P. 1
Analgesik antiinflamasi

Analgesik antiinflamasi

|Views: 8,057|Likes:
Published by nan'nin dya

More info:

Published by: nan'nin dya on Nov 03, 2010
Copyright:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as DOC, PDF, TXT or read online from Scribd
See more
See less

07/08/2013

pdf

text

original

Analgesik, antiinflamasi http://www.farmasiku.com/index.php?

target=categories&category_id=171 Analgesik adalah obat yang dapat mengurangi atau menghilangkan rasa nyeri dan akhirnya akan memberikan rasa nyaman pada orang yang menderita. Anti inflamasi adalah obat yang dapat menghilangkan radang yang disebabkan bukan karena mikroorganisme (non infeksi). Gejala inflamasi Inflamasi dapat disertai dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Proses inflamasi meliputi kerusakan mikrovaskuler, meningkatnya permeabilitas vaskuler dan migrasi leukosit ke jaringan radang, dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Mediator yang dilepaskan antara lain histamin, bradikinin, leukotrin, Prostaglandin dan PAF. Penanganan inflamasi 1 2 3 4 5 6 7 Derivat Asam Salisilat à Aspirin, Benorilat, Diflunisal, Salsalat Derivat Asam Propionat à As.Tiaprofenat, Fenbufen, Flurbiprofen, Ibuprofen, Ketoprofen, Naproksen Derivat.As.Fenamat à As.Mefenamat, Meklofenamat Derivat As.Fenilasetat à Diklofenak, Fenklofenak Derivat Oksikam à Piroksikam, Tenoksikam Der.As.Asetat inden/indol à Indometasin, Sulindak, Tolmetin Deriva Pirazolon à Azapropazon, Fenilbutazon, Oksifenbutazon

ABDIFLAM CODE: C29 Harga Per Satuan Terkecil : Rp1,350.00 Abdiflam Natrium diklofenak 25 mg; 50 mg. Indikasi: sakit pasca traumatik inflamatori, inflamasi dan bentuk degeneratif rematik, rematik non artikular. Dosis: Dewasa: awal: sehari100-150 mg dalam dosis terbagi 2-3x; Anak 14th: 75-100 mg sehari dalam dosis bagi 2-3x. Kemasan: 5 x 10 tablet 50 mg.

AFI RHEUMA CODE: C1

Harga Per Satuan Terkecil : Rp2,300.00 BELI AFI RHEUMA KAPSUL KOMpOSISI : Tiap kapsul mengandung : 4 butil 1,2 difenilpirazolidina 3,5 dion ................... 100 mg CARA KERJA OBAT : Sebagai anti radang dan analgetik INDIKASI : Ankylosing spondylitis, acute gouty arthritis, active rheumatoid arthritis. CARA PEMAKAIAN: Dewasa 2-3 kali sehari 1 kapsul, sesudah makan atau diminum dengan susu, seyogyanya sesuai petunjuk dokter. EFEK SAMPING: - Iritasi gastrointestinal (mual, muntah, rasa terbakar pada lambung). - Retensi : Cairan, edema, rash. - Gangguan hematologi yang serius (leukopenia, agranulositopenia, aplastik-anemia). - Alergi INTERAKSI OBAT: Jangan diberikan bersama - sama dengan : Kumarinantikoagulan, insulin, fenitoin, oral hipoglikemik. KEMASAN : Box isi 10 blister @ 12 kapsul Reg. No. DKL 8901700901 A1 Simpanlah obat ini ditempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER Allogon 500 Harga Per Satuan Terkecil : Rp700.00 BELI ALLOGON 500 mg. Komposisi Mefenamic acid/Asam mefenamat INDIKASI Nyeri ringan, sedang sampai berat seperti sakit kepala, nyeri otot, artralgia (nyeri sendi), sakit gigi, osteoartitis rematoid, gout, nyeri saat haid, nyeri setelah operasi, nyeri setelah terjadi patah tulang, nyeri setelah melahirkan, neuralgia (nyeri pada saraf), dan nyeri pada organ-organ dalam perut. KONTRA INDIKASI Gastritis, ulkus lambung, dan anemia hemolitik. PERHATIAN Kehamilan, dehidrasi, epilepsi, asma. Interaksi obat : antikoagulan oral. EFEK SAMPING

Gangguan & perdarahan saluran pencernaan, ulkus peptikum, sakit kepala, gugup, insomnia (sulit tidur), biduran/kaligata, kemerahan pada kulit, pembengkakan wajah. INDEKS KEAMANAN PADA WANITA HAMIL C: Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin. KEMASAN Kaplet 500 mg x 2 x 10 butir. DOSIS Dewasa : 250-500 mg tiap 6 jam sekali. Anak-anak : 6,5 mg/kg berat badan tiap 6-8 jam sekali. Nyeri saat : diawali dengan 500 mg, kemudian 250 mg tiap 6 jam. haid PENYAJIAN Dikonsumsi bersamaan dengan makanan PABRIK Konimex. Analsik CODE: C2 Harga Per Satuan Terkecil : Rp1,150.00 ANALSIK Tiap kaptet mengandung : Metampiron 500 mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. Metampiron adalah suatu obat analgesik- antipiretik. Diazepam mempunyai kerja sebagai antiansietas, juga memiliki sifat relaksasi otot rangka. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral. INDIKASi : Untuk meringankan rasa nyeri sedang sampai berat, ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam. Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg, wanita hamil dan menyusui. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. Glaukoma sudut sempit, keadaan psikosis akut. EFEK SAMPING : Dapat menimbulkan agranulositosis. Reaksi hipersensitivitas, reaksi pada kulit,ngantuk,pusing,lelah yang berlebihan. Konstipasi, depresi, diplopia, hipotensi, jaundice, perubahan libido, mual, tremor, retensi urin, vertigo. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan

lumbago. HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet.30°C).: DPL8822208609A1. DOSIS : 1 kaplet.250. karena dapat berakibat fatal. INDIKASI : Untuk meringankan rasa nyeri sedang sampai berat. sakit punggung. maksimum 4 kaplet sehari.Indonesia Analspec CODE: C3 Harga Per Satuan Terkecil : Rp1.halusinasi dan gangguan tidur.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam.- darah/kelainan darah. juga memiliki sifat relaksasi otot rangka. Dibuat oleh : PT SANBE FARMA Bandung . Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. sindroma bahu lengan. ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam. No. Diazepam mempunyai kerja sebagai antiansietas. sebaik-nya tidak digunakan untuk jangka pahjang. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri.00 ANALSIK Tiap kaptet mengandung : Metampiron 500mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut. Metampiron adalah suatu obat analgesik. Walaupun jarang menimbulkan agranulositosis. Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik. Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg. INTERAKSI OBAT : Penggunaan bersama . .sama dengan obat .bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam. wanita hamil dan menyusui. bursitis. Reg. gangguan fungsi hati atau ginjal. ansietas.antipiretik. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. PENYIMPANAN Simpan pada suhu kamar (25°.

