita bagi menjadi 3 kelompok, yaitu kelompokbesar,menengahdankecil. Polapemberdayaanmasing-masing berbeda.Kalauyangkecilkitalatihdari

merekabelumtahuperaksampai tahudansampaibisamembuat.ini motivatornya banyak dari kita. Kalau kelompok menengah karenamerekasudahbisamembuat, maka yang kita lakukan adalah menyambungkandenganasosiasi. Jugamerekakitaberisubsidiuntuk pameran.Kalauyangkecilkitaberikan subsidipameransecarapenuh,tapi kalauyangmenengahsekadardiberi subsidi. Sementarayangbesartingkatan pembinaannya sudah ke level deregulasi. Mereka perlu apa, perizinanatausertificateoforigin (SKA) dalam satu hari, akan kita bantu.Bahkanjikamerekakesulitan kapalbisakitabantu.untukeksportir kitabuatkanforumeksportirGianyar. initempatmerekaberkumpuldan berkomunikasi.JadidiGianyarini setiapkelompokperainkitabuatkan asosiasisebagaiwadahkomunikasi G antar mereka. dhorifi Zumar

Counter barang kerajinan perak: Harga sering tidak stabil


Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

Industri perak di Kota Gede, yang sudah eksis sejak zaman Kerajaan Mataram, kini nasibnya memprihatinkan.Tragedi bom Bali serta bencana gempa di Yogya dan Jateng ditambah pajak 10% bagi perajin perak, melengkapi penderitaan perajin perak khususnya di Kota Gede,Yogya.
ogyakartaadalahsalahsatukota wisatadiindonesiayangbanyak dikunjungiwisman(wisatawan mancanegara). daya tarik dari kota “Gudeg”iniselainberbagaipeninggalan bersejarahnyasepertiCandiBorobudur, Prambanan,dancandiyanglainnya,juga karenapantainyayangindah,parangtritis serta tempat wisata lainnya. di kota yangjugaterkenaldengansebutankota




pelajarinijugaterdapatsentraperak, yangkeberadaannyasudahadasejak kerajaan Mataram. Hasilkerajinanperakyangberpusat di“KotaGede”ini,diantaranyaberupa perhiasan,peralatanrumahtangga,dan hiasaninteriorcukupdiminatiparaturis mancanegara.disampingdisainnyacukup antik,harganyajugatergolongmurah. Pasang surut Produk-produkkerajinanperakdi Jogjadapatditemukandisepanjangjalan Malioboro.namunjikaAndainginlebih puaslagimemilihdanmelihatproses pembuatannya,datangkeKotaGede. KotaGedesudahterkenalsejaklama sebagaipusatkerajinanlogam,khususnya perak.Menurutsejarahdaerahinipernah menjadipusatpemerintahanKerajaan MataramsebelumpindahkeKartasura. WalaupunkemudianMataramterpecah

menjadiduayaituKasunananSurakarta danKasultananYogyakarta,namun beberapaperajinmemilihmenetapdi tempatini.Lalupadamasaperangdunia keii,aktivitasKotaGedesebagaipusat kerajinan perak sempat terhenti. Baru setelah merdeka, usaha kerajinanperakdimulaikembali.namun dengankembalinyaBelandamenjajah indonesiaatauyangdikenalsebagaimasa “RevolusiFisik”antara1947-1949usaha kerajinanperakdiKotaGedekembali terhenti.Saatitusebagianbesarrakyat indonesiaberkonsentrasimenghadapi agresi-agresiyangdilakukanolehpasukan militerBelanda.Setelahkondisikeamanan membaik,sekitar1949perajinperakKota Gedemulaimerintiskembaliusahanya. Kemudian pada 1952 pemerintah indonesiamulaimemberlakukanizin usaha dan mendorong tumbuhnya kegiatan perekonomian rakyat. Digemari wisman Periode 1950-1960 setelah kemerdekaanbanyaktenagaasingyang membantupembangunandiindonesia. diantaramerekaadayangberkunjungke KotaGede,dantertarikdenganproduk kerajinanperaknya.Mulaisaatitulahhasil kerajinanperakKotaGededikenaldan diminatikonsumenluarnegeri.“Waktuitu


Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

banyakorangasingyangberkunjungke KotaGede,merekatertarikdenganproduk seperti teaset atau coffeeset. Boleh dibilangkerajinanperakkotaGedesaatitu mengalamikemajuanyangsangatpesat. Bapaksayasudahmemilikikaryawan28 orang,”ceritaMoeljopratono,seorang perajinyangmewarisiusahakerajinan perak dari bapaknya. KotaGedemakinberkibar,setelah pemerintahmenetapkankotainisebagai tujuanwisata.“Karenaindustriperakerat kaitannyadenganpariwisata,makanama KotaGedejugaikutterangkat,”tambah Moeljopratono.MeskidiBalidanLombok jugaterkenaldenganindustriperaknya, namunKotaGede,Yogyatetapramai dikunjungiwisatawanasingdandomestik yangtertarikdengankerajinanperak. Butuh perhatian pemerintah Sekaranginikondisiperindustrian perakyangadadiKotaGedesedang mengalamikelesuan.“Kalaudulukita bisamempekerjakanpuluhanbahkan

ada yang sampai ratusan karyawan, sekarangbanyakkaryawanyangterpaksa dirumahkan,” ungkapAlonopemilikOnycs Silver.ditambahlagiperistiwabomBali (2002)makinmembuatwismantakut berkunjungkeindonesia,danhalini berdampakterhadapindustriperakdi Kota Gede. Bencanagempabumiyangbarusaja melandaYogyakartadanJawaTengah, makinmenambahpenderitaanperajin perak.“Tidaksedikitperajinperakyang gulungtikar,sebabkondisinyamemang tidakmenguntungkan” tambahAlonolagi. Memangpernahadabantuandari pemerintahkepadaparaperajinperak. namun sayang bantuan itu kurang bermanfaat. Karena bantuan yang diberikan tidak sesuai dengan yang dibutuhkan. “Hal itu terjadi karena kurangnyakomunikasiantarapihak pengusaha(perajin)denganpemerintah mengenaiapasajayangdibutuhkanoleh industriperakKitadiberikanmesinuntuk produksi,namunsayangmesin-mesin

Perajin perak (kiri bawah), patung membajak sawah ( kanan atas), patung kuda dan replika vespa: Dibutuhkan jaringan pemasaran

tersebutkualitasnyasangatrendah.Sehingga tidakbanyakmembantu.Padahalyangkami butuhkansaatiniadalahjaringanpemasaran danpromositentangprodukperakKotaGede” ucapPriyo,pemilikSalimSilver.dalamkondisi sulitsepertiinihanyapengusahayangmemiliki jaringanbuyeryangbisabertahan,tambahnya. Jadi,lanjutPriyo,kalaupunsaatinimasih adaperajinyangproduksitidaklainhanyauntuk mempertahankandirisaja.Apalagidengan diberlakukannyapajaksebesar10%terhadap perajinperak,jelasmakinmemberatkan.“Kami merasakeberatandenganpajakitu.Apalagi pajakituhanyaberlakupadakami,jikaada pembelibahanbakuperakdariluarnegeri merekatidakdibebankanpajak.Jadidalam persaingandenganprodusenperakdarinegara asingkitasudahkalahduluan,”ungkapSutojo, KetuaiKoperasiProduksiPengusahaPerak G irwansyah Yogyakarta.
9 Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

iantaraperajinperakdiKotaGede, yangmasihtetapeksisadalahSalim Silver.iamendapatkanpelanggan tetapuntukpasarinternasional.Hampir 70%customer-nyaberasaldariAmerika Serikat,danakandikembangkankepasar Eropa.“untukpasardomestiksayatidak terlalukhawatir,karenapasarnyatetap ada,”ujar Priyo pemilik Salim Silver. Teknik asli Kota Gede MenurutPriyo,perbedaanproduk

Priyo meneruskan usaha perak warisan orang tua, dengan teknik pengolahan perak ala Kota Gede.


SalimSilverdenganyanglainterletak padadesaindanteknikpembuatannya. “Kamiterusmengeluarkandesainterbaru, sepertireplikabecakatauandong,”tutur Priyo.Sedangteknikyangdigunakan adalahteknikusapanyangsudahjarang digunakan.Kamimenawarkanmelalui katalogdesainyangtelahdisiapkan.Kami jugamenerimamotifkhususpesanan pelanggan dan menjamin hak cipta pelanggan tersebut, tambahnya.

Hakciptaatasdesainmemangsering menjadipermasalahandikalanganindustri perakkhususnyadiKotaGede.“Kadang adaorangyangdatangmelihat-lihatlalu menawar.Tapidenganberbagaialasan lantasmembatalkantransakasi.Ternyata oranginimemesanmotifyangdilihatpada perajinlain.Kamitentuakanmenerima dengan senang hati,” ujar Priyo. Kendalatentangmiskomunikasidengan pemerintahsoalbantuanjugadialamioleh Priyo.“Kitadiberikanmesinuntuk produksi,namunsayangmesinmesintersebutkualitasnyasangat rendahsehinggatidakbegitubanyak membantu. Padahal yang kami butuhkansaatiniadalahjaringan pemasarandanpromositentang produkperakKotaGede”ucapPriyo. SehinggatambahPriyo,dalam kondisisulitsepertisekaranghanya perajinyangmemilikijaringanbuyer yangbisabertahan.SelainituPriyo jugamerasabahwapemberlakuanpajak sebesar10%terhadapperajinperaksangat memberatkan.“Kalaukondisiinidibiarkan terusmakasayayakinnamabesarKotaGede sebagaiprodusenperakakantenggelam,” G irwansyah imbuh Priyo yakin.
Produk Salim Silver (kiri) dan Priyo (insert) pemilik Salim Silver: Tetap eksis pasarnya luar negeri


Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

Untuk menyiasati sepinya order, Onyc’s Silver membuat inovasi baru memadukan dengan ukiran kayu.
nyc’sSilverdiantara perajin perak yang terkena imbas bom Bali dan gempabumi.“industri perak Kota Gede pasti bergantungpadaiklim pariwisatadiindonesia. Bom Bali dan gempa bumiyangmelandaYogya berpengaruhcukupbesar pada wisatawan yang berkunjungkhususnyake industriperakKotaGede,Yogya,”ucap Alono pemilik Onyc’s Silver. Tetap bertahan Sadarbahwakondisiyangkurang kondusiftidakbisahanyadengandiratapi, Alonomelakukanberbagaiinovasidalam produksinya.“untuktetapbisabertahan sayamencobamemproduksikerajinan non perak” tuturnya. Jikasebelumtragedibomdangempa, Onyc’sSilverdalamsatubulanmampu menghabiskanhingga30-45kgperak mentah,tapikinihanyamenghabiskan18 kgsaja.“Selainkarenasepinyaorder,juga karenafaktorpajak10%yangditetapkan olehpemerintah.Keinginankamipara pelakuindustriperakkalaubisapajakpajakyangmemberatkandihapuskan. Karena jika tidak, berarti kami harus menaikkanhargamakabisasajapara

buyerberalihkeprodusen darinegaralain,”ujarnya. untukmengantisipasi kondisisepi,Alonomenerapkanstrategidengan meningkatkankualitasproduk.SelainituOnyc’sSilver jugamenciptakandesaindesainbarusertamengikuti trenkonsumen.“darisisi lainjugaharusadausaha bersama antar perajin sepertidenganmengadakan pameranbersama,pemasaranbersama, atausharingorder.denganbegitusecara bersama-samaparaperajinjugabisasaling menguatkan,” ujar Alono lagi. Saatawalbukapada1980,Onyc’s Silvermemperkerjakansekitar60karyawan. “dalamkondisinormal,kitamemasarkan hinggaJakarta,BalidanAmerikaSerikat. namun dengan kondisi lesu begini, pemasaranmakinsulit.Akhirnyabanyak pekerjayangberalihprofesimenjadikuli bangunan,” papar Alono. Meskikinipasarperaksedanglesu, namunAlonotetapsurvivedanbertekad tetapmenjalankanusahaperaksebagai bisnisutamanya.“Sayasedangmencoba memadukan perak dengan ukiran kayu.Yainibagiandariinovasiuntuk menyiasatikeadaan,”ujarnyasambil memegangukirankayuberbentukcicak besar.G irwansyah
11 Gema Industri Kecil. Edisi XVIII - Juni 2007


Alono pemilik Onyc’s Silver (kiri) dan produk perak Onyc’s: Pasar makin sepi

Info Utama

emasuki workshop perak MdSilver,milikMoeljopranototampaksekelompoklelakituatengah asyikmengukirperak,sambilngobrol berbahasa jawa. Suasana ruangan workshopkentaldengannuansabudaya Jawa.disalahsatudindingterpampang gambarSriSultanHamengkubuwono iX,danbeberapagambarlelakidengan pakaianbangsawanJawa.disudutlain terpampangsertifikatkeluaranpemerintah nederlandindieyangmenerangkan penerimanyaadalahorangyangahli. MdSilversendiriberdiripada1917. “SaatituEyangLurahWirjosudarmo membukausahayangbergerakdibidang kerajinanlogamsepertikuningandan tembaga,”paparMoeljopranoto.Lantas pada1936sayamembukausahakerajinan emas,namunkemudiandialihkanpada

MD Silver milik Moeljopranoto, pernah mencapai kejayaan hingga dianugerahi Piala Upakarti dari Presiden Suharto. Karyanya menjadi cinderamata tamu-tamu negara. Tapi kini butuh perhatian pemerintah.
kerajinan perak. Awalnya,MdSilverhanyauntukmenutupikebutuhanhidupsehari-hari.Seiring perkembangandanbanyakorangBelanda yang tertarik akhirnya perusahaan dikelolalebihbaik.“namunkarenasituasi indonesia,khususnyaYogyasaatitu selaluberubah-ubahmakaperusahaan ini juga mengalami pasang surut. Jikakondisikeamananbaikpenjualan meningkatbegitupulasebaliknya,”tutur Moeljopranoto. Menembus pasar ekspor dengandigalakannyaindustripariwisataolehpemerintahpada1978,Md Silvermengalamiperkembanganyang cukuppesat.“Kamisanggupmelayani pemesananmulaidarikerajinanuntuk souvenirtamunegarasampaiekspor kemancanegara,terutamadariEropa. umumnyapesananmerekaberbentuk peralatanmakandanminum,”ungkap Moeljopratono. namun kini kondisinya cukup memprihatinkan.“Banyakfaktoryang membuatindustriperaksecaraumum menjadi lesu, termasuk Md Silver. Selainsektorpariwisatayangagaksepi menyusulperistiwabomBalidangempa bumiYogya,kondisidiperparahdengan diberlakukannyaPPn10%untukindustri peraklokalsaatmembeliperakmentah. Anehnyapajakinitidakdikenakanpada importir,” ucap Moeljopranoto. namun,Moeljopranototetapoptimis bahwaindustriperakKotaGedemasih memilikipeluanguntukmaju.Karena MdSilversudahcukupdikenaldengan produk-produkyangkhas.“Sayayakin kondisilesutidakakan lama,apalagikalaudidukungkebijakanpemerintahyangberpihakpada perajinperak,”tambah
G Moeljopranoto. irwansyah


Moelyopranoto dan karya seninya: Masih optimis kerajinan perak Yogya akan berjaya lagi


Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

ampirsatutahunkotaSidoarjo terkenamusibahbencanalumpur panasLapindo.dampaknyahampir semuasendi-sendiekonomiberhenti.Pada halsebelumnyanamaTanggulangindi Sidoarjocukupterkenalsebagaitempat belanjataskulitdenganmodelluarnegeri. Sebenarnyatidaksemuadaerahdi Tanggulangintenggelamkarenalumpur, hanyasebagiankecilsaja.namundengan luberanlumpuryangmenggenangi jalanan,banyakusahayangterganggu. Parapembelimaupunwisatawanenggan mampiruntukbelanja.Sehinggaomzet sentraiKMdikawasaniniturundrastis sampai80%.TotalkerugianiKMyang terendamlumpurmencapaiRp480miliar. Jadijikasebelumnyarata-rataomzet pengusahaRp3-5miliartinggalRp1miliar perbulan.Selainitubanyaktenagakerja yang terpaksa dirumahkan. Berdasarkan data dari dinas PerindustriandanPerdaganganSidoarjo, totalindustriiKMada2.449unitusaha, yangterendamlumpursebanyak209unit usaha.KhususiKMdiTanggulangin,dari 650unitusaha,terdapat46unitusaha yangterendamlumpur,yanglainnyatetap berproduksikarenalokasinyajauhdari luapan lumpur. SejauhiniupayayangtelahditempuhPemprovJatimadalahmerelokasi unit-unitusahayangterendamlumpurke


Dari 2.449 IKM yang terdata oleh Dinas Perindustrian dan Perdagangan, yang terendam lumpur sebanyak 209 unit usaha. Khusus IKM di Tanggulangin, dari 650 unit usaha, terdapat 46 unit yang terendam lumpur, yang lainnya tetap eksis.
sembilanwilayahyangtelahdisewauntuk programrelokasisementara.Relokasiini khususindustrikerupuk,rotanhingga pengolahan beton pratekan. Potensi IKM Sidoarjo SebagaiwujudperhatianPemerintah, departemenPerindustrianbekerjasama dengandinasPerindustriandanPerdaganganProvinsiJatimdanKabupaten SidoarjokhususnyaiKMTanggulangin menggelar“PamerandanPenjualan ProdukiKMTanggulanginSidoarjo”di Plasa Pameran industri deperin. Pamerandiikuti54perusahaan,dengan memamerkanberbagaiprodukseperti koper,tas,dompet,sepatu,jaket,aksesori serta aneka bordiran dan batik. Melaluipameranini,diharapkanpara perajindapatmempromosikandanmenunjukkankepadamasyarakatluasbahwa keberadaansentraiKMtasdankoper Tanggulangin masih produktif. MenteriPerindustrianFahmiidris,dalam sambutannya mengatakan bahwa Kabupaten Sidoarjomerupakandaerahproduktif,cukup banyakindustriyangoperasionaldiwilayah ini.namunakibatmusibahyangmerusak sejumlahinfrastruktur,terjadipenurunan produktivitasdisektoriKMdansejumlah industri besar. Sebelumbencanalumpur,Kabupaten Sidoarjo adalah sebagai salah satu penyanggaProvinsiJatim.Berbagaipotensi industrikecildanmenengah,perdagangan, sektorpariwisata,ikutmemberikankontribusiterhadappendapatandaerah.Bahkan KabupatenSidoarjomenjadisalahsatu daerahstrategisbagipengembangan G Faras perekonomian regional.

Pameran produk kulit produksi IKM: Salah satu komoditi unggulan dari Sidoarjo 13 Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

PoTenSI Dan ProDuK unGGulan DI BeBeraPa KecaMaTan SIDoarjo
No Kecamatan 1. Sidoardjo Industri Batik Tulis Keterangan Sentra ini banyak terdapat di Desa Sidoklumpuk, Jetis, dan Lemahputro. Batik tulis Sidoarjo yang terkenal adalah batik tulis Kenongo. Kerajinan anyaman bambu berada di desa Sumput Kecamatan Sidoarjo. Kerajinan pembuatan alat peraga ini berada di desa Sumput Kecamatan Sidoarjo. Tanggulangin berdiri sejak tahun 1976. Selain memproduksi tas dan koper juga sepatu, ikat pinggang, dompet, dll. Koperasi Intako mempunyai anggota tahun 2001 sebanyak 132 orang. Koperasi ini telah membuka showroom di desa Kedensari Tanggulangin. Pemasaran tas dan koper selain konsumedatang sendiri, juga dipasarkan di dalam negeri atau keluar negeri antara lain Jepang, Arab Saudi dan Eropa. Bordir Hasanah terletak di desa Kludan, Kecamatan Tanggulangin. Usaha bordir ini mempelopori kerajinan dan ketrampilan bordir di desa Ketegan, Kedung Pandan, Trompoasri, Kedung Rejo, Kludan, dan Boro. Bordir Hasanah terkenal karena kualitas tinggi dengan harga bersaing. Pemasaran produk bordir tersebut selain di dalam negeri juga diekspor. Terletak di desa Kesambi Kecamatan Porong. Jumlah unit usaha pada 2001 berjumlah 122 unit dengan tenaga kerja 689 orang. Jumlah produksi sebanyak 4.088.030 buah dengan nilai Rp,-. Nilai bahan baku maupun bahan penolong yang digunakan sebear Rp. 8.705.800.00,- Alat-alat dapur ini dipasar kan di pulau Jawa, Madura, Bali, NTT dan Luar Jawa. Terletak di desa Kedung Cangkring Kecamatan Jabon berkembang cukup pesat. Jumlah unit usaha pada tahun 2001 ada 110 unit usaha dengan tenaga kerja 420 orang. Jumlah produksi yang dihasilkan sbanyak 1.800.030 kg dengan nilai Rp. 2.700.000.000,Tempe yang dihsilkan dipasarkan di Sidoarjo, Surabaya, Pasuruan dan Mojokerto. Sentra Industri Bordir Terletak di Kecamatan Jabon berada di desa Kedung Pandan, Kedung Rejo dan Trompoasri. Produk dipasarkan di Bangil, Surabaya, Bali, Jawa Tengah, Jakarta. Terletak di Kecamatan Jabon berada di desa Pejarakan. Jumlah unit usaha pada tahun 2001 berjumlah 21 unit, dengan tenaga kerja 30 orang. Jumlah produksi yang dihasilkan

Anyaman Bambu Alat Peraga Anatomi Manusia 2. Tanggulangin Industri Kulit

Industri Bordir

Batik, bordir, dan tempe: Batik dan bordir pasarnya sampai luar negeri, untuk tempe dipasarkan disekitar Sidorajo

3. Porong

Sentra Industri Alat-alat dapur dari aluminium

4. Jabon

Sentra IK Tempe

Sentra IK Konveksi


Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

No Kecamatan


Keterangan 75.600 potong dengan nilai produksi Rp. 26.600.000,- Sentra Udang Windu Berada di desa Kedung Pandan Kecamatan Jabon. Hasil produksi dipasarkan dan diekspor ke USA, Jepang, Taiwan, Hongkong, dan Arab Saudi.