halusinasi dan gangguan tidur. Walaupun jarang menimbulkan agranulositosis. tremor.lelah yang berlebihan. DOSIS : 1 kaplet. bursitis.Glaukoma sudut sempit. Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis.sama dengan obat . jaundice. Konstipasi. keadaan psikosis akut. diplopia. ansietas. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri. lumbago.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam. Reaksi hipersensitivitas. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. Reg. sindroma bahu lengan. HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet. hipotensi. karena dapat berakibat fatal.ngantuk. gangguan fungsi hati atau ginjal. No. PENYIMPANAN Simpan pada suhu kamar (25°. mual.pusing. perubahan libido.30°C). Dibuat oleh : PT SANBE FARMA Bandung . Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut. sakit punggung. retensi urin. vertigo.: DPL8822208609A1.bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam.Indonesia Anastan CODE: C4 Harga Per Satuan Terkecil : Rp250. reaksi pada kulit. depresi. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. maksimum 4 kaplet sehari.00 ANASTAN (Mefenamic Acid) 500 mg . Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik. sebaik-nya tidak digunakan untuk jangka pahjang. INTERAKSI OBAT : Penggunaan bersama . EFEK SAMPING : Dapat menimbulkan agranulositosis.

Cara penyimpanan : Disimpan di tempat tertutup dan diluar pengaruh cahaya. Enteraksi obat : Dengan obat anti coagulant. Mempengaruhi test urine. nervous dan sakit kepala. karena kemungkinan terjadi" cross sensitivity". albuminiea dan kencing darah.00 Antalgin . terjadi tukak lambung dan pendarahan. Hati . Juga dapat timbul kantuk. aiergik rinrtis atau urticaria karena obat non steroid anti inflamasi yang lain. sakit kepaia. Tiap kapsul mengandung Acidum Mefenamicum 250 mg. Komposisi : Tiap kaplet mengandung Acidum Mefenamicum 500 mg (Anastan Forte). Kemasan : Anastan forte : Dos isi 10 strip @ 10 kaplet. sehingga hemoiytic anemia coombs positif. Efek samping : Dapat timbul diare biasa hingga berat. Posologi : Dewasa dan anak . Wanita mengandung atau sedang menyusui.anak dibawah 14 tahun belum diketahui dengan pasti. Mempengaruhi test darah. : Anastan forte DKL 9207802304 A1 Antalgin CODE: C5 Harga Per Satuan Terkecil : Rp150. nausea dezziness.anak diatas 14 tahun : - Anastan forte jam.Anastan adalah obat yang mengandung Acidum Mefenamicum. sehingga billirubin urine positif dan protein uria positif. Reg. bila cfiare maka pengobatan dihentikan. Juga pada penderita gangguan fungsi ginjal atau pernah menderita sakit ginjal atau hati. Keamanan penggunaan pada anak . Dapat timbul agranucytosis. anemia. Kontra indikasi : Obat kontra indikasi bagi penderita sakit tukak lambung atau inflamasi pada saluran cerna.hati pada penderita yang mendapat bronkospasma. Peringatan dan Perhatian : Dalam pengooatan. Penderita asma. Digunakart tidak lebih dari 7 hari. nyeri sesudah operasi dan dysmenorrhoea primer. mengurangi kerja obat anti coagulant. thrombocytopenia. : Awal 1 kaplet (500 mg) kemudian Vi kaplet (250 mg) tiap 6 Indikasi : Sebagai obat untuk meringankan rasa sakit seperti pada sakit gigi. Dapat timbul asma. Harus dengan resep dokter No. berkhasiat analgesic dan anti inflamasi.

Penderita yang hipersensitif.INJEKSI© . Dosis dan Cara Penggunaan : Melalui mulut (per oral). WanitahamilteTutama^B bulan pertamanaTT6 minggu terakhir. terutama kolik dan sakit setelah operasi. Reg. Efek Samping : Gejala kepekaan yang manifestasinya kelainan pada kulit.30°C (kondisi penyimpanan.Komposisi Tiap tablet mengandung antalgin 500 mg. Kasus porfiria hati (amat jarang) dan defisiensi bawaan glukosa-6-fosfat-dehidrogenase. Peringatan dan Perhatian : Karena dapat menimbulkan agranulositosis yang berakibat fatal. normal). Pada penggunaan jangka panjang dapat menyebabkan agranulositosis. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.:GKL9420906010A1 HARUS DENGAN RESEP DOKTER INDO FARMA BEKASI – INDONESIA Antrain CODE: C6 Harga Per Satuan Terkecil : Rp10. Cara Kerja Obat : Antalgin adalah derivat metansulfonat dan amidopirina yang bekerja terhadap susunan saraf pusat yaitu mengurangi sensitivitas reseptor rasa nyeri dan mempengaruhi pusat pengatur suhu tubuh.200. Antalgin mudah larut dalam air dan mudah diabsorpsi ke dalam jaringan tubuh. Tiga efek utama adalah sebagai analgesik. antipiretik danantiinflamasi. Kemasan dan Nomor Registrasi Antalgin 500 mg. Cara Penyimpanan : Simpan pada suhu 25° . botol 1000 tablet No. maka sebaiknya tidak digunakan terus-menerus dalam jangka panjang.00 ANTRAIN TABLET . Indikasi : Untuk menghilangkan rasa sakit.: GKL9420906010A1 Antalgin 500 mg. Bayi 3 bulan pertama atau dengan berat badandibawah 5 kg. Kontra indikasi : Pada penderita yang alergi terhadap derivat pirazolon. Dewasa : sehari 3 kali 1 tablet. Penderita dengan tekanan darah <100 mmHg.Reg. kotak 10 blister @ 10 tablet No.

maksimum 3 kali sehari. INTERAKSI OBAT : Bila Metamizole Na diberikan bersamaan dengan Chlorpromazine dapat mengakibatkan hipotermia. No. maka sebaiknya tidak digunakan dalam jangka panjang.sindroma bahu lengan.M. Wanita hamil dan menyusui. INDIKASI : Untuk meringankan rasa sakit. PERINGATAN / PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. Karena dapat menimbulkan agranulositosis yang berakibat fatal. Metamizole Na bekerja sebagai analgesik. Penderita dengan tekanan darah sistolik < 100 mmHg. Injeksi : 500 mg jika sakit timbul. KEMASAN : ANTRAIN* Tablet Kotak berisi 10 strip @ 10 tablet Reg. atau I. Mekanisme kerjanya adalah menghambat transmisi rasa sakit ke susunan saraf pusat dan perifer. EFEK SAMPING : Reaksi hipersensitivitas: reaksi pada kulitmisal kemerahan. berikutnya 500 mg tiap 6-8 jam. Bayi di bawah 3 buian atau dengan berat badan kurang dari 5 kg. diberikan secara injeksi I. Pada pemakaian jangka lama dapat menimbulkan sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan.: DKL0117616843A1 JAUHKAN DARI JANGKAUAN ANAK .KOMPOSISI : Tiap tablet mengandung : Metamizole Na 500 mg ANTRAINI Injeksi Tiap ml mengandung: Metamizole Na 500 mg CARA KERJA OBAT : Metamizole Na adalah derivat metansulfonat dari aminopirin yang mempunyai khasiat analgesik. Karena itu perlu dilakukan pemeriksaan fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut.maksimum 4 tablet sehari. diabsorpsi dari saluran pencernaan mempunyai waktu paruh 1-4 jam. gangguan fungsi hati atau ginjal.sakit punggung. KONTRA INDIKASI : Penderita hipersensitif terhadap Metamizole Na.V.ANAK HARUS DENGAN RESEP DOKTER . Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah.lumbago.No. ATURAN PAKAI : Dewasa: Tablet : 1 tablet jika sakit timbul. Agranulositosis.terutama nyeri kolik operasi.bursitis. berikutnya 1 tablet tiap 6-8 jam.:DKL7617611210A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA ANTRAIN* Injeksi Kotak berisi 5 ampul @ 2 ml netto Reg.

mual. kolik. Box 10 Strip @10 Kapsul. Indikasi : untuk meredakan rasa sakit seperti sakit gigi. alergik rinitis. Peringatan dan Perhatian Tidak dianjurkan diberikan pada wanita hamil dan menyusui. nyeri saat melahirkan. usus. nyeri sesudah operasi. ARGESID 500 Tiap Kaplet salut selaput mengandung Asam Mefenamat 500 mg Farmakologi : Asam Mefenamat merupakan anti inflamasi non-steroid. asetosal. Mangundiprojo no. Interaksi Obat : Obat-obatan antikoagulan oral seperti warfarin.100. ruam makulo papular. dismenore. sakit kepala.M. vertigo.00 ARGESID Asam Mefenamat KOMPOSISI : ARGESID 250 Tiap kapsul mengandung Asam Mefenamat 250 mg. sakit kepala. Hati-hati pemberian pada penderita bronkhospasme. pusing. nyeri karena trauma. Dosis : Dewasa dan anak-anak di atas 14 tahun: Dosis awal 500mg kemudian dilanjutkan 250 mg tiap 6 jam. meredakan rasa nyeri seperti nyeri otot. muntah. Indonesia Argesid 500mg Harga Per Satuan Terkecil : Rp1. 1 Buduran. urtikaria atau mendapat pengobatan antiinflamasi non-steroid lainnya. Interbat Jl. Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahui. diare. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase sehingga mempunyai efek analgetik dan antiinflamasi. Kemasan: ARGESID 250. Efek samping : Gangguan saluran cerna seperti iritasi lambung. radang gangguan ginjal. dispepsia. Kontra indikasi : Tukak lambung. Tidak boleh melebihi dosis yang dianjurkan dan lebih dari 7 hari. kecuali atas petunjuk dokter.: DKL0033201I301A1 ARGESID 500 .R.SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA JANGAN DISIMPAN DALAM LEMARI PEMBEKU Diproduksi Oleh : PT. Sidoarjo-61252 Jawa Timur. Reg. karena dapat terjadi sensitivitas silang. Pada penggunaan terusmenerus dengan dosis 2000 mg atau lebih sehari dapat mengakibatkan agranulositosis dan hemolitik anemia. No. H. hipersensitif usus.

Dikontraindikasikan pada pasien yang menunjukkan gejala asthma.Box 10 Strip @10 Kaplet No. Reg. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut. pendarahan gastro-intestinal makroskopik. Insufisiensi hepar yang berat. bersendawa.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. jarang terjadi kolitis. ruam kulit. analgesik. Pada kulit : pruritus. Mekanisme kerja meloxicam sebagai efek anti-inflamasi. x Anakanak dan remaja yang berumur kurang dari 15 tahun. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan. gangguan jumlah sel darah : lekosit. diare. rasa mual. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin.700.5 mg mengandung Meloxicam 7. Anemia. Masa kehamilan dan menyusui. PROMEDRAHARDJO FARMASIINDUSTRI Sukabumi – Indonesia Artrilox 15 CODE: C8 Harga Per Satuan Terkecil : Rp7.konstipasi. urtikaria. jarang terjadi fotosensitisasi. polip dihidung. Pendarahan gastrointestinal. muntah-muntah. stomatitis.: DKL0033201109A1 ( Simpan di tempat sejuk (15-25)°C dan kering ) HARUS DENGAN RESEP DOKTER PROMED PT. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik).00 Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. ulkus gastroduodenal. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. rasa sakit di perut. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. Penghambatan COX2 menentukan efek terapi NSAI. KONTRA INDIKASI : Ulkus lambung yang aktif. terutama . esofagitis. rasa kembung. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. EFEK SAMPING : Saluran cerna : dispepsia. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya. Bila diberikan bersama-sama dengan obat mielotoksik yang potent. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serumkreatinin dan/atau serum urea. Insufisiensi ginjal berat yang tidak didialisa. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1. lekopenia dan trombosito penia.