Setra Industri Ikan

Berada di desa Kedung Rejo Kecamatan Jabon. Krupuk ikan ini dipasarkan ke Jawa Timur, Jawa Tengah, dan Kalimantan. Terletak di desa Kemasan Kecamatan Krian Terletak di desa Tropodo berada dalam pengelolaan PRIM KOPTI “Ngudi Mulyo”. Jumlah unit usaha pada tahun 2001 ada 75 unit dengan tenaga kerja 294 orang. Jumlah produksi per tahun sebesar 3.600.000 kg dengan nilai produksi Rp. 4.680.000.000,-. Produk dipasarkan ke Sidoarjo, Gresik, Surabaya, dan Mojokerto. Sentra ini merupakan penghsil alatalat kebutuhan rumah tangga yang terbuat dari bahan alumunium. Seni kerajinan kulit adalah membuat barang-barang kerajinan yang terbuat dari bahan kulit. Yang dibuat antara lain adalah wayang kulit, lukisan kulit dan kaligrafi. Banyak berasal dari desa Kedung Peluk Kec.Candi. Kupang adalah merupakan hasil alam yang didapat dari perairan di Kecamatan Candi. Kupang biasa diolah sebagai lauk - pauk pada makanan dan biasa dicampur dengan lontong yang disebut lontong kupang. Selain untuk lauk-pauk kupang juga dipakai sebagai bahan pembuatan petis dan krupuk. Sentra ini terletak di desa Sepande dan Somokali Kecamatan Candi. Penghasil kerajinan cermin berasal dari desa Kedungbendo Kecamatan Candi. Industri kecil logam yang ada di Kecamatan Waru berada dalam pengelolaan Koperasi Logam Waru BuanaPutra,desa Ngingas Kecamatan Waru. Jumlah anggoanya pada tahun 2001 mencapai 128 orang. Koperasi ini telah mendapat penghargaan pada tahun 1989 berupa Upakarti Kepeloporan. Terletak di desa Wedoro Kecamatan Waru. Jumlah unit usaha pada rtahun 2001 sebanyak 147 unit dengan tenaga kerja 882 orang. 15 Gema Industri Kecil. Edisi XVIII - Juni 2007 Industri tekstil, produk kulit, dan tambak: Tumbuh dan tetap eksis

5. Krian

Sentra IK Sepatu Sentra IK Tahu, Sapi Perah dan Kereman

6. Candi

Sentra Industri Sayangan

Kerajinan Kulit Penghasil udang windu Penghasil kupang, petis kupang dan krupuk

Sentra IK Tempe Kerajinan Cermin 7. Waru Sentra IK Logam

Sentra IK Sandal

Info Utama

No Kecamatan


Keterangan Jumlah produksi per tahun 352.800 kodi dengan nilai Rp. 10.584.000.000. Ekspor per tahun 70.560 kodi dengan nilai Rp. 2.116.800.000. Negara tujuan pemasaran ekspor adalah Spanyol, Polandia, Panama, Dubai, Iran, dan Swiss.

8. Sukodono 9. Gedangan 10. Sedati

Mainan Anak Kerajinan Topi Ikan Asin Bandeng Udang Windu

Penghasil kerajinan permainan anak di Kecamatan Sukodono berasal dari desa KebonAgung. Penghasil kerajinan topi di Kecamatan Gedangan berasal dari desa Panggul. Penghasil ikan asin di Kecamatan Sedati berasal dari desa Gisik Cemandi. Penghasil ikan bandeng di Kecamatan Sedati be rasal dari desa Kalanganyar. Penghasil udang windu di Kecamatan Sedati be rasal dari desa Kalanganyar. Pengrajin Mente berasal dari desa Kedungsugo Kecamatan Prambon Penghasil krupuk berasal dari desa Jati Kalang Kecamatan Prambon. Budidaya jamur merang berada di desa Kedung Rawan Kecamatan Krembung. Jamur ini dipasarkan di Surabaya dan Malang. Buah blimbing banyak ditanam di desa Sudimoro Kecamatan Tulangan. Buah ini dipasarkan ke Sidoarjo dan Surabaya. Sentra ini terletak di desa Telasih kecamatan tulan gan. Produk ini dipasarkan ke Jatim, Jateng dan Kalimantan.

11. Prambon

Pengrajin Mente Krupuk

12. Krembung

Jamur Merang

13. Tulangan

Sentra Buah Blimbing

Sentra Krupuk Ikan

SecarageografisSidoarjoterletakantarabatassebelahutaraadalah KotamadyaSurabayadanKabupatenGresik,sebelahselatanadalah kabupatenPasuruan,sebelahtimuradalahselatMaduradansebelah barat adalah kabupaten Mojokerto. KabupatenSidoarjomempunyai18kecamatan,denganluas591,59 kmpersegidanberpenduduk1.682.000jiwa(2003).Secarakeseluruhan merupakandaerahdataranrendah.WilayahbagianTimurdengan ketinggian0-3meterdaripermukaanlaut,merupakandaerahpantai. BagianTengahberairtawardenganketinggian3-10meter,merupakan daerahpemukiman,perdagangandanpemerintahan.Wilayahbagian Baratdenganketinggian10-25meter,merupakandaerahpertanian. WilayahSidoarjoberupa:flora(tanamanpangandanholtikultura),dan fauna(perikanandanperternakan).Sumberdayamineral,bahangaliandan


Industri & Perdagangan

1. Pengembanganusahaperdagangansebagaipendukungpertanian:alatalat pertanian, hasil pertanian, dll. 2. Pusat Konsultasi Bisnis dan informasi pasar. 3. Pembangunan Pusat pembelanjaan.


1. Penambangangasbumi,terdapatdiKec.PorongdanKrembungdengan produksisementara2,5MMSCFdpertahun.Terdapat24sumuryang dibor baru 2 sumur yang beroperasi 2. Penambanganyodium.Hasilsurveydaneksplorasimenunjukkan kandunganyodiumdiKab.Sidoarjocukuptinggidenganluasareal 10.900 ha. di kec. Tarik, Tulangan, Porong dan Krembung 3. Pengelolaan garam rakyat.

Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

IKM memegang peranan penting dalam perekonomian nasional. Pada 2005 terdapat lebih dari 3,5 juta IKM dan mampu menyerap tenaga kerja 8,5 juta orang. Untuk itu pemerintah menetapkan tujuh program target pertumbuhan IKM
epartemenPerindustrian(deperin) menetapkantargetpertumbuhan iKMsebesar12,2%,yangkemudiandiharapkanakanmeningkatkan kontribusiterhadapPdBsektorindustri yangselamainihanya38%menjadi54% padatahun2005.untukmewujudkan targettersebut,mulai2006deperintelah menetapkankebijakanmelaluiprogram :pertama,PerkuatanProgram,kedua, PerkuatanPendampinganLangsung, ketiga,PerkuatanKelembagaan,keempat, PerkuatanSumberdayaManusia,kelima,


PerkuatanTeknologidanMesinPeralatan, keenam,Perkuatanjejaringkerjadan ketujuh,PerkuatanAnggaran.Ketujuh program ini harus saling terkait. dieraotonomidaerah,dirjeniKM menyerahkanwewenangoperasional pembangunanindustri,khususnyadalam rangka pembinaan dan bimbingan iKMsepenuhnyakepadaPemerintah daerah(Pemda),melaluipendekatan kebijakanAPBndekonsentrasidanTugas Pembantuan.Kebijakan“desentralisasi” atau“dekonsentrasi”inimemberikan

keleluasaankepadaPemdauntukmelaksanakantugaspemerintahannyasecara otonomidengantetapmengutamakan kepentingan nasional. dalampelaksanaantugasdekonsentrasi dan tugas pembantuan di bidangindustri,mengacupadapertama, program atau kegiatan yang akan dikelolaolehdinasindustriPropinsi dalam rangka dekonsentrasi, serta program/kegiatanyangdikelolaoleh dinasindustriKabupaten,Kotadandesa dalamrangkatugaspembantuan.Kedua,

Rapat koordinasi: Dalam rangka meningkatkan & penyusunan program IKM sektor industri


Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

adanyapengalokasianAPBndeperin kepadaPropinsi/Kabupaten/Kota/desa untukmendanaipelaksanaanprogram atau kegiatan dalam rangka tugas dekonsentrasidantugaspembantuan. Prinsip penyelenggaraan program Programdekonsentrasidiperuntukkan bagipelaksanaankegiatanparameter capainyangkinerjanyabersifatnonfisik (tidakberwujud).Selainitumenjamin keberlanjutandaurhidupeksistensiindustri yang sudah ada (existing) karena PemerintahPusatsangat berkepentinganuntuk mengamankanpertumbuhanekonominasional,kesempatankerja, penghasilan devisa danterjaminnyaaliran pasokan barang dari produsenkekonsumen. Lalu dalam perspektif manajemen pembangunan,tugas dekonsentrasi lebih tepat kalau bobot penugasannya difokuskankepadaaspek penanganankoordinasi, yangbersifatlintasdaerah Kabupaten/Kota,seperti; Koordinasipenyusunan rencana/program/ kegiatanpembinaandan pengembanganindustri, Penyediaan data dan informasiperkembangan industribesar,industri menengahdanindustri kecil di daerah (lintas
Rapat koordinasi menyusun anggaran (atas), IKM menjadi target pemerintah dalam pembangunan (bawah).

Kebupaten/Kota).SelainituMonitoring danevaluasipelaksanaanprogramP3dn terutamapengadaanbarangdanjasayang dananyadibiayaidariAPBn/APBd,baik proyek-proyekPropinsimaupunkabupaten/ Kota,Monitoringdanevaluasipelaksanaan rencana/program/kegiatanpengembangan industridiKabupaten/Kota,Koordinasi penanganandanpenyelesaianmasalah yangmenghambatperkembanganindustri didaerahdanterakhirMenyediakandata daninformasisumberdayapendukung industrilintasKabupaten/Kotaseperti

bahanbaku,infrastruktur,danlain-lain. TugasPembantuanmerupakanprogram pengembanganindustriyangdiwujudkan dalamkegiatanbersifatfisik.Misalnya pertamapembangunankawasanindustri (termasukpengembangankawasanindustri kecil)yangdiarahkanuntukmengantisipasi peningkatanutilisasikapasitasindustri, pertumbuhanindustribaru,penyebaran kegiatanindustrikeluarPulauJawadan peningkatanbasisproduksidipedesaan. Kedua,pengembanganpusat-pusat produktivitasindustri,melaluirevitalisasi uPT,LPTindak,danpendirian Pusat desain Kerajinan. Ketiga, pengembangan layananinformasiprodukdan faktorproduksi.Keempat, pemanfaatan Balai diklat industri(Bdi)sebagaipusat peningkatankompetensidan ketrampilanSdMindustri dan aparatur. Kelima, pengembangan proyekproyekrintisan(pilotproject), pengembangan industri berbasissumberdayalokal/ unggulandaerahdalamrangka pengembangankompetensi inti daerah. Penyelenggaraanprogram pengem-banganindustriyang dilaksanakanberdasarkan azas tugas dekonsentrasi maupuntugaspembantuan termasukdanaAPBnyang dipergunakanharusmengalir padasaatyangtepat(tepat waktu,tepatjumlahdantepat kualitas).danadikelolasecaratransparandanakuntabel, karena tujuannya untuk membantupertumbuhan industri/ekonomi,penciptaan lapangan kerja dan pengurangankemiskinan.


Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

Tugas Pembantuan merupakan program pengembangan industri yang diwujudkan dalam kegiatan fisik.
Mekanisme penyusunan program dan anggaran dekonsentrasiadalahkegiatanyang berlokasididaerahdimanawewenang danpengelolaannyadilimpahkankepada Gubernur selaku wakil pemerintah. SelainitudinasPerindagPropinsiyang melaksanakantugasdekonsentrasi menyusunrencanakegiatanuntukdibahas bersamadibawahkoordinasiGubernur yangselanjutnyadiajukanusulanrencana kegiatankepadaMenteriPerindustrian cq.dirjenyangbersangkutan.Selanjutnya Menteri Perindustrian dengan mempertimbangkanusulanGubernur menetapkanusulantersebutmenjadi kegiatandekonsentrasidengan”KeputusanPresiden”.BerdasarkanKeppres iniMenteriPerindustrianmengusulkan rencanannyakepadaMenteriKeuangan untukselanjutnyamenjadidasarpenyusunan satuan anggaran. SedangTugasPembantuanpertama, adalahkegiatanyangberlokasididaerah dengansumberdanadariAPBnyang pelaksanaannyamerupakanpenugasan dariPemerintahPusatkepadaGubernur/ Bupati/Walikota/Kepaladesa.Kedua, dinasPerindagyangmelaksanakan tugaspembantuanmenyusunrencana kegiatanuntukdibahasbersamadibawah koordinasiGubernuryangselanjutnya diajukanusulanrencanakegiatankepada MenteriPerindustriancq.dirjenterkait. Pengawasan, pertanggungjawaban dan pelaporan Pengawasansesuaidenganpasal26 PeraturanPemerintahnomor79tahun 2005adalahtentangPedomanPembinaan dan Pengawasan Penyelenggaraan Pemerintahdaerah,inspektoratJenderal departemenPerindustrianakanmelakukan pengawasanterhadappelaksanaantugas dekonsentrasidantugaspembantuan, karenadanayangdialokasikanbersumber dariAPBn.KalauadaunsurdanaAPBd-nya, makapengawasandapatdiselenggarakan olehBawasda.dalamrangkapembinaan, kegiatanpengawasandapatdiselenggarakan secarabersama-samadenganBawasda Propinsi/Kabupaten/ Kota. 1. Dana Dekonsentrasi : a) Penatausahaankemampuandalam pelaksanaandekonsentrasidilakukan secaraterpisahdaripenatausahaan kemampuandalampelaksanaantugas Pembantuan dan desentralisasi b) SKPdmenyelenggarakanpenatausahaanuang/barangdalamrangkadekonsentrasi secara tertib. c) SKPd menyampaikan laporan pelaksanaankegiatandekonsentrasi kepada gubernur. d) Gubernurmenyampaikanlaporan pertanggungjawabanseluruhpelaksanaankegiatandekonsentrasikepada Menteri/PimpinanLembagayang memberikanpelimpahanwewenang. e) Menteri menyampaikan laporan pertanggungjawaban kepada Presiden. 2. Tugas Pembantuan : a) Penatausahaankeuangandalam pelaksanaan tugas pembantuan dilakukan secara terpisah dari penatausahaankeuangandalam pelaksanaan dekonsentrasi /
19 Gema Industri Kecil. Edisi XVIII - Juni 2007 Hasil produksi IKM: Perlu pendampingan konsultan dan akses pasar

Info Utama Wewenang pembangunan industri, khususnya dalam rangka pembinaan dan bimbingan IKM ada pada Pemda.
TaBel KoMPoSISI KewenanGan PenGelolaan aPBn 2006 -2007
Alokasi Anggaran (milyar) No. T. A Pusat Dekonsentrasi (4) 75,3 139 Tugas Pembantuan (5) 20 Keterangan

(1) 1 2

(2) 2006 2007

(3) 204,3 322,8

(6) 18 kab/kota

Sumber : Bag. Program DJIKM

desentralisasi. b)SKPdmenyelenggarakanpenatausahaanuang/barangdalamrangka TugasPembantuansecaratertib. c) SKPdmenyampaikanlaporanpelaksanaankegiatanTugasPembantuan kepadaGubernur,BupatiatauWalikota. d) Kepala daerah menyampaikan LaporanPertanggungjawabannya kepadaMenteri/PimpinanLembaga. e) Menteri/PimpinanLembagamenyampaikan Laporan Pertanggungjawabannya kepada Presiden Implementasi dan hasil evaluasi HasilevaluasiinspektoratJenderal deperinberkaitandenganimplementasi APBndekonsentrasimaupuntugas pembantuan kesimpulannya: 1. Sesuaiketentuanyangberlaku,pelaksanaantugasdekonsentrasidibidang industribelummemenuhipersyaratan prosedural dan legal formal. 2. dilihatdarisisiprogram/kegiatan yangdilaksanakanterdapatkecen derunganadanyakegiatanyang

IKM bordir: Butuh bantuan modal dan akses pasar.

Percepatan pembangunan Papua
PenerIMa BanTuan PeralaTan
No Provinsi I Kabupaten/Kota Jenis Peralatan/mesin Papua Barat Kab. Sorong Kota Sorong Kab. Teluk Bintuni Pengolahan kayu Pengolaha kayu Peng. kayu , minyak atsiri (minyak lawang dan minyak masoi) Kab. Fakfak Pengolahan ikan Kota. Jayapura Batako/paving, kayu dan kakao Kab. Kirom kakao (coklat) Kab. Jayapura Peng. kayu, kakao Kab. Yapen Waropen Pengolahan kopi Kab. Nabire Pengolahan kopi Kab. Painai Pengolahan kopi Kab. Jayawijaya Pengolahan kopi Kab. Merauke Peng. pinyak atsiri (kayu putih) Kab. Biak Nuvor Pengolahan kayu kelapa 20



Tahun Anggaran 2007 dirjen iKM mengalokasikanprogramdankegiatan dalamrangkapercepatanpembangunandi PapuadanPapuaBarat.Hasilkesepakatan denganBappedaProvinsiPapua,ditetapkan bahwaalokasiprogrampengembanganiKM memprioritaskanpengadaanperalatan/mesin produksiuntukunitPelayananTeknis(uPT) sertadalamrangkamendukungkapasitas potensiiKMPangandanKimiadanBahan Bangunan.nilaibantuanprogramtersebut sebesarRp17milyardengankomposisiRp 12milyaruntukpengembangankomoditi kimia dan bahan bangunan, dan Rp 5 milyaruntukkomoditipangan.Rincianlokasi penempatanbantuanperalatan/mesin terlihat dalam tabel disamping.

Gema Industri Kecil. Edisi XVIII - Juni 2007

Info Utama

samadanalokasianggaranyang sama di setiap Propinsi. 3.. Program/kegiatandekonsentrasi belummengarahkepadakegiatan yangmemprioritaskankepada pengembanganpotensidaerah yangbenar-benardibutuhkan. 4. Belumadanyaprogramandalan spesifiksebagaimodelprogram yangdapatditerapkanpadadaerah potensial,kemudiandirumuskan indikator keberhasilannya. 5. Olehkarenaitu,program-program yangdirancanguntukdilaksanakan denganpendekatandekonsentrasi maupuntugaspembantuan, seyogyanyadirumuskansecara terintegrasi yang mampu menjawabatasberbagaimasalah industri di pusat/ di daerah. 6. di administrasi masih ada ketidaktertibansehinggaperlu dilakukan pembenahan. dirjeniKMdalammerealisasikan programpembinaandanpengembanganiKMmelaluiimplementasialokasi APBndekonsentrasi/desentralisasi maupuntugaspembantuandisesuaikandengankebutuhanpembangunan didaerah. ukurankebutuhanitu berdasarkanusulanBupati/Walikota mapundPRd,sertatokohmasyarakat denganurgensiyangrelevanuntuk pembangunaniKMdiwilayahnya. daritahunketahunperubahan komposisidanalokasipelimpahan wewenangpengelolaanAPBndalam rangkapembinaandanpengembangan iKMdekonsentrasimaupuntugas pembantuan terus meningkat. Sebagaimanaterlihatpadatabel KomposisiKeuanganPengelolaan G APBn 2006-2008.
21 Gema Industri Kecil. Edisi XVIII - Juni 2007

IKM pemintalan dan konveksi: Butuh bantuan pembinaan dan bimbingan.

Lintas sektoraL

Menteri Perindustrian RI, Fahmi Idris: Menyematkan tanda peserta pelatihan. Berpesan agar para peserta tekun dan rajin dalam mengikuti pelatihan Shindan Shi.

Calon Konsultan DIaGnosIs IKM
Pelatihan Shindan Shi, calon Konsultan Diagnosis IKM angkatan II selama lima bulan. Konsultan Diagnosis ini nantinya mendampingi IKM untuk membantu menyelesaikan berbagai masalah yang dihadapi IKM.