sindrom nefrotik dan penyakit ginjal.5 mg/hari. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. NSAI jarang menimbulkan nefritis interstitial. hati atau jantung. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. heparin secara sistemik. Sistem susunan saraf pusat : kepala terasa ringan. diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. Pada pasien yang volume & aliran darah ke ginjal menurun.methotrexate. palpitasi. Seperti pada obat-obat NSAI. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. maka harus dimonitor efek - . Kardiovaskuler: edema. akan menyebabkan terjadinya sitopenia. Seperti hal obat-obat NSAI. Bila kondisi ini dalam waktu lama. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. vertigo. Bila pemberian bersama obat anti koagulan tidak dapat dihindari. pusing. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. trombolitik dapat meningkatkan resiko pendarahan. Pada pasien tersebut. Pemberian bersama ticlopidine (anti-koagulan oral). muka kemerahan. ngantuk. Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. peningkatan tekanan darah. dan pada umumnya orang tua menderita gangguan fungsi ginjal. sindrom nefrotik. pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. dosis meloxicam tidak boleh melebihi 7. dianjurkan untuk menghentikan aktivitas. sirosis hati. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. Pernafasan : jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. nekrosis medularis ginjal. glomerulonefritis. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. Pasien yang beresiko tinggi adalah pasien yang dehidrasi. hati ataupun jantung. Seperti halnya obat-obat NSAI lainnya. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. pasien dengan gagal jantung kongestif. Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. tinitus.

00 .5 mg/hari tergantung respon klinis. sehingga akan mempercepat eliminasi meloxicam. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEPDOKTER Diproduksi oleh: COMBIPHAR BANDUNG-INDONESIA http://www. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. Pada pasien yang dehidrasi.Reg.farmasiku. ACE inhibitor. Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7. KEMASAN : Artrilox 7. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker. DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari. Osteoartritis:7. vasodilator.5 CODE: C7 Harga Per Satuan Terkecil : Rp4. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak. 2 Strip @ 10 Tablet No.antikoagulan.5 mg per hari. dianjurkan untuk memonitor jumlah sel darah.Reg. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut. sehingga perlu dimonitor fungsi ginjal.700. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari.5 mg/hari.5 mg Tablet Box. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate. Dosis terapeutik dapat dikurangi sampai 7. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium.5 mg per hari. 2 Strip @ 10 Tablet No. Kontrasepsi : menurunkan efektivitas alat KB IUD. Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi.com Artrilox 7. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN. Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam.DKL9904125810A1 Artrilox 15 mg Tablet Box. Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya. Artritis reumatoid :15 mg/hari. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi. Tablet harus ditelan dengan air/minuman pada waktu makan.

KONTRA INDIKASI : Ulkus lambung yang aktif. Masa kehamilan dan menyusui. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin. EFEK SAMPING : Saluran cerna : dispepsia. rasa sakit di perut. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik). CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. Insufisiensi hepar yang berat. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut.BELI Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. rasa kembung. diare. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). polip dihidung. konstipasi. Mekanisme kerja meloxicam sebagai efek anti-inflamasi. Insufisiensi ginjal berat yang tidak didialisa. ulkus gastroduodenal. x Anakanak dan remaja yang berumur kurang dari 15 tahun. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya. rasa mual. analgesik. esofagitis. Penghambatan COX2 menentukan efek terapi NSAI. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1. jarang terjadi kolitis.5 mg mengandung Meloxicam 7. Pendarahan gastrointestinal. pendarahan gastro-intestinal makroskopik. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. bersendawa. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serum kreatinin . muntah-muntah.

pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. lekopenia dan trombosito penia. nekrosis medularis ginjal. ruam kulit. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. Seperti halnya obat-obat NSAI lainnya. palpitasi. Sistem susunan saraf pusat : kepala terasa ringan. diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. sirosis hati. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. Pada kulit : pruritus. tinitus. Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). Pasien yang beresiko tinggi adalah pasien yang dehidrasi. peningkatan tekanan darah. jarang terjadi fotosensitisasi. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. pusing. ngantuk. sindrom nefrotik. gangguan jumlah sel darah : lekosit. hati atau jantung. akan menyebabkan terjadinya sitopenia. dan pada umumnya orang tua menderita gangguan fungsi ginjal. urtikaria. terutama methotrexate. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. Pernafasan:jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. pasien dengan gagal jantung kongestif. Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. Anemia. NSAI jarang menimbulkan nefritis interstitial. glomerulonefritis. Kardiovaskuler : edema. Bila diberikan bersama-sama dengan obat mielotoksik yang potent. dianjurkan untuk menghentikan aktivitas. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. muka kemerahan. dosis meloxicam tidak boleh melebihi 7. stomatitis. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. sindrom nefrotik dan penyakit ginjal. hati ataupun jantung. - - - - . Seperti hal obat-obat NSAI. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. Bila kondisi ini dalam waktu lama.5 mg/hari.- dan/atau serum urea. Pada pasien yang volume & aliran darah ke ginjal menurun. Pada pasien tersebut. Seperti pada obat-obat NSAI. vertigo.

5 mg/hari tergantung respon klinis. Bila pemberian bersama obat anti koagulan tidak dapat dihindari. sehingga perlu dimonitor fungsi ginjal. Pada pasien yang dehidrasi. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi. Artritis reumatoid :15 mg/hari. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate. Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7. Dosis terapeutik dapat dikurangi sampai 7. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium. trombolitik dapat meningkatkan resiko pendarahan.5 mg per hari. sehingga akan mempercepat eliminasi meloxicam. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari.5 mg per hari.5 mg/hari. maka harus dimonitor efek antikoagulan. dianjurkan untuk memonitor jumlah sel darah. ACE inhibitor. Kontrasepsi : menurunkan efektivitas alat KB IUD. Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak. vasodilator. Tablet harus ditelan dengan air/minuman pada waktu makan. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi. Pemberian bersama ticlopidine (anti-koagulan oral). heparin secara sistemik.INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. . Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7. Osteoartritis:7. - - - DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut.

Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya. 2 Strip @ 10 Tablet No.5 mg Tablet Box. POSOLOGI : Dewasa dan anak diatas 14 tahun Dosis awal dianjurkan 500 mg kemudian dilanjutkan250 mg tiap jam sesudah makan. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEP DOKTER Di produksi oleh: COMBIPHAR BANDUNG-INDONESIA Asam Mefenamat Kapsul 250 mg. KOMPOSISI : Tiap kapsui mengandung 250 mg Asam mefenamat "Flap kaplet 500 mg salut selaput mengandung 500 mg Asam mefenamat.DKL9904125810A1 Artrilox 15 mg Tablet Box.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN. Kaplet 500 mg. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2.Reg. 2 Strip @ 10 Tablet No. INDIKASI : . KEMASAN : Artrilox 7.Reg.

muntah. Keamanan penggunaan pada anak-anak dibawah umur 14 tahun belum diketahui dengan pasti. No Reg GKL 9830010709 A1 CARA PENYIMPANAN : Simpan ditempat kering dansejuk.penderita ginjal dan penderita yang hipersensitif.Indonesia Asimat CODE: C10 Harga Per Satuan Terkecil : Rp800. nyeri otot. EFEK SAMPING : Umumnya Asam Mefenamat dapat dibenkan dengan baik pada dosis yang dianjurkan. termasuk nyeri karena trauma. PHYTO KEMO AGUNG FARM A Jakarta . urticaria atau mendapat obat non steroid anti-inflamasi yang lain karena kemungkinan terjadi sensitiyitas silang Jangan digunakan pada wanita hamil dan menyusui. KONTRA INDIKASI : Pada penderita dengati tukak lambung / usus.T. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. P. Reg : GKL9930011201 A1 Kaplet 500 mg : Dus 10 strip® 10 Kaplet . pada penggunaan jangka panjang yang terus menerus dengan dosis 2000 mg atau lebih sehan dapat mengakibatkan agranulositosis dan hemolitik anemia. terhindar dari cahaya. No. nyeri sewaktu haid. Jangan digunakan lebih dan dosis yang dianjurkan atau lebih dari 7 hari kecuali atas petunjuk dokter. sakit sehabis operasi dan melahirkan. pendenta asma.00 BELI ASIMAT 500 . nyeri sendi. KEMASAN : Kapsul 250mg : Dus 10 strip® 10 Kapsui .Untuk menghitangkan segala macam nyeri dan ringan sampai sedang dalam kondisi akut dan kronis. sakit kepala dan sakit gigi. PERINGATAN DAN PERHATIAN : Jangan dibenkan pada penderita bronkospasme aliergik rhinitis. Harus dengan resep dokter. diare.

muntah dan diare. penderita asma.KOMPOSISI : Tiap kaplet salut selaput ASIMAT500 mengandung Mefenamic Acid 500 mg CARA KERJA : Mefenamic Acid adalah suatu analgetik yang mempunyai daya anti-inflamasi. nyeri sewaktu haid. sakit kepala dan sakit gigi. nyeri otot. pusing. penderita ginjal dan penderita yang hipersensitif terhadap Mefenamic Acid. perdarahan lambung. . termasuk nyeri karena trauma. Agranulositosis dan hemolitik anemia mungkin dapat terjadi pada penggunaan dalam jangka waktu lama yang terus menerus dengan dosis 2000 mg atau lebih sehari. INDIKASI : Untuk mengurangi nyeri dari ringan sampai sedang dalam kondisi akut dan kronis. sakit sehabis melahirkan. POSOLOGI / DOSIS : Dewasa dan anak-anak > 14 tahun : Dosis oral yang dianjurkan 500 mg kemudian dilanjutkan 250 mg setiap 6 jam jika diperiukan. KONTRA INDIKASI : Pada penderita dengan tukak lambung / usus. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. EFEK SAMPING : Efek samping yang timbul umumnya dapat ditolerir dengan baik pada dosis yang dianjurkan.

550. allergic rhinitis. CARA PENYIMPANAN : Simpan di tempat sejuk dan kering. PENGEMASAN DAN NOMOR REGISTRASI Box.PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. Keamanan pengguhaan pada anak-anak di bawah 14 tahun belum diketahui dengan pasti. No.Indonesia BlI-24/02/05 AULIN TABLET 100 MG Harga Per Satuan Terkecil : Rp4. Jangan digunakan pada wanita hamil dan menyusui. Reg. DKL9833300909A1 HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT.00 BELI AULIN TABLET 100 MG KOMPOSISI : Tiap tablet mengandung Nimesulide 100 mg URAIAN : . MERSIFARMATM Sukabumi . Jauhkan obat dari jangkauan anak-anak. 10 strip @ 10 kaplet salut selaput ASIMAT 500. terlindung dari cahaya matahari. urticaria atau mendapat obat nonsteroid anti-inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. Jangan digunakan lebih dari dosis yang dianjurkan atau lebih dari 7 hah kecuali atas petunjukdokter. INTERAKSI OBAT : Antikoagulan oral.

250.Penggunaan pada anak-anak KEMASAN & NO REG. DOSIS & CARA PEMAKAIAN : .Aulin tidak dianjurkan digunakan pada anak-anak dibawah 12 tahun KONTRA INDIKASI : . atau pendarahan gastrointetinal.Pasien dengan insufisiensi hepar sedang atau berat .Pasien dengan riwayat reaksi hipersensitif (seperti bronkospasme.Pasien dengan tukak lambung atau usus. atau pendarahan aktif lainnya atau gangguan pendarahan .Orang dewasa 1 tablet 2xsehari setelah makan (1 tablet 100 mg) .Pasien yang diketahui hipersensitif terhadap Nimesulide . analgesika.00 BELI BENOSTAN tab KOMPOSISI Mefenamic acid/Asam mefenamat . .ulserasi berulang. pendarahan serebrovaskular. Setiap box berisi 2 blister @ 10 tablet 100 mg Nimesulide.4-NITRO-2-phenoxymethane sulponanilide INDIKASI : Aulin merupakan suatu obat anti inflamasi non steroid untuk berbagai kondisi yang membutuhkan anti inflamasi. rasa nyeri dan inflamasi setelah intervensi bedah dan setelah trauma akut dan dismenoria. antipiretika seperti osteoarthritis penyakit rematikekstra-artikular.rhinitis. DKI 0051900210A1 PABRIK : Helsinn Birex Pharmaceuticals HARUS DENGAN RESEP DOKTER Benostan 500 Harga Per Satuan Terkecil : Rp1. urticaria) terhadap OAINS dan acetosal .Pasien dengan gangguan koagulasi berat .Pasien dengan kelainan fungsi ginjal berat (CCT <30 ml/menit) .

KONTRA INDIKASI Ulkus peptikum atau ulserasi usus. pusing. asma. sakit kepala. demam. mengantuk. dehidrasi. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin.5 mg/kg berat badan/hari dalam 3-4 dosis terbagi. Interaksi obat : antikoagulan oral. penyakit radang usus besar. 3 kali sehari 500 mg. migren. . ruam kulit. kerusakan hati atau ginjal. ulkus peptikum. KEMASAN Tablet 500 mg 10stp DOSIS • Dewasa Anak berusia 6 bulan atau • lebih Dismenore (nyeri saat • haid). EFEK SAMPING Gangguan & perdarahan saluran pencernaan. nyeri rematik PENYAJIAN Dikonsumsi bersamaan dengan makanan : : : 3 kali sehari 250 -500 mg. 6.gangguan penglihatan. penyakit ginjal.INDIKASI Nyeri. gugup. epilepsi. diskrasia darah. INDEKS KEAMANAN PADA WANITA HAMIL Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. PERHATIAN Kehamilan.

500 mg. sakit gigi. TAKARAN PEMAKAIAN : Dewasa dan anak-anak > 14 tahun: Dosis awai: 500 mg. Penderita dengan gangguan ginjal yang berat. KONTRA INDIKASI : Pasien yang hipersensitif terhadap Mefenamie Acid.PABRIK Bernofarm. INDIKASI : Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala. Penderita dengan tukak lambung dan usus. kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. nyeri otot dan nyeri sesudahoperasi. Penderita yang dengan Asetosal mengalami bronkospasme. termasuk nyeri karena trauma. . Bimastan CODE: C11 Harga Per Satuan Terkecil : Rp200. anti infiamasi dan antipiretik. dismenore primer. 250 mg. CARA KERJA OBAT : Bimastan merupakan kelompok anti inflamasi non steroid. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik. alergi rhinitis dan urtikaria. muntah.00 BELI BIMASTAN© KOMPOSISI : Tiap kapsul mengandung: MefenamicAcid Tiap kaptab salut selaput mengandung: MefenamicAcid Tiap kaptab mengandung: MefenamicAcid 500 mg. diare dan rasa sakit pada abdominal. EFEK SAMPING : Sistem pencernaan : mual.

-

Sistem hematopetik : leukopenia, eosinophilia, trombocytopenia dan agranulocytopenia. Sistem saraf : rasa mengantuk, pusing, penglihatan kabur dan insomnia.

PERINGATAN DAN PERHATIAN : Sebaiknya diminum sesudah makan. Hati-hati digunakan pada wanita hamil dan menyusui. Keamanan penggunaan pada anak - anak dibawah 14 tahun belum diketahui dengan pasti. KONTRA INDIKASI : Penggunaan bersama antikoagulan oral dapat memperpanjang "Prothrombin".

OVER DOSIS : Jika terjadi over dosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbon absorben) untuk menyerap obat. KEMASAN : Dus isi 10strip® "10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 10 strip @ 10 kaptab No. Reg. DKL 8931402104 A1 Dus isi 50 blister @ 10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 40 blister @ 10 kaptab salut selaput No. Reg. DKL 9731407209 A1 Dus isi 10 blister @ 10 kaptab salut selaput No. Reg. DKL 0431407209 A1 Botol isi 1.000 kapsul No. Reg. DKL 8931402001 A1

250mg 500 mg 250 mg 500 mg 500 mg 250 mg

SIMPAN DITEMPAT SEJUK (15 - 25)°C DAN KERINGTERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT. BIMA MITRA FARMA TANGERANG - INDONESIA Bio mega CODE: C12

Harga Per Satuan Terkecil : Rp300.00 BELI BIO MEGA

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiro Vitamin B1 Vitamin B6 Vitamin B12 INDIKASI :

500 mg 50 mg 50 mg 100 mcg

Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat. KONTRA INDIKASI : * * * * Penderita hipersensitif Bayi di bawah 3 bulan, atau dengan berat badan di bawah 5 kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg

EFEK SAMPING : Agranulositosis, reaksi kepekaan, mengantukdan pusing."

PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu, lengan. Karena dapat menimbulkan agranulositosis yang berakibat fatal, maka sebaiknya tidak digunakan dalam jangka panjang terusmenerus. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius.

DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput.

KEMASAN : Dus, isi 10 strip @ 10 tablet salut selaput NO. REG. DKL9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT. GRAHA FARMA SOLO - INDONESIA Biomega 10 Kaplet Harga Per Satuan Terkecil : Rp300.00 BELI Biomega

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiron Vitamin B1 Vitamin B6 Vitamin B12

INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat.

KONTRA INDIKASI :

PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. sakit punggung. REG. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius.00 BELI BIROPYRON Kaplet Salut Selaput . gangguan fungsi hati atau ginjal. isi 10 strip @ 10 tablet salut selaput NO. bursitis. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.INDONESIA Biropyron Harga Per Satuan Terkecil : Rp300.atau dengan berat badan dibawah 5kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg EFEK SAMPING : Agranulositosis.- Penderita hipersensitif Bayi dibawah 3bulan. sindroma bahu. DKL 9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT. KEMASAN : Dus. GRAHA PARMA SOLO . reaksi kepekaan. mengantuk dan pusing. lengan. DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput. lumbago.

sindroma bahu lengan. karena itu perlu dilakukan pemeriksaan uji fungsi hati atau ginjal dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. KEMASAN: Dus isi 10 Strip® 10 Kaplet No. Reg.Karena dapat menimbulkan agranulositosis dan berakibat fatal. DKL0231406809 A2 Botol isi 1.hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.00 BELI BODREX .Pada pemakaian jangka lama dapat timbul sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan. PERINGATAN DAN PERHATIAN: . .000 kaplet No. DKL0231406809 A1 SIMPAN DITEMPAT SEJUK (15-25)°C DAN KERING TERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT. lumbago. bursitis. gangguan fungsi hati.Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. misalnya kemerahan dan agranulositosis. BIMA MITRA FARMA TANGERANG .Hati. Reg. DOSIS: 1 kaplet 3x sehari . ginjal.Wanita hamil dan menyusui .Penderita hipersensitif .INDONESIA Bodrex CODE: C13 Harga Per Satuan Terkecil : Rp5.Penderita dengan tekanan darah sistolik < 100 mm Hg EFEKSAMPING: Reaksi hipersensitif pada kulit. KONTRA INDIKASI: . maka sebaiknya tidak digunakan dalam waktu panjang dan terus menerus. sakit punggung.KOMPOSISI: Tiap kaplet salut selaput mengandung: Methampyrone 500 mg Thiamine HCl 50 mg Pyridoxine HCl 100 mg Cyanocobalamine 100 mcg INDIKASI: Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia. .500. .

SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. . SAKIT GIGI dan menurunkan DEMAM. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. dapat meningkatkan resiko kerusakan fungsi hati. INDIKASI : Meringankan SAKIT KEPALA. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. • Reaksi hipersensitifitas. • Penderita Hipersensitif. sakit gigi.Meringankan SAKIT KEPALA. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. segera hubungi dokter/unit pelayanan kesehatan terdekat.

............50 mg CARA KERJA OBAT paracetamol merupakan analgetik-antipiretik dan ibuprofen merupakan obat golongan analgetik-antipiretik dan anti inflamasi non steroid (AINS) yang memiliki efek analgetik(menghilangkan rasa nyeri)..............00 BELI BODREX EXTRA KOMPOSISI tiap tablet mengandung : paracetamol...700.....SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg..... Bekasi-lndonesia atas lisensi dari DR.. DBL 8522700810 A1 Dibuat oleh P............. PHARM... FRITZ BODE GmbH/ CHEM. FABRIK / Rheinfelden / Germany P91108000 Bodrex Extra CODE: C111 Harga Per Satuan Terkecil : Rp3.. No........350 mg ibuprofen...antipiretik(demam) dan anti inflamasi(mengurangi proses peradangan).T......efek analgesik dari paracetamol dan ibuprofen bejerja sinergis dengan caffeine dalam meredakan sakit kepala INDIKASI .. TEMPO SCAN PACIFIC Tbk.200 mg caffeine.....

00 BELI BODREX Meringankan SAKIT KEPALA. 3-4 kali sehari EFEK SAMPING gangguan saluran cerna seperti mual.meredakan sakit kepala DOSIS dan ATURAN PAKAI dewasa dan anak-anak >12 tahun : 1-2 kaplet.nyeri ulu hati. 3-4 kali sehari anak-anak 6-12 tahun : 1/2-1 kaplet.kemerahan pada kulit dan gangguan darah INTERAKSI OBAT efek toksik dari paracetamol dapat meningkat pada pemberian bersam-sama dengan obat yang menyebabkan kerusakan hati SIMPAN PADA SUHU DI BAWAH 30'C Reg.muntah.Tempo Scan Pacific Tbk.DTL0622719204A1 PT. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : . Bekasi-Indonesia Bodrex Flu batuk CODE: C14 Harga Per Satuan Terkecil : Rp1.No.200.

INDIKASI : Meringankan SAKIT KEPALA. • Penderita Hipersensitif.Parasetamol Kofein CARA KERJA OBAT : 600 mg 50 mg bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. sakit gigi. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. dapat meningkatkan resiko kerusakan fungsi hati. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg. segera hubungi dokter/unit pelayanan kesehatan terdekat. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. No. DBL 8522700810 A1 Dibuat oleh . PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. • Reaksi hipersensitifitas. SAKIT GIGI dan menurunkan DEMAM.

PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. PHARM. FRITZ BODE GmbH/ CHEM. dapat . Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam.T. INDIKASI : Meringankan SAKIT KEPALA. • Penderita Hipersensitif. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. TEMPO SCAN PACIFIC Tbk. SAKIT GIGI dan menurunkan DEMAM.300.00 BELI BODREX Meringankan SAKIT KEPALA. FABRIK / Rheinfelden / Germany P91108000 Bodrex migra CODE: C15 Harga Per Satuan Terkecil : Rp1. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol.P. sakit gigi. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. Bekasi-lndonesia atas lisensi dari DR. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. • Reaksi hipersensitifitas. segera hubungi dokter/unit pelayanan kesehatan terdekat.

Sistem saraf: rasa mengantuk................ DBL 8522700810 A1 Dibuat oleh P. . 500 mg Tiap kapsul mengandung Asam Mefenamat.• meningkatkan resiko kerusakan fungsi hati... dismenore primer... KONTRA INDIKASI: . . nyeri otot dan nyeri sesudah operasi.... PHARM. .. 500 mg Asam Mefenamat merupakan kelompok anti-inftamasi non steroid. Bekasi-lndonesia atas lisensi dari DR.........00 BELI Cargesik KOMPOSISI: Tiap kaplet mengandung Asam Mefenamat.......Penderita dengan gangguan ginjal yang berat..... diare dan rasa sakit pada abdominal....... EFEK SAMPING : ........ PERINGATAN DAN PERHATIAN : ...... FRITZ BODE GmbH/ CHEM... alergi rhinitis dan urtikaria.... termasuk nyeri karena trauma... penglihatan kabur dan insomnia......Sebaiknya diminum sesudah makan.... INDIKASI Meredam nyeri ringan sampai sedang sehubungan dengan sakit kepala. trombocytopenia dan agranulocytopenia......... anti-inflamasi dan antipiretik...... muntah....... Hati-hati penggunaan obat ini pada penderita penyakit ginjal......T.... No.. .. eosinophilia. FABRIK / Rheinfelden / Germany P91108000 Cargesik 500 Kaplet CODE: C111 Harga Per Satuan Terkecil : Rp250...... .Penderita yang hipersensitif terhadap asam mefenamat..... .... sakit gigi.Sistem hematopoetik : Leukopenia.... bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik. pusing........ SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg.Penderita yang dengan aspirin mengalami bronkospasme...Penderita dengan tultaK lambung dan usus... TEMPO SCAN PACIFIC Tbk...Sistem pencemaan : mual..