Gema Industri Kecil. Edisi XVIII/Juni 2007

Lintas sektoraL

enteriPerindustrian,FahmiIdris membukapelatihanShindanShi, calonKonsultanDiagnosisIKM angkatan ke II selama 5 (lima) bulan diCisarua-Bogor.KonsultanDiagnosis ininantinyamendampingiIKMuntuk membantumenyelesaikanberbagai masalahyangmungkintimbuldalam usahanya.Pelatihanyangdimulaipada 16April2007inidiikuti100peserta,hasil perekrutandanseleksi216pesertadari 23propinsidiseluruhIndonesia.Peserta akan menyelesaikan 702 JPL. Padakesempatantersebut,Menteri Perindustrian berpesan agar para pesertatekundanrajindalammengikuti pelatihan. Sehingga nanti dapat berperandilapangan,melakukantugas pendampingankepadapengusahaIKM. DiharapkanparaShindanShimampu merumuskanhasildiagnosispenyakitatau penghambatusahaIKMsecaracermat. Sehinggarekomendasiataupengobatan yangdiberikandapat“menyembuhkan penyakit” pada usaha tersebut. Hasil diagnosis tersebut, lanjut Menteri,jikadianalogikandenganpraktek kedokteranbenar-benarmenghasilkan usulan terapi lanjut yang dapat menyembuhkansuatupenyakit.Kalau penyakit/permasalahantergolongringan perludikasihobatringan,sebaliknya jikahasildiagnosismerekomendasikan terkenapenyakitberatmakaperluada ujilaboratoriumyangkemudiandilakukan terapilanjutan.“Kriteriaidealpetugas pendampingandikatakanberhasil, jikakeberadaannyamemberikannilai tambah atas pada perusahaan dan usahanyamenjadimeningkat,”katanya. Sebagaimanayangpernahdilakukan disentragerabah“Kasongan,Bantul” olehseorangsenimanbesarasalJogja almarhumSaptoHudoyo,sentrayang semulasangattradisionaldankumuhtelah


Menteri Perindustrian Fahmi Idris bersama Dirjen IKM Sakri Widhianto: Menghadiri acara pelatihan Shindan Shi.

dirubahmenjadisentrapercontohandi DaerahIstimewaYogyakarta,tambahnya. Peresmianpelatihanditandaidengan penyematankartupengenalkepada2 peserta,IwansyahdariKab.PidieNAD danMerceKaluedariSorong,Papua. ShindanShisendirimerupakanmetode dankurikulumpembelajaranasalJepang yangdiadopsidanditetapkanmenjadi salahsaturujukanstandarkompetensi profesi sesuai Standar Kompetensi KeterampilanNasionalyangditetapkan Badan Nasional Sertifikasi Profesi . SeorangcalonShindanShiatauKonsultan Diagnosismeskipunsudahluluspelatihan masihharusmenempuhsatutahapanlagi untukmemilikistandarkompetensiprofesi denganmengikutiujikompetensiyang diselenggarakanolehLembagaSertifikasiProfesiyangdiakuiBadanNasional G SertifikasiProfesi(BNSP). BoediSawitri
Gema Industri Kecil. Edisi XVIII/Juni 2007

Menteri Perindustrian, Fahmi Idris: Mengucapkan selamat kepada tenaga ahli dari Jepang

Lintas sektoraL


HaRaPan PEnGusaHa IKM
alam memecahkan masalah internalmaupuneksternalyang membelitIKMdiIndoneisa,Dirjen IKMmengadopsisistemdariJepang, yangdisebutShindanatauKonsultan Diagnosis.Prinsipkerjanya,melakukan pendampingandankonsultansidalam bentukanalisadandiagnosamasalah yang dihadapi oleh IKM. Untukmencapaitargetpertumbuhan IKMyangtelahditetapkanDepartemen Perindustriansebesar12,2%,dibutuhkanterobosankebijakanyangmendasar. Datalajupertumbuhan IKMdalamperekonomian nasional pada 2005 baru sekitar 8,8%denganjumlah unitusahalebihdari 3,5 juta, dan tenaga kerjayangdiserapsebanyak8,5jutaorang. Sarat masalah KondisiIKMsendiri hinggasaatinimasih saratdenganberbagai masalah,baikinternal maupuneksternal.Masalahinternalbiasanya lemahdibidangpermodalan,teknologi,manajemen,keterampilansumberdayamanusiatermasuk lemahmengaksespemasaran.Sedang

IKM di Indonesia umumnya sulit keluar dari lingkaran permasalahan, baik masalah internal maupun eksternal. Untuk memecahkan masalah tersebut Ditjen IKM mengadopsi sistem dari Jepang.
sisieksternal,IKMlemahdalamposisitawar,lemahbersaingdenganprodukperusahaanbesarmaupunprodukimpor. Realitasnya bahwa industri kecil memangmasihsulitkeluardarilingkaran permasalahan,meskipunsudahbanyak programdanskemapembinaanyang diberikan.Diantarapenyebabnya,kurang pembinaansecarakomprehensif,dan tidakberkesinambungan.Salahsatunya berkaitandenganprogrampendampingan langsungkepadaIKM.Olehkarenaitu programdankegiatanpendampingan langsung perlu diintensifkan. UntukprogrampendampinganIKM, DirjenIKMmengadopsisistemataupola darinegaraJepang.Programyangdi negaraasalnyainidisebutShindan,di IndonesiaditerjemahkansebagaiKonsultanDiagnosis,karenaprinsipkerjanya adalahmelakukanpendampingandan konsultansidalambentukanalisadandiagnosamasalahyangdihadapiolehperusahaankhususnyaIKM.Tugasutamanya adalahmemberikanrekomendasiuntuk memecahkanmasalahyangdihadapiIKM tersebut. Untukmencaritenaga konsultanpendamping dengankualifikasiahlidiagnosapenyakitataumasalahyangdihadapiIKM, DirjenIKMDeperinmenjalinkerjasamadengan JICA,denganmembentuk programpelatihanbagi pegawainegerisipilpusat dandaerah,utamanyaPejabatFungsionalPenyuluh Perindustrian (PFPP) dilatih selama 6 bulan. Tahapawalsemuatenaga instruktur(pengajar)didatangkandariJepang. ProgramPendampinganLangsung jugadiberikankepadaprofesional”konsultanspesialis”yangdapatmenindaklanjuti

Pelatihan Shindan: Untuk membantu memecahkan permasalahan di IKM

Gema Industri Kecil. Edisi XVIII/Juni 2007

Lintas sektoraL

rekomendasikonsultandiagnosisberkaitandenganpembinaandanpengembanganIKMyangbermasalah.Selainitupeluangpendampinganjugadiberikankepada profesionalyangbergabungdilembaga atauperusahaankonsultanuntukberperanmembimbingperusahaanyang berkelompokdalamsuatusentra.Secara parsialprofesipendampinganyangdilakukanparakonsultaniniterbagimenjaditiga,pertamapendampinganbidang analisadandiagnosaolehkonsultandiagnosis.Keduapendampinganbersifat spesifik,olehkonsultanspesialis, dan ketigapendampingansentraIKMyang dilakukanolehlembagaatauperusahaan konsultan Untukmengelolasistimdanmekanisme kerjaprogramdanpelaksanaankegiatan pendampingan dibuat unit kerja sebagaipengelolaadministrasisekaligus mengorganisasikankegiatandilapangan dengan nama Unit Pendampingan Langsung (UPL). UPL ini adalah unit kerjayangberkedudukandilingkungan

DitjenIKMdandilingkunganPemda Provinsi/Kabupaten/Kota.Tugasnya mengkoordinasikan,mengadministrasikan prosespelaksanaanprogram/kegiatan pendampinganlangsungyangdilakukan parapejabatfungsionalpenyuluhindustri, konsultan diagnosis maupun para konsultanprofesionalsecaraindividu ataukelembagaan.Oehkarenaituunsur pokok pelaksana unit ini terdiri dari PejabatFungsionalPenyuluh,Konsultan Diagnosis, Konsultan Spesialis dan Lembaga Konsultan. Peran, fungsi dan tugas UPL berperan menjadi fasilitator, komunikator,motivator,dinamisator, koordinator,administratorpelaksanaan program/kegiatanpendampingan.Sedangfungsinyameliputi;layananteknis dannonteknis,layananinformasitimbal balik,memberidoronganatasdinamika dankreativitaskeusahawanandisamping ikut memecahkan masalah. Sementara tugas UPL pertama

Perajin batu: Kurang pembinaan secara konprehensif




TUPOKSI: - Perencanaan - Pengendalian - Monitoring - Pelaporan - Koordinasi antar instansi Pusat provinsi Kab / Kotaa, Asosiasi, perusahaan - Pelaksanaan DIPA (Pelatihan, Seminar, Pameran, Raker, pengadaan, dsb) - Pemecahan masalah aktual (Kebijakan & Program)

TUPOKSI: - Diagnosis masalah - Pendampingan perusahaan (GMK, AMT, CEFE, ISO 9000) - Pendampingan pihak III yg ditugasi - Pengendalian UPT - Pemecahan masalah aktual di lapangan

Posisi Tenaga Penyuluh Perindustrian Dilingkungan Dinas Perindag Tingkat Provinsi 25

menyediakansaranadanprasarana kerjapelaksanaankegiatan,menyusun danmengajukanprogramdiwilayah kerjanya. Kedua,melaksanakanprogrampendampinganlangsungsesuai alokasi kegiatan (DIPA) tahun yang bersangkutan.Ketiga,melakukanidentifikasidanmenentukanindustrikecil danmenengah yangmenjaditarget pendampingan.Keempat,menunjuk dan menugaskan PFPP (Pejabat FungsionalPenyuluhPerindustrian)atau KonsultanPendampingandalamrangka pelaksanaanpendampingan.Kelima, menyediakanfasilitasdandukungan kerja.Keenam,mengkoordinasikan danmengadministrasikantugasPFPP, konsultandiagnosisIKMdankonsultan spesialisdiwilayahnyasertamelakukan monitoringdanevaluasilaporan.Ketujuh, UPLProvinsimemberikanpendampingan IKMdengannilaiinvestasiperalatandan mesinantaraRp200jutasampaiRp10 milyar.Sedang-kanUPLKabupaten/Kota memberikanpendampinganIKMdengan nilai investasi peralatan dan mesin dibawah Rp 200 juta. UntukmembentukUPLyangperlu diperhatikanpertama,UPLtermasuk pengelolanyaditetapkanolehKepala DinasyangmenanganibidangindustridiProvinsi/Kabupaten/Kota.Kedua, pengelolaUPLterdiridariseorangketua

Gema Industri Kecil. Edisi XVIII/Juni 2007

Lintas sektoraL

dansedikitnya2(dua)anggota.Ketiga pengelolaUPLharusPejabatFungsionalPenyuluhPerindustrian(PFPP)atau PNSyangsudahmengikutipelatihan konsultandiagnosis.Keempat,ketua UPLadalahkoordinatorkegiatandalam melaksanakankegiatanberdasarkan DIPA/APBNDekonsentrasiProvinsitempatbertugas.Kelima,memilikiruang kerja, sarana dan prasarana. Pendampingan perusahaan. Mekanismependampinganterbagi menjadiduamodelyaknipendampingan perusahaandanpendampingansentra. Sedangmekanismependampingan terhadapperusahaantertentudilaksanakan olehKonsultanIndividu(PFPP,Konsultan Diagnosis dan Konsultan Spesialis)

melaluitahapanpertama,verifikasi.Yakni mendatacalonyangakandidampingibaik administratifmaupunteknisnya.Kedua, pelaksanaandiagnosismerupakantahap operasionaldiagnosisatasperusahaan yangdirekomendasikandengantujuan mengidentifikan serta menganalisa permasalahanyangditemukansertarumusan terapiyangperludirekomendasikanuntuk tindaklanjutpendampingandilapangan. Ketiga, tahap konsultasi. Yakni tahapoperasionalpendampinganyang dilaksanakan atas ketetapan Surat PerintahKerjadariPejabatPembuat Komitmen,termasukpenetapanbesaran honorariumpelaksanaanpendampingan. Keempat, tahappembayaran.Yakni penetapanhakyangdiberikankepada konsultanbaikdiagnosismaupunspesialis. UntukKonsultanDiagnosis cukupditetapkanolehPejabat Pembuat Komitmen Provinsi,sementarauntuk KonsultanSpesialisdiatur berdasarkan Peraturan MenteriPerindustrianNo. 37/2005yangmenetapkan bahwa 10% biaya pendampingandibebankan kepada perusahaan IKM, sisanya(90%)ditanggung pemerintahdalamhalini Dirjen IKM. Pendampingan sentra Pendampinganterhadap kelompokIKMdalamsatu lokasisentraharusdilakukan olehLembaga/Perusahaan Konsultandengantahapan pertama, Kepala Dinas Provinsi U.p Ketua UPL menugaskanKonsultanIKM (PFPP,KonsultanDiagnosis) melakukan diagnosis ke

Konveksi: Butuh bantuan akses pasar

SentraIKM.Kedua,hasildiagnosissentra yanglayakditindaklan-jutipembinaannya disampaikan kepada Kepala Dinas ProvinsiU.pKetuaUPLuntukmelakukan persiapanpelelanganjasakonsultan. Ketiga,KepalaDinasProvinsiU.p.PPK Provinsi(DIPADekonsentrasi)melakukan persiapan pelelangan. Keempat,KepalaDinasProvinsiU.p. PPKProvinsimemerintahkankepada TimPengadaanJasaKonsultanuntuk melakukanpelelangan.Kelima,tim pengadaanjasakonsultanmelakukan pengadaan jasa konsultan sesuai prosedurdanketentuanyangberlaku. Keenam, tim pengadaan jasa konsultanmenyampaikanhasilpenetapan pemenangjasakonsultan(perusahaan konsultan)kepadaKepalaDinasProvinsi U.p.PPKProvinsi(Dekonsentrasi)untuk menerbitkansuratperjanjiankerjasama (kontrak). Ketujuh, perusahaan konsultan melaksanakantugaspendampingan sentra.Kedelapan,perusahaankonsultan menyampaikanlaporanhasiltugas pendampingansentrakepadaKepala DinasProvinsiU.p.PPKProvinsidilampiri dokumen Berita Acara Penyerahan dan Berita Acara Pemeriksaan Hasil Pekerjaantermasukkwitansipenagihan pembayaran. Kesembilan,KepalaDinasProvinsi U.p.PPKmenelitidokumendanmenyetujui pembayaranjasakonsultansimelalui KPKN setempat. DitetapkannyaUPLsebagailembaga pengelolaprogrampendampingan,serta dukungandanaDekonsentrasimaupun TugasPembantuansebagaiamanat APBNharusbenar-benartepatsasaran. Tujuannyauntuk”membangkitkanIKM darililitanmasalahyangtakkunjung usai”menujukemandirianyangsehat G dan tangguh. Gunawan Usamah

Gema Industri Kecil. Edisi XVIII/Juni 2007

Lintas sektoraL

ExPo InDonEsIa 2007 DI MuMbaI-InDIa Indonesia-India, Untuk meningkatkan hubungan dagang antara

Indonesia menyelenggarakan Expo Indonesia 2007 di Mumbai, India. Hasilnya, telah terjadi transaksi dagang antar pengusaha Indonesia dan India. Kedepan perlu terus ditindaklanjuti.
sekaligusmemantapkanhubunganbisnis antarapengusahaIndiadanIndonesia sertahubunganbilateralkeduanegara yangberkelanjutan.Diharapkandengan ekspoini,produk-produkasalIndonesia dikenaldiIndiasecaralebihluas.Yang selanjutnyaadatransaksipembelian. “Perlunyadukunganpemerintahmendirikan Trading House Indonesia di Mumbai,Indiauntukmendorongrealisasi bisnisyangberkelanjutan,”kataTitoDos SantosBaptista,KonjenRIdiMumbai. Tampilkan produk unggulan IkuttampildalamExpoIndonesia 2007,diantaranyapengusahaIKMyang difasilitasiolehDitjenIKMdenganmenampilkananekaprodukunggulanseperti kerajinandanminyakatsiri.Danmereka mendapatkantanggapancukupbagus, beberapadiantaranyatelahberhasil melakukantransaksi“potensialorder”, khususnyaprodukminyakatsirimendapat banyakperhatiandaripengunjungExpo. Diantaraperusahaanminyakatsiri Indonesia yang ikut expo, PT. Kelma NiagaSempurna(KNS),menampilkan produkminyakatsirimeliputiPatchouli oil,Nutmegoil,Javagloveoil,Sandalwood oil,Canangaoil,CinnamonBarkoil,serta gambir,damar,danramuanspa.Dalam ekpoiniKNSberhasilmelakukantransaksi penjualanlangsungdanpotensialorder.

ubungandagangantaraIndonesia dan India telah berlangsung cukup lama, sejak Indonesia merdeka1945.Namununtukmenghadapi perdagangan global, hubungan ini dirasamasihperluditingkatkanlagi. Upayayangdilakukandiantaranyamelalui penyelenggaraanpameranatauekspo. Sepertiyangbaru-baruinidiselenggarakan “ExpoIndonesia”dikotaMumbaiIndia, tepatnyadiWorldTradeCentrepada6-8 April2007.Instansiyangikutmendukung ekspokaliinidariDepartemenLuarNegeri, DepartemenPerindustrian,Departemen Perdagangan,DepartemenKebudayaan danPariwisata,BKPM,BKPMDDKIJakarta


Konsul Jenderal RI di Mumbai, Toto Dos Santos Baptista bersama Menteri Keuangan Maharastra India, Shri Jayantrao: Meresmikan pameran.

danYayasanMutuManikam,yangterbagi dalam62standdenganmenampilkan aneka produk industri. ExpoIndonesia2007dibukapada6 April2007,olehMenteriKeuanganMaharastraIndia,ShriJayantraobersama KonsulJenderalRIdiMumbai,TotoDos SantosBaptista,yangdidampingiketua AsosiasiBisnisIndia-Indonesia(IIBA)DR. NareshBedi,DirekturJenderal ILMTA AnsariBukharidanDirjenPariwisata, Thamrin ExpoyangdiprakarsaiolehKonjen RI di Mumbai bekerjasama dengan IIBAini,bertujuanuntukmeningkatkan peluangpasarprodukIndonesiadiIndia,

Gema Industri Kecil. Edisi XVIII/Juni 2007

Lintas sektoraL

Transaksi: Pengusaha mebel rotan asal Cirebon mendapat pesanan

LantasPTScentIndonesiadan PT. AromatikaBotanika,menampilkan21jenisminyakatsirimeliputiyangPatchouli oil,Vertiveroil,Nutmegoil,Gloveleafoil, Curcumaoil,Hydroxylcitronella,Gajeput oil,Turmericoil,MassoiaBarkoil,YlangYlangoil,Kaffirlimeoil,GurjunBalsam oil,GloveBudoil,Gingeroil,GloveStem oil,Cintonellaoil,Agarwoodoil,Cubeb oil,EngenolUSP,javaCanangaoil,CinnamonBarkoil.PTAromatikaBotanika, mendapatkan“potensialorder”untukjen-

isPatchoulioil, Vertiveroil,Essentialoildari Perusahaan PariChemical India,Agriculture System KevadanAjmal Perfume. PT. Van Aroma,perusahaaninimelakukanpromosidantransaksipesanan,untukprodukPatchoulioil, NutmegoildanVertiveroil.Sedanguntuk potensialorder-nyaadalahjenisPatchouli oildanVertiveroilsertaPatchoulioildan nutmeg oil. Ada tindak lanjut HarapanbuyerdariIndia,Perancis danInggris,selakuwholesalesmaupun eksportir,inginberlanjutmenjalinker-

jasamaperdagangandenganpengusaha Indonesia.Diharapkanparapengusaha IKMIndonesiamampumemenuhipermintaanparabuyeryangtelahdisepakati dalamexpoini.Sedanginstansiterkait diharapkantetapmemberidukunganprogrampembinaanberkelanjutandemiterjalinhubungandagangantaraIndonesia dan India yang langgeng. Sebagaiinformasi,industriminyak atsiridiIndiasekaranginisangatmaju. Merekamenguasaipangsapasardunia, dandapatmempengaruhiharga.Halini karenaprodusenminyakatsiridiIndia telahdidukungdenganperalatanmodern dantelahmelakukanpenganekaragaman produkturunanberbasisminyakatsiri. Olehkarenaituperludilakukantindak lanjutbaikdalam hubungandagang maupun transfer teknologi dalam mengolahprodukhilirminyakatsiridi G Indonesia. Elim Lolodatu

GoRontalo EKsIs ManfaatKan bantuan MEsIn PERalatan
Sejak 2004 Propinsi Gorontalo menerima bantuan mesin peralatan dari Direktorat Jenderal IKM. Pemda dan Dinas Perindagkop Gorontalo menempatkan dalam satu Kawasan Industri Agro Terpadu (KIAT).
alah satu upaya pemerintah meningkatkanperkembangan IndustriKecildanMenengah(IKM) diseluruhPropinsi Kab/Kota, yakni melalui pemberian Bantuan Mesin Peralatan. Bantuan itu tentunya disesuaikandenganpotensisumber dayaalamdimasing–masingdaerah


agar dapat menghasilkan produk yang berkualitas, mempunyai daya saing tinggi dan memberikan nilai tambahbagiprodukyangdihasilkan. Sehinggaselainakanmemberikannilai tambahbagiIKMitusendiri,jugadapat meningkatkanekonomimasyarakat didaerah tersebut.

PropinsiGorontalomerupakansalah satudaerahyangmenerimabantuan mesinperalatanyangdisalurkanoleh DepartemenPerindustrianmelaluiDinas Perindustrian,PerdagangandanKoperasi. Bantuanyangdiberikandisesuaikan denganpotensisumberdayaalamyang menjadiunggulanPropinsiGorontaloyakni

Gema Industri Kecil. Edisi XVIII/Juni 2007

Lintas sektoraL

ikan,kelapa,jahe,jagung,danrotan. Sejak2004PropinsiGorontalotelah menerimabantuandariinstansipembina sepertiMenekop,Dep.Perindustrian, melaluiDirektoratJenderalIndustriKecildanMenengahberupabantuanmesinperalatanindustripembuatanbakso ikan,industriempingjagung,industri cabebubuk,industrisaustomat,industri jaheinstantdanindustripakanternak. Untukmemaksimalkanpenggunaan mesinperalatantersebut,Pemerintah DaerahdandinasPerindagkopGorontalomenghimpunseluruhbantuanini dalamsatuKawasanIndustriAgroTerpadu (KIAT)diataslahanseluas6hektar, di areal Danau Perintis. Lokasi ini tidakhanyaberfungsisebagaikawasan industrisaja,tapijugaberfungsimenjadi lokasiwisatayangcukupmenarikbagi masyarakat Gorontalo. Meningkatkan mutu produk Penempatanmesinperalatandalam KIATdimaksudkanuntukmemaksimalkanpenggunaanmesinperalatanbagi pengolahanprodukIKMyangberkualitas dibawahpengawasantenagaahlidan fasilitasujimutulaboratorium.Diharapkanprodukyangdihasilkandikawasan iniakanmenjadiprodukunggulandaerah yangmempunyainilaijualtinggidanmen-

Bantuan mesin: Untuk memaksimalkan pengolahan produk bagi IKM

No 1 1 2 3. 4. 5. 6. 7. MESIN PERALATAN 2 Pengolahan Cabe Bubuk Pembuatan PakanTernak Pengolahan saus tomat Virgin coconut oil(VCO) Pembuatan Jahe Instant Bakso Ikan Emping Jagung KAPASITAS PRODUKSI 3 180 kg 500 kg 75 botol (600ml) 160 btl 100 kg 100 kg 30 kg KAPASITAS LISTRIK 4 .9000 watt 30.000 watt 7500 watt 2.200 watt 9000 watt 14.500 wat 13 PK

jadisumberpenghasilanbagiIKM. Pengelolaan dan mekanisme kerja yang ada di KIAT, sifatnya masihdalamtahappembinaanoleh DinasPerindagkopdengandibantu beberapakaryawanyangdirekrut sesuaikebutuhanunitusahayang ada dilokasi KIAT. Sementara, pemanfaatanmesinperalatanyang adamasihmengerjakanproduk– produkyangsifatnyamasihdalam tahap penyempurnaan baik segi kualitasmaupunteknikpengolahan. Masamendatangmesinperalatan ini diharapkan dapat berfungsi maksimalseiringdenganpeningkatan produktifitasparapengelolanya. DengandemikianpengelolaKIAT dapatmelakukan pembinaankepada IKMyangberminat mengembangkan usaha sesuai dengan potensi wilayahnya. Keberadaan KIATinidiharapkan dapatmemberikan fungsi pada peningkatanaspek ekonomi, sosial dan ekologi bagi kalanganIKMdan masyarakat.Untuk masamendatang kawasanKIATdiharapkanmendapat bantuanrumahKemasan,sehingga produkyangdihasilkanmenjadi produkyangmempunyaiidentitas khususmudahdikenalsebagaiproduk dariKIAT.Sistimyangdilakukandi PropinsiGorontaloinidapatdijadikan contohbagidaerahlainagarbantuan yangditerimalebihberdayagunadan Lusiana Mohi berhasilguna. G


Gema Industri Kecil. Edisi XVIII/Juni 2007

Dari Sentra KeSentra

Konawe Bangkit Dengan Bantuan
mesin pengolahan sabut kelapa dan mesin pengolahan rotan.
Selatan,dansebelahbaratberbatasan denganKabupatenKolakainikondisi masyarakatnya memang rata-rata berpendapatantergolongmasihrendah. Mengacu komoditi unggulan Spesifikasi jenis mesin yang diberikankedaerahKonawemengacu kepadakomoditiunggulandidaerah tersebut. Melihat kondisi geografis KabupatenKonaweyangumumnya bergunungdanberbukit,sebagianlagi berupa lautan dan daratan rendah. Makatidakherankomoditiunggulannya abupatenKonaweyangmasuk dalampropinsiSulawesiTenggara, masihtergolongdaerahtertinggal. Kondisimasyarakatnyamasihcukup memprihatinkan.Untukitupemerintah lewatDepartemenPerindustrian(Deperin) menempatkanKonawesebagaisalah satudaerahprioritasyangmendapatkan bantuan mesin peralatan. Daerahyangberbatasandengan PropinsiSulawesiTengah(sebelahutara), berbatasandenganlautBandadanlaut Maluku(sebelahtimur),disebelahselatan berbatasandenganKabupatenKonawe

Mesin Peralatanmesin peralatan pengolahan ikan, Kabupaten Konawe mendapat bantuan
berupa rotan, kelapa, dan ikan. Di Konawe sendiri industri terbesar yangadaadalahindustripengolahan rotan.DaridataDiperindagKabupaten Konawe,didaerahiniterdapatsekitar 70 unit usaha. Untuk produksi rotan, Konawe termasuk salah satu sentra rotan di Indonesia. Tersedia lahan sekitar 6.800hektaryangbisadikembangkan untukbudidayatanamanrotandienam kecamatan(Latoma,Abuki,Meluhu, Lasolo, Asera, dan Wawonii). Jadiberdasarkanpemetaankebutuhan danindustriyangberkembangdiKonawe, jenismesinatauperalatanyangdiberikan meliputimesinpengolahanikan,mesin pengolahansabutkelapa,danmesinatau peralatan pengolahan rotan. Untukmesinpengolahanikanterdiri dari tiga item mesin, pertama mesin penanganandanpengolahanikanterdiri atasempatjenisyakniiceflaker(1unit), peti insulas (cold box / 5 unit), pisau pemisahdagingikan(5unit),danvacuum sealer(1unit).Kedua,pengolahanabon ikanterdiridarigratermachine(1unit), mollen/mixer(1unit),fryingapparatus (1 unit), meja kerja (1 unit), impulse
Arwahid, Kadis Perindag Konawe: Untuk serabut kelapa sedang mencari pasar 30 Gema Industri Kecil. Edisi XVIII/Juni 2007

Dari Sentra KeSentra

Mesin pembelah rotan dan produk rotan: Komoditi unggulan di Konawe

sealer(2unit).Ketiga,mesinpengolahan dan pengasapan ikan terdiri ruang pengasapan(1unit),pembangkitasap (1 unit), dan genset (1 unit). Sedanguntukmesinpengolahan sabut kelapa yang diberikan dalam rangkapengembangankomoditiprioritas daerahKonaweterdirimesinpelunak sabut(crhusher/1unit),mesinpenyerat (decorticator / 1 unit), mesin saring serabut(revolvingscreencocofibre/ 1unit),mesinpresserabut(hydraulic press coco fibre / 1 unit), peralatan pendukung(straightband/1paket), timbanganberas,alatangkutgabus,dll (1 paket). Kapasitas produksi dari mesin pengolahansabutkelapainisekitar2000 tonperbulan.Saatinisudahberoperasi, tapiproduksinyabelumbisarutin,karena pasarnyabelumada.Pemdasedang membantumencarikanbuyerataupasar yang bisa pesan rutin dengan harga bersaing. Sementaramesinatauperalatan pengolahanrotanterdirimesinpembelah rotan ukuran 6’(spilt /2 unit), mesin pembelahrotanusuran3,5’(spilt/2unit), mesinpelurus(untukmeluruskanrotan2unit),mesinpenipis(untukmenipiskan rotan - 2 unit), mesin poles (untuk menghilangkankulitaridarirotan-2

unit),dangeneratorset(sebagaitenaga pembangkitlistrik/opentype-2unit). Kapasitas produksi dari mesin pengolahanrotantersebutrata-rataper bulanbisamencapai200ton.Padatahun ini(2007)kapasitasproduksinyaakan ditingkatkangunamendukungpeningkatan produksi yang berorientasi ekspor. Dikelola UPT Sistemataupolapengoperasianmesin bantuantersebutdiserahkankepadaUPT (UnitPelayananTeknis)setempat.UPTini yangakanmenghimpunkelompokperajin untuk menjadi anggotanya. Proseskemitraannyaadalahbahan bakuyangdijualpetanidibeliolehUPT kemudianUPTakanmenjualnyakembali G kepadaperajinataupengolah. Kadri
31 Gema Industri Kecil. Edisi XVIII/Juni 2007

Dari Sentra KeSentra

geliat INDUSTRI ANYAMAN serat lOntar Di takalar yang Sulawesi Selatan memiliki sentra industri kerajinan anyaman
cukup terkenal, yakni di Kabupaten Takalar. Produk anyamannya memiliki nilai estetika yang tinggi karena dibuat dari serat lontar. Bagaimana kondisinya sekarang?
Sementaradarisegibahanbaku,cukup banyaktersediadidaerahinidansampai sekarangbelumpernahmemasokbahan bakudariluardaerah.Semuabahanbaku yangdigunakanmasihbahanlokal,dimana seratdaripelepahlontarinimempunyai keunggulan yakni kuat dan lentur. Pemanfaatanseratlontarsebagai bahanbakuanyamantelahmengubah sesuatuyangtidakbermanfaatmenjadi produkyangbernilaitinggi.Kegiatan industrikerajinananyamanseratlontarini mewarnaigerakkehidupanmasyarakat GalesongSelatansebagaisumber lapangankerjayangcukupbesar dalammemberikankontribusibagi pembangunanekonomisecara


abupatenTakalaryangberpenduduk 235.565 jiwa dan memiliki 7 kecamatan merupakan salah satudaerahdiSulawesiSelatanyang merupakansentraindustri,terutama industrikerajinananyamanseratlontar yangbahanbakuutamanyaadalahserat/ pelepah dari pohon lontar. Anyamansertalontarinimerupakan suatuindustriyangsejakzamandahulu dikenaldanmerupakanindustriwarisan nenek moyang yang tersebar pada beberapa desa, dimana sentra dari kerajinananyamanserat lontariniberadadidesa BontokassidanSawakong Kecamatan Galesong Selatan. Industrikerajinananyamanseratlontaryangberada dikecamatanGalesong Selatanmempunyaipotensi cukup besar dalam pengembangannya.InidapatdilihatdarisegiSDMmaupunbahan bakunya. DarisegiSDMpadadasarnya masyarakatGalesongSelatanmempunyaiketerampilanyangsudah turun-temurundalamhalmenganyam seratlontar,khususnyamenganyam topi/songkok. Saat ini di sana terdapat12unitusahadengan300 perajin dan 500 tenaga kerja.

umum.Sentraindustrianyamanserat lontardengankeberadaannyakental dengan seni budaya setempat. Padatahun1985industrikerajinan anyamanseratlontarinimulaimengalami banyak perubahan dan mampu menghasilkanbeberapaproduk,antara laintopi/songkok,gucianyaman,tempat pulpen,keranjang,gantungankunci,dan gelang tangan. Produkyangditampilkandarihasil karyaparaperajinmemilikinilaiestetika dankearifanlokalsertadiversifikasiproduk setelahmendapatsentuhanpembinaan langsungmelaluiDinasPerindustrian danPerdaganganKabupatenTakalar yangdisesuaikandengankebutuhan masyarakatkonsumen masa kini. Setiap bulan paraperajinmampu memproduksisekitar 1500-3000 buah untukdipasarkanke wilayahJakarta,yakni di Tanah Abang dan Blok M. Sementara untukdaerahlokaldi

M. Dahlan Beta (inzet) dan perajin anyaman lontar: Memiliki nilai estetika tinggi


Gema Industri Kecil. Edisi XVIII/Juni 2007

Dari Sentra KeSentra

Makassaryakniditoko-tokokerajinan setempat.Omzetyangdidapatpara perajinrata-rata50jutasetiapbulannya. Produk Unggulan Daerah KabupatenTakalarmenjadikanproduk kerajinanseratlontarsebagaiproduk unggulandaerah.Haliniterlihatdarisetiap adaacarapameranyangdiselenggarakan olehdaerahTakalar,anyamanseratlontar selaludiikutsertakansebagaikerajinan khas Takalar. Bahkan pemerintah Kabupaten Takalarmemberikanbantuankepadapara perajinuntuklebihmeningkatkankualitas produknya.BupatiTakalar,H.Ibrahim Rewa,memintakepadaparaperajinagar memanfaatkanbantuanitudengansebaikbaiknyagunameningkatkankesejahteraan mereka. M.DahlanBeta,KetuaKelompok UsahaBersamaAnyamanSeratLontar “Pattinggalong”,sebagaipenggerak perajinanyamanseratlontardiTakalar, jugaterusberupayauntukmemberikan yang terbaik bagi pengembangan kerajinananyamanseratlontardiTakalar. Dahlan yang mulai bergelut di kerajinananyamanseratlontarpada 1989 ini merasa terpanggil untuk memberdayakankerajinananyamanserat lontar.Pasalnya,bahanbakulontaryang terdapatdiTakalarsangatbanyak,namun pemberdayaannyamasihsangatkurang. Industrikerajinananyamanserat lontardiTakalarpernahmengalamimasa kejayaanpadatahun1990-an,dimana produk-produkanyamanTakalarsudah mulaidikenalolehpendudukluardaerah, diantaranyaadalahJakarta.Bahkanpada tahun1992produkanyamanTakalar sudahsampaikemancanegara,seperti Singapura, Jepang dan Belanda. Adasatuprodukyangmenjadiciri khasanyamanTakalaradalahtopiadat

Produk anyaman lontar: Untuk acara adat

Takalar,yaitusongkokguru.Biasanyatopi inidigunakanuntukacara-acaraadatatau acarapernikahandiSulawesiSelatan. Bertahannyakerajinananyamanserat lontardiTakalarhinggakinitaklepasdari kiprahsalahseorangyangpedulidengan anyamanseratlontar,yaituDaengToto (alm.).DaengTotodikenalsebagaiorang yangmengenalkanmodifikasianyaman topidariseratlontarsehinggamemiliki banyak ragam. Meskibegitu,paraperajinanyaman serat lontar di Takalar selama ini memilikikendaladalamhalteknikcepat

memisahkandaribahanpelepahhingga menjadiseratyangbisadianyam.Alat ini,menurutDahlan,pernahdijanjikan olehpemerintahuntukdiberikan,namun hinggakinibelumadarealisasinya.“Jadi selamainikamimasihmenggunakanalat tradisionalyaitupisau,”kataDahlan. Takhanyamesin,paraperajinanyaman diTakalarjugamengalamikendaladalam pemasaran.Selamainipemasaranyang dilakukanolehparaperajinmasihpasif. Biasanyahanyamelaluipameransaja. Selebihnyamelaluikegiatan-kegiatanyang G Fiki dilakukanolehPemerintahKabupaten.

Gema Industri Kecil. Edisi XVIII/Juni 2007

Dari Sentra KeSentra

Minyak KenangaperanciS “Srengat” Sampai
Bunga kenanga bisa dijadikan sebagai peluang bisnis, diolah menjadi minyak atsiri kenanga. Sukar telah membuktikan dan hasilnya diekspor ke Perancis sebagai bahan baku parfum.
ungakenangayangidentikdengan pemakaman,karenabiasanyatumbuhdilokasipemakamanternyata bisadijadikansebagaipeluangbisnis. SukaryangtinggaldidesaPetogogan, Srengat,Blitardiantarayangberhasil mengolahbungakenangamenjadiminyak atsirikenanga.Bahkanminyaknyasudah dieksporkePerancis,sebagaibahanbaku parfum. Proses penyulingan AwalnyaSukarhanyasebagaipemetik bungakenanga.Lantasseiringdengan perjalananwaktu,meningkatmenjadi pengumpuluntukkemudianmenjualke-


padayangmembutuhkan.Merasapunya kemampuanmengolahbungakenanga menjadiminyak,Sukarberusahamemproduksi minyak bunga kenanga. Untukkeperluanproduksi,Sukar menciptakanalat sendiri, yaitu denganmembeli plat eiyser, pakukelingdan bor tangan. Kemudiandibuat tangki kecil berkapasitas 150 kg bunga. Merasaproduksi

makinmeningkat,tangkipenampungan ditambahsatulagi,sehinggakapasitas menjadi300–500kgbunga.Daribahan baku500kginisetelahdisulingmenjadi6 kg minyak kenanga. Dengandibantu4karyawan, Sukar melakukan prosespenyulingandengan carayangmasihsederhana. Prosesnyatangkidiisiair sebanyak50%darivolume tangki,kemudiandididihkan. Sebaiknya bahan bakar yangdigunakanbonggol jagungdankayu,biayanya lebih murah. Setelah air mendidihbungadimasukkan laluditutuprapat,dengan kondisiapitetapmenyala selama 40 - 50 jam atau dua hari dua malam. Kemudianuapnyadisuling,dialirkanke pipa,didinginkankemudiantetesdemi tetes menjadi minyak kenanga. Sukarmulaimenyulingminyakkenangasejak1969.Dalamperjalanan,dilihat usahanyacukupSukarmendapatbantuanperalatandanpelatihanmanajemen dariPetrokimiaGresik.Bahkandiangkat menjadi“anakangkat”PetrokimiaGresik. Untukbantuanperalatansifatnyabantuan
Sukar (atas) dan bunga kenanga (bawah): Dapat sebagai bahan parfum


Gema Industri Kecil. Edisi XVIII/Juni 2007

Dari Sentra KeSentra

lunak dengan bunga 6% setahun. Selaindapatpembinaandari“bapak angkat”Sukarjugadapatpembinaandari , DepartemenPerindustrianpada1980, berupastudibandingkeBengkuludan beberapa daerah di Jawa Timur. Kiniusahanyaterusberkembang,dan bisamenghasilkanrata-rata5tonminyak kenangapertahunatausekitar40kgper bulan.Selainmengolahminyakkenanga, Sukarjugamemproduksiminyaknilam. Untukkeperluanbahanbakunya,dengan caramenanampohonnilamdisawah. Tapikarenahargaminyaknilamturundan pada2006laluterjadikemaraupanjang makasekarangtidakmemproduksiminyak nilam lagi. Butuh dana Untukmengembangkanusaha,Sukar butuhpenambahanmodal.Selamaini hanyamengandalkanmodalyangada, dandiputarterus.Modalsendiriyang dikeluarkansekitarRp50jutadanmasihmembutuhkantambahansekitarRp 50–Rp.60jutalagiuntukmemproduksi sekitar200kgminyakkenanga.“SekarangkatanyakreditdaribankuntukIKM sudahmudah.Tapikenyataannyamasih susahuntukmendapatkan,”paparnya sambilemosi.Kecualikalaupakaijaminan, barubisa.Itupuncairnyauanglamasekali sampai2bulanbelumturun,tambahnya. YangmenjadiharapanSukarsebagai pengusahaminyakatsirikenanga,adalah agar pemerintah dapat memproses sendiriproduklanjutandariminyakatsiri yang selama ini diekspor antara lain sebagaibahanbakuparfum.Kalaudi IndonesiabisamempunyaiSDMyangahli danmempunyaiteknologitinggiuntuk memproduksiproduklanjutanminyakatsiri, Indonesiaakanmemperolehnilaitambah yangsangattinggidanbisameningkatkan G WgF au . kesejahteraan masyarakat.

Industri Gerabah

keraMik Minahasa Menanti“sentuhan”
Minahasa ternyata punya potensi besar kerajinan gerabah/keramik. Sayang belum dikembangkan secara maksimal. Perlu perhatian serius dari semua pihak.


otensikerajinangerabah/keramikternyatatidakhanyamenjadidominasi daerah-daerahdiJawa,semisalKasongan(DIY),Melikan(JawaTengah), Dinoyo(Jatim),danPlered(Jabar)maupunBanyumulek(NTB),tetapi potensiitusekarangjugamulaitumbuhdidaerahlain.Sepertiyangsaatini sedang menggeliat di tanah Minahasa, Sulawesi Utara. Potensibesarsumberdayamanusiadansumberdayaalamyangadadi desaPulutan-Remboken,Minahasa,SulawesiUtarauntukkerajinangerabah dankeramikhiastentuperluterusuntukdikembangkan.Terdapatsekitar100 lebih Unit Usaha gerabah/keramik di sana. Sayangnya,perhatianpemerintahterhadappotensimereka,khususnya programpenguatanyangmenyeluruhdidesatersebut,masihbelummaksimal. Baru-baruinikondisiriilindustrikerajinangerabah/keramikdisanaditinjau oleh Komisi VI DPR-RI. Kerajinanyangdidapatmasyarakatsetempatsecaraturun-temuruninitermasuksangatlambatberkembang.Halinidikarenakanbeberapafaktorkendala,antaralaindesain/bentukgerabahyangadabelumbaik,masihsebatas

Perajin gerabah: Kerajinan secara turun temurun

Gema Industri Kecil. Edisi XVIII/Juni 2007

Dari Sentra KeSentra

seleralokaldiKabupatenMinahasaataupun Manado. Selainitu,kerajinangerabahbelum menjadiunggulanpenghidupan,terbuktidi antaramerekaterkadangmasihberkebun jikatidakadapesanan.Kemudian,pasar masih sangat terbatas untuk lokal, beberapapesananmemangadayang datangdariGorontaloataupunMakassar tetapi tidak kontinyu. Selanjutnya, infrastrukturyangadabelummemadai untukdapatdilintasitruk-trukbesaryang menghubungkankotapropinsi(Manado). Padahal,sepertidiketahuibahwa untukindustrigerabah/keramik,desain merupakanfaktoryangsangatmenentukan.Desainyangbaikakanmenentukan pasar,sehinggaGorontalo,SulawesiSelatan,dandaerah-daerahlaindapatme-

manfaatkankeunggulangerabah/keramik di Sulut tersebut. Bentuk-bentukdasaryangadamasih sebatasuntukbarang-barangkeperluan rumahtangga(houseware/terakota) dankebutuhantamanhias(pot-pot bunga), sedangkan pasar yang ada sudahjauhberkembanguntukkebutuhan kelengkapan/asesorisatauinteriorbaik untukrumahtinggal,hotel-hotel,restoran, dangedung-gedungperkantoranyang telahmengutamakankenyamananoptimal dantidaksebatasfungsitempatsemata. PeranaktifDinasPerindustriandan Perdagangansetempattentunyasangat diharapkanuntukbekerjasamadengan berbagaipihakterkait.Kerjasamayang

dimaksud,antaralainpengadaan”desainer”keramikdan”tenagaahli”pemasaran.Lebihlanjutdapatdikembangkan pulakerjasamadanpermintaanbantuan dengannegaralainsepertipemerintah Jepang(JICA)danKanadayangsudah ikutmengembangkankeramiktersebut sejak 1999. ProgrammagangkebeberapadaerahpotensialsepertiPlered(JawaBarat) danKasongan(Yogyakarta)jugamenjadi salahsatupilihantepatbagimerekayang benar-benarseriusuntukmengembangkankerajinangerabah/keramiksebagai G tumpuan hidupnya. Bambang Irt

Proses pembuatan gerabah dan produk gerabah: Desain sangat menentukan pasar


Gema Industri Kecil. Edisi XVIII/Juni 2007

Dari Sentra KeSentra


Unit Pelayanan Teknis (UPT) dibangun pada era “Proyek Bimbingan dan Pembinaan Industri Kecil” (BIPIK). Perannya adalah transfer pengetahuan dan teknologi kepada industri kecil, bantuan sarana produksi, bantuan sarana pelatihan, bantuan promosi dan pemasaran.


embinaan industri kecil dan menengah telah menempuh jalanpanjang,sepanjangsejarah keberadaanindustrikecilitusendiri.Ini menunjukkankepeduliandanperhatian pemerintahsaatitupadaperkembangan usahaindustriyangmemegangperan pentingdalamperekonomianlokal, regionalmaupunnasional.Sejakdulu, pembinaandiarahkankepadaexisting industriatauindustriyangsudahada,dan sedikityangditujukanbagitumbuhnya wirausaha baru. Era Probinkra dan BIPIK Berbagailembagaatauinstitusipernah dibentuk,kemudianbubardandibentuk lagilembagabaru,ProyekPembinaan KerajinanatauProbinkra.Saatituindustri kecildisebutsebagaikerajinan.Probinkra berhasilmengembangkanindustrikecildan kerajinan,bahkanmendirikansebuahunit usahayangcukupmonumentalseperti UnitPembinaanTeknis(UPT)pandebesi diSewulan,Madiun,kemudianUPTLogam ProbinkradiTegal.Tapisayangkesemuanya itutinggalpuing-puingberupabesituadan bangunan yang tidak terurus. LantaseraProbinkraberakhir,digantikan“ProyekBimbingandanPembinaan IndustriKecil(BIPIK)“diseluruhIndonesia yangdimulaiawalPelitatiga.DieraBIPIK inidibangunUnitPelayananTeknis(UPT)di sentra-sentraproduksi.Tidakkurangdari

146UPTdaribermacamkomoditipernah dibangunsaatituyangmengembanfungsi transferpengetahuandanteknologikepadaindustrikecil,bantuansaranaproduksi, bantuansaranapelatihan,bantuanpromosidanpemasaranyangkesemuanya terintegrasi didalam UPT. UPTyangmasihberjalanhinggasekaranginidiantaranyaUPTlogamdiTegal JawaTengah,UPTkayudiPasururanJawa Timur,danUPTprodukkulitdiCibaduyut JawaBarat.BanyakUPTyangtidakmampulagimenjalankanfungsinyakarena peralatandanmesinnyasudahketingga-

lanjaman.PeralatandanmesinmilikUPT kalahbersaingdenganmilikindustrikecil. DisisilainSDMpengelolanyabanyakyang beralihmenjadipegawainegeridanmenduduki jabatan struktural. Era LIK/PIK/SUIK Pada era BIPIK juga dibangun Lingkungan Industri Kecil (LIK), PerkampunganIndustriKecil(PIK)dan SaranaUsahaIndustriKecil(SUIK).MasingmasingLIK,PIKdanSUIKmenyediakan UnitPelayananTeknis.PadaeraBIPIK direkrutTenagaPenyuluhLapangan(TPL),

UPT Kerajinan Batu Aji, di Kuta Cane - Aceh Tenggara: Belum direnovasi


Gema Industri Kecil. Edisi XVIII/Juni 2007

Dari Sentra KeSentra Era kejayaan UPT dan TPL atau TPLS merupakan masa kejayaan industri kecil.
dimanatugasnyamemberikanpenyuluhan kepadaperusahaanindustrikecilyang bersifatumum,danTenagaPenyuluh LapanganSpesialisyangmemberikan penyuluhankepadaperusahaanindustri kecilyangbersifatspesifiksepertiTPLS bidanglogam,bidangkulit,bidangkayu dan sebagainya. Darisegiinstitusijugadikembangkan PusatPengembanganIndustriKecil (PPIK)di9wilayahutama,yangtugas danfungsinyaadalahmembinaindustri kecil.Sebagaiinstitusipembinaan,PPIK merupakanunitkerjatersendiridan mempunyaipengurus,sertasaranakerja sendiri.Pengembanganindustrikecil melaluiPPIKmenirumodelyangdilakukan diPhilipinakarenasaatitupembinaan industrikecildibantuolehUNIDOdengan menempatkantenagaahlidiIndonesia. Peran TPL/TPLS Untukpelaksanaanpembinaandi lapangan,direkrutTenagaPenyuluh Lapangan(TPL)danTenagaPenyuluh LapanganSpesialis(TPLS).Bagidaerah yangmempunyaiUPT,makabasiskerja TPL dan TPLS adalah di UPT. Model penggunaanTPLdanTPLSmiripdengan modelyangdilaksanakandiDepartemen Pertanian saat itu berupa Petugas PenyuluhLapangan(PPL)Pertanianyang tersebar di pedesaan. Koordinasipelaksanaanpembinaan industrikecilolehTPLdanTPLSdilakukan olehPPIKdi9wilayahutama,sedangkan diprovinsilainyangtidakmempunyaiPPIK dilakukanolehProyekBIPIKsetempat. KeberadaanUPTdisentradanTPL sertaTPLSsebagaiujungtombakpembinaanindustrikecildilapangan.Selama periodeini,industrikeciltumbuhdan berkembangsecarasignifikanhingga sepertisekarang.StatusTPLdanTPLS saatituadalahtenagahonorerkontrak yang diperbaharui setiap tahun. Sementara,pembinaanTPLdanTPLS diarahkankeduaopsi.Pertamabagiyang mempunyaikinerjabaikdanterdapat formasi, makadapatdiangkatmenjadipegawai negeri.Kedua,bagiyanginginmenjadi wirausahaataupengusaha,makapembinaan industrikecilmerupakanmasamagang yangmenyediakanwahanauntukmencari pengalaman,pengetahuandannetworking. Era kejayaan UPT dan TPL/TPLS merupakanmasakejayaanindustrikecil. Keberadaannyadidalamsistempembinaanyangtepat.Namunsayangmasa keemasanituberakhirdengansurutnya peranUPTsertahabisnyaTPL/TPLS.Hal inibisaterjadi,karenapadasaatjumlah pembinalapanganmulaihabisdiangkat menjadipegawainegeriatausebagian keluarmenjadipengusaha,tapitidakdibarengidenganrecruitmenttenagalapangan yang baru. Era PIKM SurutnyaperanUPT,karenalebih kepada misinya dalam transfer of technologykepadaindustrikeciltelah selesaidantidakadapembaharuanmesin, peralatansertaSDMpengelola.Setelah sekianlamaUPTtidakmempunyaiperan, seiringdengandatangnyaeraotonomi daerah(Otda)semuapengelolaanUPT diserahkankepadaPemda,untukdilakukan pembaharuanperalatandanmesinserta digunakansebagaisaranapembinaan karenasudahmenjaditugasdaerah. Apayangterjadikemudian,jauhdari harapan.BeberapaUPTyangkemudian direhabilitasiolehdaerahberfungsisebagiUnitPelaksanaTeknisDaerah(UPTD) yangsalahsatufungsinyaadalahsebagai salahsatusumberpendapatandaerah. SebagianUPTyanglaintetapmerana, peralatannyarusak,teknologinyaketinggalanjaman,danSDMpengelolanyarela38

tiftidakbisamengoperasikanperalatan danmesin.Bagaimanabisamemberikan pelayananpembinaankepadaindustri kecil.BahkanbeberapaUPTmalahmenjaditempat“pembuangan”bagipegawai yangtidaktertampungdikantordinas.Ini sungguh memprihatinkan. Melihatkondisisepertiini,pemerintah pusat mengambil kebijakan untuk merevitalisasiUPT,walaupunsebenarnya sudahbukanmenjaditugasdanfungsi pemerintahpusat.MenurutUndangUndangnomor32,fungsipemerintahpusat hanyadalampenyusunannorma,kriteria, standar,kebijakan,menyusunpedoman danmelakukanmonitoringsertaevaluasi. Revitalisasi UPT RevitalisasiUPTberartimeningkatkan fungsiUPTsebagaiunitpelayanankepada IKMdalambentukperbaikansaranafisik, pembaharuanperalatanataumesin, peningkatankemampuanpengelola agarmempunyaikompetensidibidang pelayanan,sertamelakukannetworking. UPTyangbisadirevitalisasiadalahyang mempunyaitujuandanrencanakedepan yangjelasbagipeningkatanIKMyangakan dilayani,mempunyaimanfaatteknissosial danekonomisyangjelaskhususnyabagi IKM,danumumnyabagiperekonmiandaerah.Usulannyajugaharusjelasbaiktentangjenis,spesifikasidanhargaperalatan (mesin)yangdi-minta,ketersediaandan kesiapanbangunanuntukmenempatkan peralatandanmesin,dayalistrik,akses menujulokasipenempatan,operator,ketersediaandankesiapanpersonilpengelola,sertatenagaadministrasi.Tingkat pendidikandanpengalamanbagipetugas UPT juga harus memadai. Selain itu, sistim pelayanan dan tarifsewajugaharusjelas.Begitupula soalketersediaandankesiapanbiaya operasional,biayapengadaanbahan

Gema Industri Kecil. Edisi XVIII/Juni 2007

Dari Sentra KeSentra

penolong,kejelasanpihakyangakan memanfaatkan,kejelasanpihakyang akanbertanggungjawabatasmesindan peralatan,rencanapemanfaaatanmesin danperalatandalamrangkapeningkatan efisiensi,produktifitassertapeningkatan mutu dan perluasan pasar. Dan tidak kalahpentingnyaadalahdukungandari Pemdadalambentukkomitmenpenuh untukmemberdayakanUPTsebagaiunit pelayanankepadaIKM,adanyasharebiaya revitalisasidariPemdamelaluiAPBDatau sumberlainuntukrenovasibangunan,biaya listrik,telepon,gaji(honor)pengelola. Terdapat66UPTyangdirevitalisasi, terdiridarilogamdanpermesinan18UPT, kayudanrotan24UPT,sandangdankulit 10UPT,kemasanakandibangun3UPT, sertakerajinan11UPT.Lingkupkegiatan revitalisasimeliputifasilitaspengetahuan kepada pengelola UPT tentang IKM (pasar,teknologi,keuangan),peningkatan kemampuanSDMpengelolaUPTuntuk mengenal lebih dalam kondisi dan karakteristikIKMyangdilayani,menguasai teknologiperalatandanprosesproduksi bagiIKMyangdilayani,sistemakuntansi perusahaanyangsesuaibagiIKMyang dilayani,penyusunanBisnisPlanUPT, pengembangannetworking,pengadaan mesinperalatandenganteknologilebih maju(alatproduksidanalatuji),pelatihan teknisuntukoperatorUPT,pelatihan pengelolaanUPT,pembuatanprototype mesinperalatan(R&Dsederhana)dan pendampingan tenaga ahli. Sharing peran Revitalisasi UPT dilakukan oleh PemerintahPusatdanPemerintahDaerah dengansharingPemdamenyediakan ataumeningkatkankualitasbangunan
Mesin UPT Tresobo -Sidoarjo: Sudah direnovasi

(bangunanUPT,saranadiklat,sarana promosi,kantor,dayalistrik,telepon, gudang,lahanparkirdll),memperbaharui peralatandanmesinUPT,menyediakan tenagapengelolayaitutenagateknis dantenagamanajemen/administrasi, meningkatkankualitasSDMdankualitas pelayanankepadaIKM,menyediakanbiaya operasionalUPT,melakukanpengelolaan UPTgunamelayaniIKMberdasarkan pedoman yang ada. SedangPemerintahPusat,menyusun norma,standar,pedomanpengelolaan UPTsebagaibahanacuanpengeloladalam memberikanpelayanankepadaIKM,memfasilitasipeningkatanpengetahuanpengelolaUPTtentangkarakteristikIKM,tentang pasarprodukIKM,tentangstakeholder yangdilayaniUPT,tentangpengetahuan teknologi,pengetahuankeuanganIKM,penyusunanBisnisPlanUPTsebagaiacuan pengembanganUPTkedepan,pengembangankemampuanSDMpengelolaUPT sertaSDMperusahaanIKMbaikpemilik

maupuntenagakerja,pengembangan networkingUPTdenganberbagaistakeholderyangterkaitsepertilembagauji yangkompeten,sumberteknologiterbaru, lembagakeuangan,lembagaresearchand development,menyediakanmesinperalatandenganteknologilebihmajuuntuk menggantiperalatandanmesinyangsudahrusak,memberikanpelatihanteknis untukoperatorgunameningkatkankemampuanmenjalankandanmenggunakan mesin/peralatan,memberikanpelatihan pengelolaanUPTagardapatmemberikan pelayananprimakepadaIKM,pembuatan prototypemesinperalatanyangdiperlukan olehIKM,pendampingantenagaahliguna memberikankonsultasikepadapengelola UPTmaupunIKMyangdilayaniyangakan dilakukan oleh konsultan IKM. Perkembanganrevitalisasihingga saatinidanberbagaipermasalahanyang dihadapiakandisajikandalamtulisanbagian kedua terbitan berikutnya. G


Gema Industri Kecil. Edisi XVIII/Juni 2007

Peluang usaha

IndustrI HIlIr CPO PrOsPeKtIf
alamRapatKerjaDepartemenPerindustrianyangdiselenggarakan pada17Januari2007,dipimpin olehWapresJusufKalla,salahsatukeputusannyaadalahmenetapkansepuluh industriprioritasuntuk2007,salahsatunyaadalahindustriminyakkelapasawit mentah (CPO). MenteriPerindustrian,MenteriPertanian,danMenteriPerdaganganmenyusun aturanpendukungpeningkatanproduksi CPO.Haliniberkaitandengantujuan pemerintahyangberniatuntukmengoptimalkan industri hilir kelapa sawit. Banyakhalyangharusdikoordinasikandenganinstansilain,sepertimengenaiketersediaanlahanuntukmenunjang kebutuhantambahanproduksiCPO,maupunperbaikanproduktifitasperkebunan.


Pemerintah menetapkan sepuluh industri prioritas untuk 2007, salah satunya adalah industri minyak kelapa sawit mentah (CPO). Pada industri hilir, sampai 2010 dibutuhkan tambahan pasokan sebesar 5 juta ton per tahun.
Padaindustrihilir,sampai2010membutuhkantambahanpasokanminyaksawit mentah(CPO)sebesar5jutatonpertahun untukmemenuhikebutuhandalamnegeri, termasukuntukkebutuhanpengembangan bahan bakar nabati (BBN). Hingga2010mendatang,diperkirakan kebutuhanpasokanCPOuntukindustri pangandalamnegeriakanmeningkat menjadi 10,5 juta ton dari 8 juta ton (2007).Peningkatanituuntukmemenuhi kebutuhanminyakgorengsekitar9,9 jutatondanprodukturunanCPOlainnya sepertimargarindanshorteningsebesar 750.000 ton. SedangkankebutuhanCPOuntukindustrinonpangansepertifattyacid,fatty alcoholdanglyserinmencapaisekitar 150ributonsertakebutuhanuntukBBN sebesar 2,01 juta ton. Untukmeningkatkanefisiensi,ke depanpengembanganperkebunankelapasawitharusbisaterintegrasi,tidak terpencar-pencarsepertisekarangini yangakhirnyamenimbulkanbiayatinggi. Disampingiturisetpengembanganharus lebihdiberdayakan,termasukuntukmeningkatkanproduktifitasperkebunankelapasawityangmasihrendahyaitu3,4juta tonperhadibandingkanMalaysiayang sudah mencapai 4,2 juta ton per ha. Diversifikasi industri hilir CPO MenteriPerindustrian,FahmiIdris menjelaskanbahwastrukturindustrihulu danhilirprodukCPOakandiperkuatsecarakeseluruhansebagaiupayauntuk meningkatkannilaitambah.Deperin telahmenyiapkansejumlahrencanaaksi antaralainmempromosikandiversifikasi produkhilirCPOdari17jenismenjadi30 jenis,mendorongpembangunanfasilitas pelabuhandantangkitimbundisejumlah sentraproduksi,mengembangkanaliansi strategisoleokimiadenganperusahaan multinasional (MNC). Kebijakan diversifikasi produk jugaperlulebihdidorong.Dalamhal inidiversifikasiminyaksawitmenjadi bahandasarutamayanglebihkhusus.

Industri CPO: Perlu membuat diversifikasi produk 40 Gema Industri Kecil. Edisi XVIII/Juni

Peluang usaha

Misalnyapembuatanasamlemakdengan spesifikasikhususuntukpembuatan minyakpelumas(lubricant),tinta,fluxing agent,pembuatanbiosurfuktandari minyakdenganbantuanmikroorganisme, pembuatanprodukmonogliserida,etil alkohol,asamlemakamida,alkylresin, plasticizer, dan lain-lain. Kebijakanpengembanganindustrihilir minyaksawitdengannilaitambahlebih tinggijugaperlusegeradirealisasikan untukmenghadapikompetisidariindustri CPOnegaralaindanindustriminyak/lemak asalkedelai,jagung,kelapadanlain-lain. Misalnyaindustrihiliryangmenghasilkan produkshortenings,minyaksalad,betakaroten,vitaminE,vegetableghee,cocoa buttersubstitute(CBS)ataucocoabutter equivalent(CBE),minyaktermodifikasi dan produk oleokimia. Ditinjaudariprospeknyaindustriyang mungkinbisadikembangkandiIndonesia untukskalamenengahadalahindustri minyaksalad,industrietil-alkoholdanindustri CBS dan CBE. Permintaanprodukolekimiadan derivat-derivatnyamengalamipeningkatan, terutamadaribeberapanegaraimportir sepertiAmerikaSerikat,UniEropa,Uni Sovyet,Jepang,Koreadannegara-negara TimurTengah.Untukproduk-produk derivatoleokimiayangperludikembangkan industrinyaadalahindustripembuatan aminaethoksilat,aminaazelat,asam undeklonat,ammoniumkuartenerkhlorida, alkohollemaksulfat,etherfosfat,alkilresin, dan fatty acid alkanol amides. DiMalaysiatelahterjalinhubungan bisnisdengannegarakonsumenprodukprodukhilirsawitsepertiInggrisJerman, Perancis,Belanda,Belgia,Italia,Jepang, KoreaSelatan,Cina,India,Taiwan,dan Australia.Polakerjasamaantaraprodusendankonsumentersebuttelahmemacuperkembanganindustrihilirsawitdi G Wagu F Malaysia.

Jenis inDustri, Perkiraan investasi Dan Pertumbuhan nilai inDustri hilir berbasiskan minyak sawit
No Produk Bahan baku Tingkat Teknologi Menengah Tinggi Tinggi Tinggi Sederhana Sederhana Perkiraan Investasi Rp300-700 M Rp300-700 M Rp200-500 M Pertambahan Nilai 20% 50% 150%

1. 2. 3. 4. 5. 6. 7.

Olein dan stearin Asam-asam lemak Ester Sabun mandi Lilin Kosmetik (lotion cream), shampo

CPO CPO, PKO, katalis Palmitat, miristat tol, gliserol CPO, PKO, NaOH pewarna, parfum Stearat

Surfaktan, emulsifier Stearat, oleat, sorbi Rp250-700 M 200% Mulai dari 1 M 300% Mulai dari 1 M 300% 600%

Surfaktan, ester amida Sederhana Rp 10-200 M

Sumber: Poeloengan et al (2000)

Gema Industri Kecil. Edisi XVIII/Juni

Peluang usaha


Tanaman obat: Masyarakat mulai beralih pada pengobatan herbal

seBAGAI MInuMAn KeseHAtAn MOdern
eberadaanjamutradisionalsudah tidakasingbagimasyarakatkita. Sejakzamandahulu,nenekmoyang kitatelahmengkonsumsijamutradisional untuk menjaga kesehatan ataupun mengobatipenyakit.Dewasaini,dengan kesadaranbacktonature(kembalike alam),konsumsijamutradisionalyang berbahanbakualamisemakinmeningkat tajam.

Negara kita dikenal sebagai gudangnya bahan baku jamu tradisional. Faktor keunggulan ini tentu harus dimanfaatkan secara maksimal oleh para pengusaha jamu kita untuk dapat memenangkan pasar, baik lokal maupun internasional.


Ketersediaan bahan baku untuk pembuatanjamutradisionaldiIndonesia cukupmelimpah.HasilrisetLIPImenyebutkan,Indonesiamemiliki30.000spesies tanamanobatdaritotal40.000spesies yangadadiseluruhdunia.Negarakitabaru memanfaatkansekitar180spesiesdari950 spesiesbahanbakualamiyangberkhasiat sebagaiobat.Faktainimengungkapkan bahwadarisegiketersediaanbahanbaku,
42 Gema Industri Kecil. Edisi XVIII/Juni

industrijamutradisionaltidakmemiliki ketergantungan impor. Bahanbakupembuatanjamutradisionaldisebutsebagaisimplisia.Simplisiayangdigunakanadalahdalam bentukkeringsehinggatidakdiperlukan prosespencuciandanpengeringanlagi. Prosespengeringanpundilakukanoleh pemasokbahanbaku.Jenisbahanbaku yangdigunakan untukpembuatanjamu

Peluang usaha

tradisionalantaralainkapulaga,jahe, kencur,kunyit,laos,temulawak,sambiloto, puyang,kedawung,daunsirih,tapal liman,kayumanis,adas,kayusecang, pulosari,ginseng,delima,kayurapat,jati belanda,ladahitam,cabejawa,pinang dan brotowali. Kualitasbahanbaku/simplisiaakan sangatmenentukankualitasjamuyang dihasilkan.Olehkarenaitupemilihan bahanbakuyangberkualitasbaiksangat pentinguntukdiperhatikan,dantidak hanyasematadidasarkanatashargayang murah.Secaraumumkualitassimplisia yangbaikdilihatdaritingkatkebersihan, kekeringan, warna, ketebalan, dan keseragaman ukurannya. Selain untuk konsumsi nasional, jamutradisionaljugaberpotensiuntuk diekspor.Negaratujuanekspor,menurutdataGabunganPengusahaJamudan ObatbahanalamIndonesia(GPJamu), yaituMalaysia,KoreaSelatan,Filipina, Vietnam,Hongkong,Taiwan,AfrikaSelatan,Nigeria,ArabSaudi,TimurTengah, RusiadanChile.Eksporjamutradisional tersebutsebagianbesarmasihdilakukan olehindustrijamuyangcukupbesar. Untukmemproduksijamutradisional dibutuhkanmesin/peralatanproduksi antara lain mesin penggiling, mesin penyaring,timbanganbesar,timbangan duduk,alatpengepres,alatpengukur kadarair,tampah,rakbesar,danlainnya. Proses Produksi Prosesproduksiyangdilakukanpada industrijamutradisionalmasihmenggunakanteknologiyangrelatifsederhana/ tradisional,danbiasanyaprodukyang dihasilkandalambentukserbuk.Secara umumprosesproduksi(jamubentukserbuk)meliputitahapansebagaiberikut: Tahappertama,persiapanbahan baku.Bahanbakubiasanyadatangdari pemasokdalambentukkering.Bahan

bakusebelumdibeliharusdiadakan pengambilansampel,jikakualitasnya cocok baru diadakan pembelian. Tahapkedua,sortasibahanbaku. Yaknimemisahkanbahanbakuyangbaik denganyangtidakbaikyangterlihatsecarafisik,misalnyadaunyangsudah layu. Sortasijugadilakukanuntukmemisahkanbendaasingyangmungkinterdapat dalambahanbakutersebut,misalnyakotoran atau tanah. Tahapketiga,pengukurankadarair. MenurutaturanBadanPengawasObat danMakanan(BPOM),setiapindustrijamu harusmemilikialatlaboratorium,minimal alatuntukmengukurkadarairbahan bakujamu.Sebaiknyasimplisiakering yangakandigunakanuntukpembuatan jamumemilikikadarairmaksimal11%. Jikaternyatakadarairsimplisiatersebut di atas 11% maka dilakukan proses pengeringan/penjemuran. Tahapkeempat,penimbangan.Penimbanganbahanbakusesuaikebutuhan, denganmenggunakantimbanganduduk. Tahapkelima,penggilingansimplisiamenjadiserbuk.Simplisiayangtelah ditimbanglaludigilingdenganmenggunakanmesinpenggilingyangdigerakkan olehmesinpenggerak.Sebaiknyajenis atauukuranpisaupadamesinpenggiling yangdigunakanuntukmenggilingdaun danrimpangberbeda.Pisaupadamesin penggilingharusselaludigantisetiap3

bulanuntukmenjaminhasilgilinganselalu dalam ukuran yang seharusnya. Tahapkeenam,Penyaringan/pengayakandengansaringan120mesh.Proses penyaringandilakukanuntukmenghasilkan serbukdenganukuranyanghalusdan seragam.Dariproses penyaringanini, padaumumnyaserbukyangtidaklolos adalah sekitar 15 - 20 %. Tahapketujuh,peramuan/pencampuran sesuaikomposisiyangdiinginkan.Serbuk jamuyangtelahdisaringkemudiandiramu dengan jumlah dan komposisi yang disesuaikan.Tahapkedelapan,pengukuran kadarairserbukjamu.Sebelumdikemas, dilakukanpengukurankadarairserbukjamu untukmenjamintingkatkekeringanserbuk tersebut.Kualitasserbukyangbaikadalah yangmemilikikadarairtidaklebihdari5%. Tahapkesembilan,pengemasan dalambentuksachetdanpak.Serbuk jamudimasukkandenganukuranratarata7-8gramkedalamkemasansachet kemudiandipresdenganalatpengepres dandilakukansecaramanual.Setiap10 sachetdipakdalamkemasanplastik. Beberapapakjamudikemaslagidalam plastikbeningdenganukuranbesar.Terdapatbeberapajenisserbukjamuyang tidakdikemasdalambentuksachet,tetapi dikemassecarakiloandengankemasan plastik yang lebih besar. Tahapkesepuluh,penyimpanan produkjadisebelumdijual.Jamuyang

Jalur PemasaraN PrOduk Jamu TradisiONal
Pengepul/ Pengumpul Pengusaha agen penjualan/ Pedagang Pengumpul/Pengecer

konsumen langsung
Gema Industri Kecil. Edisi XVIII/Juni

Peluang usaha Yang harus dilakukan pengusaha jamu adalah meningkatkan mutu, kemasan, serta bahan baku yang berkualitas.
dilaksanakan,peningkatanomzet/volume produksi,pengembanganusaha,serta publikasiyangjelasdanmenambah pelanggan. Peluang pasar DiIndonesia,industrijamumemiliki asosiasiyangdiakuipemerintahsebagai asosiasibagipengusahajamudanobat bahanalamdiIndonesiayaituGabungan PengusahaJamudanObatbahanalamIndonesia(GPJamu).AnggotaGPJamuterdiridariprodusen,penyalurdanpengecer. HinggasaatiniGPJamumenghimpun908 anggota,yangterdiridari75unitindustri besar(IndustriObatbahanalam/IOT)dan 833industrikecil (IndustriKecilObatbahan alam/IKOT). Denganasetjumlahunityangcukup banyakjumlahnyadandenganlokasiyang menyebar,usahajamutradisionalmempunyaiperanyangcukupstrategisdalam menopangperekonomiannasionalpada umumnyadanmasyarakatsetempatpada khususnya.Untukmasayangakandatang diharapkandapatmenjadisalahsatuaset wisata andalan Indonesia. Untuk dapat memenangkan per saingan,setiappengusahaharuscukup kreatifdanmempunyaistrategidalammeningkatkankualitasprodukdanmeningkatkanpenjualan.Strategiusahayangdapat dilakukanadalahsenantiasamelakukan peningkatankualitas/mutujamu,kualitas kemasan,danmencaribahanbakuyang murah dan berkualitas baik. Selain itu untuk perluasan pasar, sebaiknyamelakukanpromosiyanggencar sepertipengadaanbonus,potonganharga, kemudahanpembayaran,iklandimedia cetakmaupunelektronik,sertayangpaling pentingadalahmembangunloyalitasdan komitmenpadakonsumen.Haliniperlu dilakukanmengingatpersainganyangada saat ini cukup ketat dan berat. G

Bahan baku obat & produk akhir: Harus kreatif dan inovatif

siapdijualdisimpanterlebihdahuludalam rak-rakbesarsecarateratur.Gudang penyimpananjamuharuskeringdantidaklembabsehinggatidakmenurunkan kualitasjamuyangtelahdihasilkan.Rakrakpenyimpanantidakbolehmenempel padadinding,tetapiharusadasedikit jaraksehinggajamutersebuttidakmenjadi lembab. Tahapkesebelas,distribusiproduk jadipadakonsumen.Tahapinimerupakanprosespenyampaianprodukdari produsenkekonsumen.Padatahapini punharusdiperhatikanaspekhigienis

danpengaturanpeletakannya,baikpada saatpengangkutanmaupunpenyimpanan di kios / di toko. Jalur Pemasaran Produksi Produkjamudijualmelaluiagenpenjualan,pedagangpengumpul,ataupun langsungdijualkekonsumen.Pengusaha jamupadaumumnyamelakukankemitraan denganpengepuldanagenpenjualan, jeniskemitraaniniberbentukdagang umum.Manfaatyangdidapatdariadanya kemitraaniniadalahadanyakemudahan prosespenjualankarenasudahrutin
44 Gema Industri Kecil. Edisi XVIII/Juni

Peluang usaha

Pesantren Ummusshabri.: Melatih dan membina santri mandiri


MeMBAnGun KeMAndIrIAn PesAntren lewAt KOPerAsI
ama Pondok Pesantern Ummusshabriyangdiresmikan olehMenteriAgamaRIProf.Dr.H. A.MuktiAlipada9Januari1974,memiliki maknayangmulia“puncakkesabaran” atau“kesabaranyangtinggi”.Pesantren yangterletakdipusatkotaDesaBende, KecamatanKadia,KotaKendari,Sulawesi Tenggarainiberadadibawahpembinaan GabunganUsahaPerbaikanPendidikan Islam(GUPPI).DenganpendiriMayor


Pesantren ummusshabri selain sebagai sarana belajar juga menjalankan aktivitas bisnis. Bisnis yang dijalankan seperti budidaya perikanan air tawar, usaha pertokoan, jasa dan industri kecil menengah.
JenderalEddySabhara(Almarhum), MukhtarumSH,KHBaedhawie(Almarhum) mantanKa.KanwilDepartemenAgama SulawesiTenggara, Drs. H. Abdullah Silandoe(Almarhum),Brigjen.H.Madjid Joenoes(Almarhum),H.A.KarimAburaera SH,Drs.H.DjalateP,Drs.H.A.ZainulArifin, P.Rafiuddin(Almarhum),NurdinDaeng Magassing,Drs.H.AbdulRahiemMunier (Almarhum),H.Muh.Amin(Almarhum) danIr.Muh.Saleh.Sejakberdirihingga
Gema Industri Kecil. Edisi XVIII/Juni

sekarangpemimpinpesantrendipegang oleh Drs. Baso Suamir Pesantrenyangberdiridiataslahan72 hektarini,memilikiprasarandansarana yangcukupmemadai.Lahanyanguntuk bangunansaranada’wahdanpendidikan sekitar6.500M2,terdiriruangbelajar25 lokal,masjiddan76kamarhunianuntuk asramasantriputradanputri.Sebagian lahan lagi dikelola untuk keperluan berbagaiusahabisnispesantrenseperti

Peluang usaha

Dirjen IKM Deperin, Sakri Widhianto: Memberikan pengarahan kepada peserta pelatihan kerja di Koperasi Pesantren Ummussabhri

usahabudidayaperikananairtawar, usahapertokoan,jasadanindustrikecil menengah. Jenjang pendidikan Jenjangpendidikanformaldipesantren inimeliputijenjangpendidikanTaman Kanak-kanak(RoudlotulAthfal),Madrasah Ibtidaiyah,MadrasahTsanawiyahdan MadrasahAliyah.UntukjenjangPerguruan Tinggi masih dalam persiapan. Saatinipesantren Ummusshabri memiliki829orangsantri,denganjumlah pengasuh(ustadz)sebanyak83orang. Daricatatandataalumnipesantren, sebgaianbesarparaalumnuspesantren sudahmenempatiposisijabatanPNS sertadijajaranTNI,bahkanadayang telahmencapaijenjangpendidikantingkat sarjana S2 maupun S3. Pendidikannonformalataukhusus kepesantrenanyangdilaksanakandiluar jam belajar seperti sore, malam dan pagi(subuh)inimeliputipendalaman kitabklasik(kuning),TahfidzdanQiroatul

Qur’an, Takhasus bahasa Arab dan Inggris,keterampilanT.I,olahragadan kegiatanlatihanbermasyarakat(bhakti sosial) kegiatan bisnis PesantrenUmmusshabrimempunyai berbagaiusahaekonomiyangsudah cukupmapan,dikelolaolehsebuahunit

Pengolahan VCO yang masih dilakukan secara manual, menjadi kendala terhadap pasokan atas permintaan yang terus meningkat.
46 Gema Industri Kecil. Edisi XVIII/Juni

usahakoperasiyangdidirikansejak1995, ”KoperasiBustanilArifin”,denganketua Drs.PairinMA.Bisnisyangdikelolameliputi UsahaSimpanPinjam,WarungSerba Ada(Waserda),WarungTelekomunikasi (Wartel), Jasa Foto Copy dan usaha industripengolahan.Industripengolahan berskalakecildanmenengahberhasil dikembangkandenganmemproduksi berbagaijenisprodukantaralain;Virgin CoconutOil(VCO),SabunMandi,Minyak Gorengdanmakanan/minumanolahan AnekaSirup,NatadeCoco,SaosTomat/ Cabe dan lain-lain. Untukusahaindustripengolahan inipesantrentelahmenginvestasikan dananyasekitarRp500juta.Koperasi inijugamembinapengusaha/perajin.Kini telahberhasildibina10orangperajin untukmembuatproduksejenisdiluar lingkunganpesantren.Untukkoperasi sendirimempekerjakansebanyak19 orang sebagai tenaga operasional. Masalahpemasaran,selainuntuk memenuhikebutuhanlokaldandalam negeri,khususuntukprodukVCOtengah dirintiseksporkeKorea.ProdukVCO sangatprospektifdankecenderungannya terusmeningkatdaritahunketahun denganomzetproduksiratarata300 botoldengannilaiRp15jutapada2004. Pada2005meningkatmenjadi500botol atau senilai Rp 25 juta. Tahun 2006 meningkatlagimencapai1.500botolatau senilai Rp 60 juta. bantuan mesin dan peralatan. PengolahanVCOyangmasihdilakukan secaramanual,menjadikendalaterhadap pasokanataspermintaanyangterus meningkat.DepartemenPerindustrian CqDirektoratJenderalIndustriKecildan Menengahmengalokasikanbantuan dalamrangkamemenuhikebutuhan tersebut. Tahun 2006 Pesantren Ummusshabrimemperolehbantuan

Peluang usaha

mesindanperalatanVCOyangterdiri dariPengepres,Pemarut,Sentrifius, Vacuum dan Filter Press, serta peralatan produksi Nata de Coco ditambahdenganalatPressCupdan Mesin Potong otomatis. Kedepan,pesantreninimemprogramkanpendirianusahaindustripengolahanbersifatterpadudenganindustri yangsudahadasepertimembangun unitusahapengolahantepungampas kelapa, sabut kelapa (coco sheet dan coco fibre), arang briket dan

asapcair.DepartemenAgamaRIjuga pernahmengucurkanbantuanberupa uang sebesar Rp 20 juta, pada 2005. BegitupulaKementerianKoperasidan UKMpernahmemberibantuanuntuk pembangunansarana,peralatandan modalkerjakoperasisebesarRp150 juta pada akhir 2006. KhususpengembanganprodukVCO, Koperasi”BustanulArifin”akanmenjalin kerjasamadenganImprovementInstitute dan UD Sumber Rezeki dari Jakarta maupundenganAsosiasiProdusenKelapa

Olahan(APKO)SulawesiTenggaradengan targetmemenuhipermintaaneksporVCO keKoreadanPolandiasebanyak30ton setiap bulan. Kini Koperasi ”Bustanil Arifin” dibawahnaunganPondokPesantren Ummusshabri,merupakansalahkoperasi diIndonesiayangmemilikikinerjacukup bagus.Fungsipesantrenyangselain sebagaisalahsatulembagapendidikan dan da’wah Islamiyah, juga sebagai agenpembaharumasyarakatkhususnya G di sekitar koperasi. Boedi Sawitri

Proses produksi: Kedepan produksi pesantren Ummusshabri bersifat terpadu


Gema Industri Kecil. Edisi XVIII/Juni

Peluang usaha




Pohon bambu di sekitar kita sangat melimpah. aneka jenis produk anyaman, baik untuk peralatan rumah tangga maupun mebel, pun dapat dibuatnya. Tapi bagaimana caranya agar produk-produk bambu tetap bernilai seni tinggi dan diminati pasar?
jual yang tinggi. Perlu diawetkan Untukmendapatkankualitasproduk kerajinanbambuyangbagus,makabambuperludiawetkan.Pengawetanbambu dikerjakandengancaramenghilangkan cairancelldanataumemasukkanobat/ racunkedalambambu.Pengawetanada duamacam,yaitusecaraalamidansecara kimiawi. Bambudapatdiawetkandengan menghilangkangetah/minyakbambuuntukmenambahdayalenting/lentur,agar jikadiiratataudianyamtidakmudapatah. Disampingitusupayabambutidakmudah dimakan bubuk/insekta. Secaraalamipengawetandapatdilakukandengancaraperendaman,dianginkan,pendiangandancaraperebusan. Pengawetanbahananyamansecara kimiawi,biasanyadilakukanpadabambu yangsudahmenjadiiratanmaupunpada produk-produkanyaman.Carainiada5 macam,yaitu:(a)denganbahansulfat tembagaatauprusi,(b)denganbahan hidroksinatriumataukostiksoda,(c)denganbahankarbonatnatriumatausoda abu,dan(d)denganwolsfatataupijar. Pemutihanbambudapatdilakukan dengan cara perebusan dan cara pengasapan dengan gas belerang dioksida,jugadapatdilakukandengancara perendamandalamlarutanpengelantang. Perlu pewarnaan Selainitu,bahananyamanbambu perlu dilakukan proses pewarnaan. Pewarnaaninidapatdilakukanbaiksecaraalamimaupunkimiawi.Pewarnaan secaraalamidapatmenggunakanbahan pewarnaalamiah,sepertidaunjatimuda, daunjarak,kulitpohondanlumpur.Sedangkanpewarnaansecarakimiawi dapatdilakukandengancaramerendam denganzatwarnaasam,zatwarnabasisdanzatwarnalangsung.Pewarnaan jugadapatdilakukandenganmengecat atau dengan vernis.G Faras

ndustrikerajinannasionalIndonesiayangmerupakanterbesardiAsia Tenggaramempunyaiprospeksangat cerah,baikdipasarnasionalmaupuninternasional.Salahsatunyaadalahindustri kerajinan anyaman bambu. Saatiniindustrikerajinananyaman bambumengalamikemajuanyangcukup pesat,sesuaidengankemajuanteknologi danpenciptaandesain-desainbaruyang banyakdiminatiolehpasarlokalmaupun mancanegara. Ditinjaudariaspeknilaiseni/artistik, produkkerajinanbambuIndonesiatidak kalahdenganprodukdarinegaralain. Akantetapibiladitinjaudariaspekbahan baku,seringkalibelumsesuaistandar yang diharapkan. Masihbanyakkeluhan/komplainyang seringkitadengarterhadapprodukproduk kerajinan kita dari para konsumen/buyerasing.Komplainitubiasanyaseputarbarangmudahrusak,warna mudah pudar dan sebagainya. Nah,berikutinidipaparkanbeberapa caramembuatprodukanyamanbambu agartetapberkualitas,bernilaisenidan
nilai eksPOr “hanDiCraFt” 2006 (dalam juta dollar AS)

- Kayu, bambu, rotan, dan sejenisnya - Logam - Batu dan Keramik - Tekstil - Aneka (kulit, mutiara, dll)
Sumber: ASPHI, diolah BPS

212,04 98,25 15,96 7,13

Produk anyaman bambu: Pasarnya makin prospektif


Gema Industri Kecil. Edisi XVIII/Juni


Peluang usaha

JenIs-JenIs BAMBu
ambutermasuksukurumput-rumputan (gramineae).Diperkirakanterdapat600700jenisbambudidunia.Diantarajumlah itusebagianterdapatdiIndonesia.Beberapa yang terdapat di Indonesia adalah: 1. Bambutali/apus(cigantochoaapus). Banyakdigunakanuntukanyamandan alat-alatrumahtangga.Bambutersebut mempunyaikekuatan,keawetandandaya lenturyangtinggi,sehinggacocokuntuk bahananyamandankerajinananyaman. 2. Bambuhitam(wulung).Dapatdigunakan sebagaibahananyaman,tetapihanya padakulitnyasaja.Bambuwulungkurang liatdankurangkuat,dayalenturnya kurang,tetapiukurannya(batangnya) lebih besar. 3. Bambubetung(dandrocalamusasper). Bambuinitidakdigunakanuntukanyaman,karenatidakbisadiirat.Jenisbambuiniukurannyabesar,sehinggacocok untuktiang-tiangrumah,danuntukjembatan darurat. 4. Bambu duri (bambusespinosa). Jenisbambuinibanyakdurinya,sehingga seringuntukpertahanansuatukampung. Padaumumnyaberdindingtebaldancocokuntukbahanpembuatankertas.Rebungnya dapat untuk sayur. 5. Bambuampel(bambusavulgaris).Jenis initidakdapatdigunakanuntukanyaman maupunkerajinanlain,melainkanhanya untuktanamanbatas-bataspekarangan danuntukpagarsaja,karenalekaslapuk dan mudah terserang insekta. 6. Bambututul.Disebuttutulkarenapada kulitnyaterdapattutul-tutul,hitam,coklat tua,danwarnadasarnyakuningsehing49


gabaikuntukhiasanruangan.Tidak bisauntukanyaman,karenakerasdan bagian dindingnya terbatas. 7. Bambugading.Jenisinihampirsama denganbambututul,bedanyahanya diwarnakulit.Bambugadingtidakada tutuldankulitnyalebihmengkilat.Sifat bambugadingyaitukerasdandindingnyatipis,makatidakdapatuntukbahan anyaman. 8. Bambucendani(cina).Jenisinitidak dapatdibuatuntukbahananyaman, karenabatangnyakecil,dagingnyapadatdankeras,tetapiruasnyapanjangpanjang.Sifatbambucendaniyaitu keras,bagiandagingnyatebaldanulet atautidakmudahpecah.Banyakdigunakanuntukhiasan,tangkailembing dan tangkai sapu lantai. 9. Bambuwuluh.Jenisinihampirsama denganbambucendani,tidakdapat untukbahananyaman.Sifatbambuini yaitubatangnyakecil,keras,mudah pecah,padabagiandindingtipis-tipis. Bambuinibanyakdigunakanuntuk seruling,mainananak-anakdanuntuk hiasan-hiasan. 10.Bambumahoni.Jenisbambuinitermasukjenisterkecil,biasanyahanya untukhiasandanbanyakditanamdi halamanrumah.Bambutersebuthanya memperindahhalaman,tidakuntukbahananyaman,karenabatangnyatidak dapatbesar,liatdanlunak,ruasnya pendekdanbagiandindingnyatipis. Bambuinijugatidakbisatinggiseperti bambu yang lain.

Gema Industri Kecil. Edisi XVIII/Juni

ProfilPengusaha rofil Pengusaha


Kerajinan anyaman akar keladi air yang kini menjadi produk unggulan Pontianak ternyata tak lepas dari sentuhan tangan Rachmidar. Dialah yang mempopulerkan produk kerajinan tersebut.
iPontianak,KalimantanBarat,jenis anyamanakarkeladiairmerupakanprodukunggulanselainrotan. Produkanyamanakarkeladiairinitidak adaduanyadidaerahlain.Teksturnya yanglembutdantidakmudahpatahmenjadikanprodukinisangatdisukaipara konsumen. AdalahRachmidaryangmenjadi-


kankerajinananyamanakarkeladiair berkembangsepertisekaranghinggadiminatimasyarakatPontianak.Akarkeladi airyangbanyakterdapatdihutan-hutan Kalimantanternyatabisadikembangkan menjadiprodukanyamanmenarikyang bisadijualsebagaicenderamatamaupun kebutuhan rumah tangga. Rachmidarmengakudalamsebulan

bisa memproduksi lebih dari 10.000 buah.Hargayangditawarkanbervariasi, mulai dari Rp 25 ribu hingga Rp 200 ribuperbuah.Hargainiakanmengalami peningkatansaatdijualdiMalaysia.Adapun produkyangdiminatikonsumenadalah tempat parcel, topi dan keranjang. Keberhasilan yang telah diraih Rachmidartaklepasdaricampurtangan

Gema Industri Kecil. Edisi XVIII/Juni 2007

Profil Pengusaha

pemerintahdaerahsetempat.Karenamelaluibimbingandanpembinaanyangdilakukanolehdinasterkait,terutamaDinas PerindustriandanPerdagangan,menjadikanproduknyadikenalbanyakorang,lantaranseringdiikutsertakandalamacara pameran-pameran,baikyangdigelardi daerah maupun di Jakarta. Selainperanpemerintah,keberhasilan Rachmidartakbisadilepaskandariperan seorangibubernamaJamilon,sebagai orangyangpertamakalimengenalkan kerajinan anyaman akar keladi air di Pontianak pada tahun 1980-an. NamunkarenaJamilonpindahdaerah dantidakmengembangkannyalagi, akhirnya Rachmidar terketuk untuk mengembangkannya hingga kini. SebelumRachmidarhadirmemberikanwarnaanyamanakarkeladiair,keberadaananyamandiPontianakmasih sangattradisional.Pemasarannyapun jugaberkisardidaerahsendiri,belum sampaikeluardaerahapalagikemancanegara. Korban perang suku Rachmidaradalahkorbanperang sukuantarasukuDayakdanMadurayang terjadiparatahun1999.Wanitayang bersuamikanorangMadurainiterpaksa kalangkabutmencaritempatberlindung dariseranganorangdayak.Hinggapada akhirnya,iabersamasuaminyaberhasil selamat dan tinggal di Pontianak. DiPontianakiabersamakeluarganya mengadunasib.Berbagaiupayauntuk bisatetaphidupterusdilakukan.Mulai menjualmakanan,kuehinggamenjual hasilanyamankaryanyasendiri,berupa akar keladi air. Keterampilanmenganyamakarkeladi airdidapatdaritetangganyayangbisa menganyam.IapunbelajarkepadabeberapaorangyangadadiTanjungHuluPontianak.“Sayabelajartanpamaludanmin51

dermeskihanyamenganyam,”katanya. Denganketekunandankeyakinannya dalam menggeluti usaha kerajinan anyaman,iaakhirnyadapatberhasil danbangkitdarikesedihanyangselama inimenderanya.Beberapabulanbelajar menganyam,iaberhasilmembuatkarya sendiri.Saat ituhanyabisamembuat 5buah,itupunukurannyakecil.Berbekal 5 buah anyaman inilah Rachmidar menjajakankaryanyadipasarsetempat. Rachmidartakputusasa.Meskipunia tergolongorangpendatangdidesatersebut,iatetapnekaddanyakindagangannyaakanterjual.Dengannadanelangsaia menawarkankebeberapapembelidipasar meskiusahaituternyatatidakmudah. Namundenganpenuhkeyakinandan optimisbarangdaganganyaakanterjual, akhirnyawaktuyangdinantinyatiba, dagangannyalakuRp125ribu.“Saya dengannadamenangismenjualanyaman sayahanyauntukmembeliberasuntuk makan sehari-hari,” kisahnya. Barangpunterjual,hatimenjadigembirakarenahariituiabisamembelibeberapa kebutuhanuntukmenyambunghidupnya.Ia punkembalibelajarmenganyam.Kaliiniia belajaranyamanyanglebihbesarlagiagar hasil penjualannya lebih besar. UsahayangdilakukanRachmidar taksia-sia.Perjuangannyauntukbisa hidupdariketerpurukanakibatperang etnisDayak-Maduramulaiterbayar.Ketikamenjajakandagangannya,iabertemu dengansalahseorangpegawaiUKMdari pemerintahansetempat.Laludarihasil pertemuanitu,dirinyadikenalkandengan pegawaibagianPerindustriansetempat. Gayungpunbersambut,pertemuan demipertemuanakhirnyamengantarkan dirinyabisabertemudenganparapedagangdariMalaysia.Darisitulah,iamulai mendapatkanordermenganyam,dania punharusmengangkatkaryawansebanyak3oranguntukmembantumemper-

Rachmidar: Mempopulerkan anyaman keladi air

cepat pekerjaannya. Melaluipertemuandenganpara pedagangdariMalaysia,dirinyamulai mengenalpartnerbisnisnyasecaralebih luas.BiasanyaparapedagangMalaysia melakukantransaksijualbelididaerah perbatasanMalaysiadanIndonesia, tepatnyadiEntikong.DisinilahbarangbarangdariIndonesia,khususnyadari Kalimantandijualkepedagangpengumpul dari Malaysia. Seiringdenganperkembangannya, usahaanyamanRachmidarkianberkembang.Tenagakerjayanghanya3orang akhirnyabertambahmenjadi20orang. Haliniuntukmemenuhitargetpemesanan ataupembeliandaribuyerMalaysia.Karenapermintaanbarangterusmeningkat, membuatRachmidarberuntungbesar, dalamwaktuseminggudirinyabisamengantongi untung hingga Rp 5 juta. Takheran,jikadarihasilusahanyaini iabisamembelirumahdanmenempatinya bersamakeluarganyasertamembeli6 ruko.“Sayabersyukurusahayangsaya lakukanselamainitaksia-sia,memang semuaperluperjuangan,”ujarnyadengan G Yuana mata berbinar-binar.

Gema Industri Kecil. Edisi XVIII/Juni 2007

Profil Pengusaha

UtamaKan Kemasan dan Rasa

Awalnya hanya ingin melestarikan kue khas daerahnya, Bengkulu. Setelah ditekuni ternyata menjadi peluang bisnis yang menjanjikan. Kiatnya, resep disesuaikan dengan kebutuhan dan tren konsumen.


anita asli Bengkulu, Neliwati Dalimo,suksesmenekuniusaha ma-kananringankhasBengkulu, kueEnde.Sebetulnyabisnisyangdirintis sejak2001ini,lebihkarenapanggilanhati. InginmemperkenalkanmakanankhasdaerahnyakeseluruhIndonesiadandunia.“Bila tidakdiperkenalkankepadapasar,lamakelamaanmakananiniakandilupakan,” ungkapwanitayangmemulaiusahadengan modalRp100ribu.Sebelumnyasayamembuatkeripikbawang,dandititipkanketoko kue.Barukemudianmembuatkuekering. Rasa dan penampilan Untukkuekhas Bengkuluini,jika pakairesepyang aslisepertiPerut Punai, Tat agak keras sehingga tidaksukai.“Rasanya enak tapi karenakeras,jadi orangmalasuntuk mengkonsumsi,” keluh Neliwati. Untuk meningkatkan kualitas

sayamerubahresep,sehinggarasakue menjadilembut.Bahan-bahanlainnya juga menggunakan yang bagus. Dengankomposisibahanbakuyang bagus,membuathargakuenyajadimahalmulaiRp5000per1,5onssampaiRp 35ribuperkgperpieces.“Saatinisaya membuatlebihdarisepuluhmacamkue snack,yangsemuanyakhasBengkulu. Tapiyangpalinglakukuebawang,perut punai dan tat,” paparnya. Prosespembuatannyamasihsecara tradisional.“Agartahanlamadantetap gurihkemasannyaharusbenar-benarkedapudara.Maksimalkuesayabertahan

Neliwati Dalimo:Bisnis kue khas Bengkulu


Gema Industri Kecil. Edisi XVIII/Juni 2007

Profil Pengusaha

sampaiduabulan,”katanyaberpromosi. SetiaphariNeliwatimemproduksi sebanyak25kgkue.Untukpengerjaannyadibantuolehduabelaskaryawanyangdibayarharian.Sedang pemasarannya,selaindijualoutletmiliknyajugadijualketokokuedengan sistem beli putus. Sementarauntukomzetmencapai Rp25jutasetiapbulan.“Sayabelum memasarkanlangsungkeluardaerah hanyalewatbuyerssaja,”ungkapnya. Saatinisayasedangmencobamasuk pasarriteldanluarnegeri.Sudahada permintaandariChina,khususnyakue keripik bawang, tambahnya. Untukmasukpasarriteldanluar, lajutNeliwatitidakhanyamengandalkancitarasasaja,tapikemasannyajuga harusdiperhatikan.Jikakemasannya tidakdiperbaikimeskirasamakanannyaenak,tetapakankalahbersaing denganprodukyangpenampilannya G menarik. Rachma Utami

desaIneR mUda meRdI sIhombInG

menGanGKat dan mempopUleRKan KaInBaduy yang menonjolkan warna badUy Kain etnik
biru dan hitam memiliki karakter dan keunikan tersendiri. Desainer muda Merdi Sihombing mencoba mengangkat dan mempopulerkan di kancah fashion nasional.


idianSefnatSihombing,yang akrabdipanggilMerdiSihombing, adalahdesainermudayangsedangnaikdaundalamjajarandesainer papanatasnegeriini,terutamapartisipasinyadalammengangkatproduk tekstilberbasisetnikBaduy.Iadikenal sangatpedulidalammengembangkan danmempopulerkankaintenun,sulamansertaberbagaibentukkerajinan khasBaduyyangsangatberkarakter dan dinamis. Pria kelahiran Medan, 21 Mei 1970 ini, pernah meraih berbagai penghargaan,antaralainPemenang KostumTerbaikdiGrandFinalVideo Musik Indonesia tahun 1999 / 2000 dan Appointed Designer forWorld HarpEnsembletahun2002diJakarta. Jugapernahmendapatperhargaandi ajangCoffeeMorningASEANdiKuala Lumpur, Malaysia tahun 2003. Dalam membantu percepatan pengembangan kain Baduy, Merdi menuangkanidehasildariinspirasinya denganmelaluiberbagaicara,yakni selembar kain biru diolah, ditata,

digunting,dipayet,laludijahittangan. MetodelainadalahtenunasliBaduy yangdinamakanSuatSongket,di-print diataskainrayondalamjumlahbanyak namuntidakmeninggalkanidentitasnya yangasli.Inidilakukankarenadiamelihat tenagaterampilsaatinisudahlangka, dimanauntukmenyelesaikan1lembar


Gema Industri Kecil. Edisi XVIII/Juni 2007

Profil Pengusaha

kaindenganpanjang2meterdibutuhkan waktu yang lama. “KainBaduydapatdijadikanicon Baduy,”ujarMerdipenuhsemangat. Menurutnya, seluruh motif yang tertuang dalam kain Baduy harus dilestarikan dan dilindungi. Tidak hanyakainSuatSongketBaduyyang layakdiangkatuntukdilestarikandan diperkenalkanpadadunia,tapipelah atau kain tenun terbuat dari serat daunrotanpuncukupmenarikuntuk

dikembangkan. Bagi seorang Merdi, membantu masyarakatBaduy bukanhanyauntuk mengembangkankain merekamenjadiproduk modern, tapi juga sekaligusmengangkat kesejahteraanmasyarakat Baduy. Langkahyangdilakukan desainer muda ini terjun langsung ke daerahterpencilperlu diapresiasi, karena masihbanyakdaerah lain yang memiliki keunikanyangbelum tergalidantersentuh oleh para desainer. Padahaltidaktertutup kemungkinankedepan produk-produkyang ada di pedalaman menjadi produk yangtransaksional dandisukaipecinta

busana. KenapaMerdiyangpencintatravelling ini menyukai suku dan kain Baduy? Initidaklain,karenasukuBaduyyang berdomisilidipedalamanprovinsiBanten inimemilikikeunikanbudayatersendiri, dimanamasyarakatnyaseringberjalan kakitanpaalas,sertaberpakaianhitam dengantasselempangyangterbuat darikulitkayu(tereub)ketikamenyusuri jalanan ibu kota. Bahkan,sebagiandarimerekamasih banyakyanghidupterasingdipedalaman sanadancenderungtertutupdarimasuknyabudayaluar.SehinggasukuBaduy sampaisaatinimasihmengundangbanyakhalyangbelumterungkap.Uniknya, kaumwanitanyamemilikikebiasaanmenenunkainkhasBaduyyangberciriwarna kebiruan (indigo). BagiseorangMerdimemandang kainBaduyterasamemilikikharisma tersendiriapalagidilakonidenganpergi ketanahBaduymenyusuribukitdengan berjalan kaki, bergabung dalam kehidupanlangsungpenduduknya,serta mengamaticarapembuatankain-kain birudanmelihatgayapenampilansehari-harimereka.”Wowsungguhmengesankan,” cetusnya. Wanita Baduy, kebiasaan dalam sehari-harimengenakansarung,blus atasan, tas, sisir, gelang dan kalung manik-manik,tampilsungguhartistik sehinggamemberikeunikandankharismatersendiri.Pemandanganinilah yangmembuatnaluriMerdiuntukterus kembaliketanahBaduydanmenelusuriselukbelukkainBaduy,sekaligus mengangkat produk tenun mereka menjadisebuahlembarankain-kain indahberseleratinggi,terusdiminati dansejajardenganprodukunggulan fashionnasionalmaupuninternasional kelak.G Mawarzi Idris

Gema Industri Kecil. Edisi XVIII/Juni 2007

PProfil Pengusaha rofil Pengusaha

Fashion: Menampilkan gaya etnik manfaatkan kain khas baduy 55 Gema Industri Kecil. Edisi XVIII/Juni 2007

Standar & teknologi Standar &teknologi

BBIA MItrA BIsnIs KoMpeten
Balai Besar Industri Agro Deperin (BBIA) punya 4 lembaga sertifikasi: Lembaga Sertifikasi Sistem Manajemen Mutu (ABIQA), Lembaga Sertifikasi Produk (ABIPro), Lembaga Sertifikasi HACCP (ABI-HACCP), dan Lembaga Sertifikasi Inspeksi (ABITIS).
udahbanyakhasilpenelitiandari BalaiBesarIndustriAgroDepartemen Perindustrian (BBIA) yang sudahdiproduksiolehmasyarakat.DiantaranyaVCO,buahmerah,jahemerah, fruitleatherj.merah,fruitleatherj.sirsak, mengkudu,apelsegar,minumancincau hitam,dantiwulinstan.Produk-produk tersebutdipamerkandalampameranindustrimakanandanminumanyangdiselenggarakanolehDepartemenPerindustrian pada tanggal 2-5 April 2007. SelainpenelitianjasalainyangdiberikanBBIA.berupariset,pengujian,kalibrasi,konsultasi,pelatihan,dansertifikasi.Kiniadasekitar85perusahaanyang


telahmemanfaatkanjasaBBIAantaralain perusahaanBogasariFlourMills,Indofood SuksesMakmur,Indomilk,Sucofindo,dan PT Unilever. Sementarafasilitaslaboratoriumyang dimilikiBBIAantaralainlaboratorium pengujianuntukmakananolahan,mikrobiologi,air,minuman,pakandanbahan bakusertalaboratoriumuntuklimbah. Selainitujugatersedialaboratoriumkalibrasidanlaboratoriumprosespengolahan pangandannonpangan.Sedangfasilitas perpustakaancukupluassekitar300m², dengankoleksikhususindustriagrodan buku-bukureferensilainnya.Untukkoleksi hasil penelitian BBIA tersedia dalam

Gema Industri Kecil. Edisi XVIII/Juni 2007

Standar & teknologi

bentukbukumaupunmajalah,danbisa diaksesmelaluiwebsite:www.bbia.go.id. Industri hasil pertanian BalaiBesaryangbernaungdibawah DepartemenPerindustrianinididirikan pada1909,dengannamaBiroAnalisis PertaniandanPerdagangan(Bureauvoor LandbouvenHandelAnalyse)yangkemudianbergantimenjadiBalaiPenyelidikan Kimiapada1945.Selanjutnyapada1980 namanyabergantilagimenjadi Balai BesarIndustriHasilPertanian,hingga akhirnyasejak29November2002diubah lagimenjadiBalaiBesarIndustriAgro (BBIA)yangsecarastrukturalberada dibawahBadanPenelitiandanPengembangan Industri (BPPI). BBIAyangberlokasidiJl.Ir.H.Juanda No.11,Bogorinimerupakaninstitusi yangmemberikanjasapelayananteknis kepadamasyarakatindustri,khususnya industrihasilpertanian,dalamrangka mewujudkanpengembanganindustriyang berdayasaingkompetitifbaiksecaranasional maupun internasional. VisiBBIAsendiriadalahmenjadiinstitusiyangprofesional,mandiridanterkemukadalammemberikanjasapelayanan teknisdibidangindustriagro.AdapunMisi yangdiembanadalah,pertamamelaksanakanjasapelayananteknisdalambidangriset,pengujian,kalibrasi,pelatihan, konsultasi,sertifikasi,rancangbangun danperekayayasaanindustri.Kedua, membantupemerintahpusatdandaerah dalampengembanganIKMdanpembinaanindustriagro.Ketiga,melakukan pengkajian,riset,pengembangandan pemdalamanteknologiekstraksisecara berkesinambunganuntukmembantu mengembangkan industri agro. Jasa sertifikasi BBIA BilaAndamempunyaiperusahaan yangmemproduksisuatubarangun57

tukdipasarkanbaikkepadakonsumen personal,industri,distributor,domestik atauekspor,adabeberapapersyaratan keamanan,danlayakuntukdikonsumsi yangharusdipenuhi.Untukmenjamin produkAndasudahamandikonsumsi harusadasertifikasinya,baikSertifikasi ISO9000,SertifikatProdukPenggunaan TandaSNI,SertifikatKeamananPangan danSertifikatInspeksiKecukupanPanas dan Lingkungan. BalaiBesarIndustriAgromempunyai empatlembagasertifikasiyaituLembaga Sertifikasi Sistem Manajemen Mutu bernamaABIQA(Agro-BasedIndustry QualityAssurance),LembagaSertifikasi ProdukyangbernamaABI-Pro(AgroBasedIndustry-ProductsCertifacation), LembagaSertifikasiHACCPbernama ABI-HACCP(Agro-BasedIndustry-HACCP System Certification),dan Lembaga SertifikasiInspeksiTeknisbernamaABITIS (Agro-BasedIndustryTechnicalInspection Services) UntuklembagaABIQAmerupakan lembagasertifikasiISO9000yangmemfokuskanpadasertifikasiindustri-industri hasilpertanian.Sejak1994,ABIQAtelah masukdalamjaringanakreditasinasional/ internasionalyangdibentukolehKomite AkreditasiNasionalBadanSertifikasiNasional (KAN/BSN) SedangABI-Promerupakanlembaga sertifikasiprodukyangdibentukoleh PemerintahRIc.q.BalaiBesarIndustri Agro(BBIA)berlokasidiBogor.ABI-Pro melayani jasasertifikasiuntukmemperolehSertifikasiProdukPenggunaan TandaSNIsecaraprofesional.ABI-Pro telahterakreditasidalamjaringanakreditasinasional/internasionalyangdibentuk olehKomiteAkreditasiNasionalBadan Sertifikasi Nasional (KAN/BSN). Keuntungandengantelahmendapat tandaSNI,pertamareputasidanpengakuansecaranasionalbahwaproduk

telahbermutu,sesuaidengankriteriaSNI. Kedua,produktelahlegaluntukdipasarkan,bilatergolongdalamprodukwajib lakuSNI.Ketiga,aksesinformasiyang luasterhadapinformasiSNIdanstandar produklainnyasertaperaturanpemerintahlainnya.Keempat,lembagaKalibrasi terakreditasi,LembagaSertifikasiSistem MutuISO9000atauHACCPterakreditasi, lembagaInspeksiteknisterakreditasi, LembagaTrainingdanLembagaKonsultasi.Kelima,sertifikasiprodukdilakukanbersamaandengansertifikasisistem mutu ISO 9000 atau HACCP. Aseptabilitas produk makanan, minuman,danolahanpanganlainnya, selain ditentukan oleh karakteristik mutuorganoleptikjugaditentukanoleh keamanan (health & safety) produk tersebut bila dikonsumsi. Untuksistemmanajemenyangmemfokuskanpadaupayajaminankeamanan dikenaldenganHazardAnalysisCritical Point(HCCP).SistemHACCPinimerupakanmetodeidentifikasidinidariunsurunsuryangmembahayakankesehatan (hazards)danmengendalikannyadalam suatumekanismesistemmanajemen. DalamsistemHACCP,higienedan sanitasidiseluruhrantaiprosespengolahan menjaditulangpunggung(backbone) sistemyangdioperasikanmelalui7(tujuh) prinsipyaknianalisahazards,penentuan titikkendalikritis,penetapanbataskritis, monitoring,tindakkoreksi,rekaman/ dokumentasi, dan verifikasi. Bilaperusahaanmengoperasikan sistemmanajemenkeamananpangan mengacusistemHACCPmakaakanmem, perolehpengakuannasional/internasional atasprestasi-prestasiyangtelahdicapai dalammenjaminkeamananpanganyang diproduksidalamabentuksertifikatHACCP . SementaraLembagaInspeksiTeknis yangbernamaABITIS,menerbitkanSertifikatInspeksiKecukupanPanas,Inspeksi

Gema Industri Kecil. Edisi XVIII/Juni 2007

Standar&teknologi Standar & teknologi

Jasa yang diberikan BBIA antara lain riset, pengujian, kalibrasi, konsultasi, pelatihan, dan sertifikasi.
VisualMakanandalamkaleng,Inspeksi MutuProdukMakanandanMinumandan Inspeksi Udara Ambien. RuanglingkupABITISterakreditasi meliputipertama,InspeksiKecukupanPanasuntukProdukMakanandanMinuman dalamkaleng,botoldanplastikpouch, (cornetbeefdalamkaleng,udangdalam kaleng,kerangdalamkaleng,sardinmediasaustomatdalamkaleng,natadalam kemasan,buah-buahandalamkaleng,dan lain-lainnya).Kedua,InspeksiVisualdalam kaleng.Ketiga,InspeksiProdukMakanan danMinuman.Keempat,InspeksiUdara Ambienmeliputi:PengambilanContoh udaraambien,pengukuransulfurdioksida(SO2),pengukurannitrogendioksida (NO2),pengukuranoksida(O2);pengukurandebu,pengukuranhidrogensulfida (H2S),danpengukuranamonia(NH3). Teknologi tepat guna Untukmengatasipersoalanketerbatasanaksesinformasi,BadanLitbang IndustriDeperinmelalui9BalaiBesar berskalanasionaldan13BalaiLitbang Industriberskalaregionalbekerjasama denganBiroUmumdanHumasmenerbitkanBukuKumpulanInformasiTeknologi G Wagu F. Tepat Guna (2006).

1. Alat dan mesin pembuatan VCO teknologi IMC (tahun 2003) (Mesin Pemarut, Mesin Pengering, Alat Jack Pres, Tangki Pencuci, Separator, Tangki Vakum, Filter Pres) 2. Alat dan mesin pengolahan minyak kelapa system HOID (Screw Pres, Tungku Bata Api, Mesin Parut, Bak Peniris) 3. Alat dan mesin pengolahan buah-buahan (Penggoreng Vakum, Mixer, Pulper, Pengolah Jeruk (Juicer), Alat Pasteurisasi). 4. Alat dan mesin pengolahan nata (Mesin Seset Nata, Mesin Pemotong Nata). 5. Alat penyangrai 6. Alat dan mesin pengolah kripik (Pengupas Kulit Umbi, Alat Pengiris, Oven Peniris, Penggoreng Otomatis, Coating Mollen). 7. Alat dan mesin pengolah bubuk coklat (Tahun 2004) (Mesin Penyangrai, Mesin Pengepres Hidrolik, Mesin Penggiling, Alat Pengayak, Mesin Alkalisasi, Alat Penampung Kakao). 8. Alat dan mesin pakan ternak (Hammer Mill, Pembangkit Uap, Mixer Pakan, Ayakan, Mesin Pelet, Mesin Crumble, Alat pendingin). 9. Alat pengaduk dodol (Tahun 2003) 10. Mini Cold Storage (Tahun 2004) 11. Peralatan penyulingan minyak atsiri (Steam Generator, Ketel/Vessel, Bak Pendingin, Pemisah Minyak Atsiri). 12. Mesin pencacah sampah (Tahun 2004) 13. Penggoreng Vakum 14. Alat Pres Gabus Kelapa 15. Pembuatan Keripik Buah-Buahan 16. Pembuatan Nata De Soya 17. Pembuatan Nata De Coco 58 Gema Industri Kecil. Edisi XVIII/Juni 2007

Gedung BBIA, sketsa mesin, dan produk dari BBIA: Teknologi tepat guna

Standar & teknologi

produK IndIKAsI GeoGrAfIs HArus MendApAt HAKI
ndonesiatermasuknegarayangmemilikikeanekaragamanhayatidan budayayangsangatkayadidunia. Darikeanekaragamantersebuttelah dikembangkanberbagaiprodukberbasis budayadarimasing-masingdaerahdengancirikhastertentu.Produk-produk tersebutmemilikiperanpentingdalam kehidupanmasyarakatsetempatkhususnyadanbangsaIndonesiaumumnya, bahkanbisamenjadibarangkomersial yang bernilai tinggi.


Salah satu hasil produk budaya yang juga termasuk produk indikasi geografis Indonesia adalah Wayang. Untuk pelestariannya harus dilindungi dengan HAKI
yang punya ciri khas tertentu. Wayang kulit Salahsatuprodukyangdapatdilindu ngiolehHKIuntukkategoriindikasigeografisdiantaranyaadalahTatahSungging atauwayangkulitdiPropinsiYogyakarta. Wayangsendiriberasaldarikatawayang -anyaitusumberilhamdalammenggambarwujudtokohdanceritasehingga bisatergambarjelasdalambatinsipeng gambar.

Untukmencegahproduk-produkberbasistradisionalknowledgeyangadadi Indonesiadiklaimjadimiliknegaralain dandimanfaatkansecaraekonomistanpa ijin,makaproduk-produktersebutharusmendapatkanperlindunganhukum. Perlindunganindikasigeografisdidalam sistemHKIadalahsalahsatubentukperlindunganhukumyangdapatditerapkan untukmelindungiproduk-produktersebut.Fungsiindikasigeografissendiri adalahmengindentifikasiproduk-produk

Gema Industri Kecil. Edisi XVIII/Juni 2007

Standar & teknologi

Nahkegiatanwayangannyainiadalah bagiandarikegiatanreligianimismepada abadke8,yaknimenyembahkepada ‘Sang Hyang’yang dilakukan antara lainsaatpanenanatautanemandalam bentukupacaramertidesa.Tujuannya agar panen berhasil atau agar desa terhindardarisegalabala.KiniWayang sudahmenjadiwayangpurwanamun masihtetapditujuanuntukmenyembah para’SangHyang’sepertiyangtertulis dalamprasastibalitung.Padadasarnya wayangadalahperlambangkehidupan manusia sehari-hari. Masa-masa awal abad ke 10, kepercayaananimismemulaidigeseroleh pengaruhagamaHindu.Padaawalabad ke15,wayangadalahmerupakankoleksi paraRaja.Fungsinyaadalahsebagaialat penyebaraninformasi,beritaataupun pengumumansecaratidaklangsungdari Rajakepadarakyatnya.Padaawalabad ke16berdirilahkerajaanDemakyang merupakan kerajaan Islam. WayangpundigunakanolehparaWali untukmenyebarkanagamaIslamdiJawa karenadidalamajaranIslamtidakboleh menggunakanmediapatung/arca.Maka dibuatlahwayangyangdibuatdarikulit kerbauyangditipiskandangambarnya dibuatmenyamping,tangannyadipanjangkan,digapitdenganpenguatdaritanduk kerbau dan disimping. Pada jaman KerajaanPajangwayangkulitmulaiditatah 3dimensi.Bentukwajahdanrambut ditatahsemakinhalusdanpadapundak, sikudanpergelangantangandiberisendi sgarwayangdapatdigerakkanlebih leluasa. Padasaatinipertunjukkanwayang bisadikatakansudahmenjurusbersifat komersilwalaupunsecaragarisbesar masihmempertahankannilai-nilaibudaya lama.Munculnyaide-ideuntukmemodernkantatapanggungataukostumpara penyanyikarawitan,pembawadagelan

maupunskenariojalanceritapertunjukkanwayangtersebutsedikitbanyak menyesuaikandenganperubahan/modernisasi jaman. Potensi produksi dan pasar PopulasipembuatwayangsaatinikhususnyadidaerahBantulYogyakartasudah mulaiberkurang.Kalaudahuludikawasan wisatatatahsunggingdiBantulhampir setiaprumahdisepanjangjalanterdapat showroomdanbengkelpembuatan wayangkulit,saatinihampirsemua sudahgulungtikar.Halinidisebabkanolehmakinsepinyapeminat/ pembelicinderamatawayang yangdatangberkunjungdan membelinya.Menurunnyawisatawanasingyangdatang berkunjungjugadisebabkanolehfaktorpertahanandankeamanannegara kitayangmulaidisangsikan olehpihakluarnegeri.Banyakdariparaperajinini beralihprofesimenjadi pedagangkarenadianggaplebihmenguntungkan. Kini hanyaadabeberapa sajayangmasihbertahanmemproduksi kerajinanwayang, itupunumunyaberdasarkanpesanan dantidakhanya wayang saja yang diproduksi tetapijugaperalatanrumah tanggadansouvenirdaribahankulitsepertikipas,kaplampu,wayang-wayangdalamukuran

kecil, dll. Sebelumterjadikrisismoneter,produk wayang-wayanginisempatmenjadikomoditieksporkeAmerikaSerikatdandi dalamnegerisendiripasarnyakehampir seluruhpropinsi.Saatinieksporproduk wayangininyaristerhentidanpermintaan daridalamnegeripunberkuranghanya keJakarta,Bali,SurabayadanKalimantan dengan jumlah yang terbatas.

Gema Industri Kecil. Edisi XVIII/Juni 2007

Standar & teknologi Pembuatan wayang kulit sudah ada standar pedomannya. Menggunakan bahan baku kulit kerbau.
Aspek komersil Pada sekitar tahun + tahun 1979 s/d1997,konsumenyangbanyakmeminatiprodukwayangkulitiniadalahorang asingsekitar75%dan25%wisatawan lokaldarijumlahwisatawanyangberkunjungkeYogyakarta.Setelahadanyakrisis moneter,jumlahitumenyusutbahkan hanyatinggalsekitar25%baikuntukwisatawanasingmaupunlokal.Hargajual wayanginibervariasi,untukwayangyang buatannyahalus(kls1)menggunakan warna-warnaemasharganyaberkisar Rp800.000,-persatubuahwayang.Yang menggunakanwarnabronbiasaberkisar Rp.250.000,-.Untukwayangyangbuatannyakasar(kls2)dijualseharga30-50 riburupiahperwayang.Wayangkelas1 banyakdiminatiolehparakolektordan orangasing.Sedangkanwisatawan lokallebihmemilihcinderamatawayangkelas2yangharganyajauh lebihmurah.Halinimenunjukkanbahwaminatkonsumen dalamnegeriterhadap produkwayangkulitmasihbertahan.Bilapihak perajin,budayawan danpemerintah lebih gencar mengadakanpromosi khususnya untukproduk wayangkulit ini,diharapkan pasar baik DN maupunLNakan kembalibergairah dan penjualanproduk wayangkulitiniakankembalimeningkat bahkandieksporyangakanmenambah devisa negara. Aspek teknologi proses Pembuatanwayangkulitsendiri adastandarpedomannyayangsudah dibakukan.Pembuatannyapunmasih menggunakanprosesmanual.Dimulai dari bahan baku kulit kerbau yang direndam di air mengalir agar tidak kaku selama 24 jam lalu dikerok dan dikeringkanselama1hari.Setelahkering dipolaataudigambarlangsungpada kulittersebut.1lembarkulitbisauntuk membuat2wayangukuranbesaratau 30wayangukurankecil.Pemotongannya bebastidakmengikutiseratkulitdengan menggunakantatah/pisaukhususlalu dipahatdandiwarnai,prosesinimemakan waktu1minggu.Catyangdigunakan adalah cat acrylic agar tidak luntur. Pengangannyadibuatdaritandukkerbau sedangkansendi/engselpadawayang terbuatdariemas,perak,kuninganatau plastik.Bentukfisikdariwayangitusendiri sudah standar dan menjadi ciri khas masing-masingtokohnya,misalnyauntuk arjunadigambarkansebagailaki-lakiyang tampanmempunyaiukiransimpingyang khas.Dilihatdariprosespembuatannya wayangkulitinicukupsederhanadan dikerjakansecaramanualkarenauntuk membuatukiranpadawayangdiperlukan keterampilankhusus,sehinggauntuk pembuatannyatidakdiperlukanteknologi canggih/masinal. Aspek substansi HaKI Setiap produk yang dijual tentu memerlukan merek sebegai tanda pengenaldanuntukmengetahuisiapa dandarimanaprodukituberasal.Begitu jugadenganprodukwayangkulitbisa menggunakanmerekdaganguntuk

mebedakanhasilproduksisatuperajin/ pengusahadenganhasilproduksiperajin lainnya. WayangkulittatahsunggingdariYog yakartainijugabisadimasukkandalam kategoriprodukIndikasiGeografiskarena merupakankaryaseniyangpunyaciri khas(ukiran)sendiri.Sedangdarisegi HakCipta,wayangkulittatahsungging jugabisadimasukkandalamkategori Folklor.Yaknisebagaihasilkaryaseni berupakerajinantanganyangtelahturun temurun. Tatahsunggingatauwayangkulit khasYogyakartamerupakansalahsatu karya seni anak bangsa yang harus dilindungikelestariannya.Pasarnyacukup bagusuntukmenambahpemasukan devisanegara,terbuktidengantelah diekspornyaprodukinikeluarnegeridan banyakwisatawanasingyangmenggemari produk yang bernilai seni tinggi ini. Hanyasejakadanyakrisismoneterdan penetapanOtda,pamasarandanpenjualan produkinicenderungmenurun.Krisis moneterdansituasikeamananIndonesia menjadisalahsatufaktorenggannya wisatawanmancanegaradanlokaluntuk berjunjung,sehinggamenimbulkanbanyak kerugiandanbahkanbanyakperajinyang gulungtikardanberalihprofesi.Laludari pihakPemdabaikKab.Bantulmaupun PropinsiDIYogyakartabelummeberikan perhatianyangbesarpadaprodukwayang kulitinibaikdarisegipromosidiDNmaupun LNataudalampemberianbantuantambahan modalusaha.Padaakhirnyamemang diperlukanupayanyatabaikdariperajin sendiri,budayawandanpihakpemerintah dalamhaliniDinasPerindustriandan Perdagangan,KementerianKoperasidan UKMsertaDinasPariwisatasetempatagar memajukankembaliusahawayangkulitini danyangterpentingmelestarikannya, karenamerupakansalahsatuwarisan G budaya bangsa. Tia

Gema Industri Kecil. Edisi XVIII/Juni 2007

BANTUAN PERALATAN UNTUK IKM MUSIBAH BANJIR : peralatan mesin kepada IKM yang terkena musibah banjir

Menteri Perindustrian, Fahmi Idris menyerahkan bantuan

PAMERAN INACRAFT: Menteri Perindustrian, Fahmi Idris, meninjau pameran Inacraft di Jakarta International Convention Center (JICC).
62 Gema Industri Kecil. Edisi XVIII/Juli 2007

Serba Serbi

PAMERAN PRODUK LANGKA: Ketua Dekranas Hj. Mufidah Jusuf Kalla meninjau pameran produk kerajinan langka Tgl 19-23 Juni 2007, di Plasa Pameran Industri Deperin

PAMERAN PRODUK KULIT: Menteri Perindustrian, Fahmi Idris, meninjau pameran produk kulit di Plasa Pameran Industri, Deperin


Gema Industri Kecil. Edisi XVIII/Juli 2007

SERBA SERBI Kunjungan Tamu Malaysia
Tujuannyaadalahmendorongprodusendalammemanfaatkandesain produksebagaiunsurpentingdayasaingdalammerebutpasar.Kerjasama PertemuanantaraMajelisRekaBentukMalaysiadengan dalambentukMemorandumOfUnderstandingakanditindaklanjuti PusatDesainNasionaldalamrangkapenjajaganKerjasama melaluipembahasankhususkedualembagatersebutdalamsatu PertukaranHasilSeleksiDesainkedualembagatersebut. agendapadaeventpertemuanAsianDesignNetworkConference akhirtahuninidiKualaLumpur,Malaysia.

Kunjungan Tamu Zimbabwe

Ibu Mutia Hatta (Menteri Negara Pemberdayaan Perempuan RI), Ho, O.Z. Muchinguri (Menteri Urusan Perempuan Zimbabwe), Hon, F. Buka (Menetri Pembangunan Masyarakat Republik Zimbabwe) serta delegasi mengunjungi Pemeran Kulit di Plasa Pameran Industri pada tanggal 24 Mei 2007. Kedua Menteri Zimbabwe sangat antusias melihat produk-produk kulit yang dipameran serta kagum dengan konsep Plasa Pameran Industri yang dibangun guna memanfaatkan lobi Departemen Perindustrian


Gema Industri Kecil. Edisi XVIII/Juli 2007

Serba Serbi

Kunjungan Tamu Cina

Kunjungan tamu dari negeri Cina ke Indonesia dalam rangka menawarkan kerjasama promosi produk IKM ke Cina

Kunjungan DPRD Aceh Utara
DirekturJenderalIKMDeperin,Sakri WidhiantodanDirekturIKMPanganIr.A. SufiardimenerimakunjunganSilaturahim DPRDKabupatenAcehUtaradidampingi KepalaDinas Perindag.Drs.H.MNur IbrahimMBA,berkenaandenganrencana realisasipemberianbantuanperalatan/ mesinuntuksentraindustrikecilgerabah dan pande besi.
65 Gema Industri Kecil. Edisi XVIII/Juli 2007

Sign up to vote on this title
UsefulNot useful