Hati-hati jika digunakan pada wanita hamil dan menyusui. .Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahul dengan pasti.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik. Reg. Dengan ramuan yang berhasil itu.Dus. Pemakaian sebaiknya sesudah makan. Prof. dengan melalui percobaan selama bertahun . Reg. kemudian dianjurion 250 mg tiap 6 jam sesuai dengan kebutuhan. Atau menurut petunjuk dokter. Pill ini cocok untuk : Sakit pinggang. encok pada pangkal paha. USA.Indonesia Carroll Super Pills Botol CODE: C17 Harga Per Satuan Terkecil : Rp11. DOSIS: Secara umum-dapat digunakan dosis pemakaian sebagai berikut: Dewasa dan anak-anak > 14 tahun : Dosis awal: 500 mg. Dokter Carroll.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof.Dus. isi 10 blister @ 10 kaplet No. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan.Botol plastik @ 500 kapsul No. .30)°C Semarang .. : DKL 9123401701 Al .: DKL 9323402504 A2 HARUS DENGAN RESEP DOKTER SIMPAN PADA SUHU KAMAR (25 . INTERAKSI OBAT : Penggunaan bersamaan antikoagulan oral dapat memperpanjang "prothrombln*. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan. rheumatik atau sering buang air diwaktu malam. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide. Reg. Reg. KEMASAN & No. isl 10 strip @ 10 kaplet No.000. OVERDOSIS: Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktlf (karbo adsorben) untuk menyerap obat. Cara pemakaian : Dewasa : .: DKL 9323402504 Al .

250. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan. 2 kali sehari. diminum dengan air hangat. dan tidak menguatirkan. warna kencing menjadi biru atau hijau. PERHATIAN : Setelah menelan pill ini. Dokter Carroll. pemakaian : makan.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik. No. Keadaan yang sedikit berat boleh makan : 2 pill sebelum makan. 1 pill sebelum tidur. Dengan ramuan yang berhasil itu. USA. dengan melalui percobaan selama bertahun . diminum dengan air hangat. Reg. 3 kali sehari. diminum 2 dengan kali air sehari. Prof. Dianjurkan minum banyak air. encok pada pangkal paha. : . rheumatik atau sering buang air diwaktu malam.1 pill sebelum makan. Cara Dewasa 1 1 pill pill sebelum sebelum tidur. hangat. Perubahan warna ini adalah reaksi normal.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. Pill ini cocok untuk : Sakit pinggang. 2 pill sebelum tidur. D 7811980 DIPRODUKSI OLEH : ARTOIS FARMA TANGERANG .INDONESIA Carroll Super Pills Sachet CODE: C16 Harga Per Satuan Terkecil : Rp1. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan.

50 mg/tablet. pusing atau vertigo.Keadaan 2 pill 2 pill Dianjurkan PERHATIAN yang sedikit berat makan. OLEH : FARMA . hangat. Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi Efek samping : kadang-kadang nyeri epigastrium. Perubahan warna ini adalah reaksi normal. Reg. air. Kemasan : Dos 5x10 tablet 25 m.00 BELI Cataflam Kalium diklofenak 25 mg.INDONESIA CATAFLAM 25 CODE: C30 Harga Per Satuan Terkecil : Rp2. No. Tidak boleh untuk anak. : sebelum sebelum tidur. warna kencing menjadi biru atau hijau. sakit kepala. minum Setelah menelan pill ini. dan tidak menguatirkan. Dosis : Dewasa : awal :100-150 mg sehari. diminum boleh 3 dengan banyak makan kali air : sehari.300. D 7811980 DIPRODUKSI ARTOIS TANGERANG . ruam kulit.

sakit kepala.00 BELI Cataflam Kalium diklofenak 25 mg.00 BELI CATAFLAM D KANDUNGAN : Diclofenac / Diklofenak. Tidak boleh untuk anak. Cataflam D 50 Harga Per Satuan Terkecil : Rp4. osteoartritis (penyakit sendi degeneratif yang disertai dengan kelainan tulang .350. pusing atau vertigo. 50 mg/tablet. INDIKASI : Pengobatan jangka pendek pada peradangan & nyeri sesudah operasi. Kemasan : Dos 5x10 tablet 50 m. keadaan meradang setelah trauma (terpukul/terbentur/teririrs) yang disertai rasa sakit/nyeri.CATAFLAM 50 CODE: C31 Harga Per Satuan Terkecil : Rp4. ruam kulit. Efek samping : kadang-kadang nyeri epigastrium. Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi. Dosis: Dewasa : awal : 100-150 mg sehari.200.

pusing. gout akut. diuretika. purpura (keadaan yang ditandai dengan bercak-bercak perdarahan dalam kulit atau selaput lendir). • Gangguan fungsi hati. • Porfiria. Digoksin. • Kasus-kasus tertentu : gangguan perasaan atau penglihatan. perdarahan lambung-usus. • Hamil. meningitis aseptik. reaksi hipersensitifitas. DOSIS : • Dewasa: dosis awal 2-3 tablet.berdekatan). diskrasia darah. sindroma Lyell. jantung. . peningkatan serum transaminase. sindroma Stevens-Johnson. • Jarang : ulkus peptikum. atau ginjal. abnormalitas fungsi ginjal. gangguan sistem kardiovaskular (jantung dan pembuluh darah). • Usia lanjut. • Kemampuan mengendarai & menggunakan mesin mungkin terpengaruh. • Anak berusia lebih dari 14 tahun : 2 tablet. PERHATIAN : • Gejala/riwayat penyakit lambung-usus. • Asma. reumatisme non artikular & sindroma nyeri pada tulang belakang. eritema multiform. INDEKS KEAMANAN PADA WANITA HAMIL : Baik penelitian reproduksi hewan tidak menunjukkan risiko pada janin maupun penelitian terkendali pada wanita hamil atau hewan coba tidak memperlihatkan efek merugikan (kecuali penurunan kesuburan) dimana tidak ada penelitian terkendali yang mengkonfirmasi risiko pada wanita hamil semester pertama (dan tidak ada bukti risiko pada trisemester selanjutnya). EFEK SAMPING : • Kadang-kadang : gangguan saluran pencernaan. Dianjurkan untuk memonitor secara teratur fungsi hati & hitung darah selama • penggunaan jangka panjang. vertigo. sakit kepala. Interaksi obat : Lithium. Metotreksat. antikoagulan. • Kehilangan volume ekstraseluler. ruamkulit. eritroderma. pneumonitis. Siklosporin. antidiabetes oral. KEMASAN : Tablet 50 mg x 50 biji. hepatitis. menyusui. KONTRA INDIKASI : Ulkus lambung atau usus. penyakit Crohn. pankreatitis.

pruritus dan depresi. KONTRA INDIKASI : Hipersensitif terhadap diclofenac. Selain anti inflamasi.Diberikan dalam 2-3 dosis terbagi. seperti operasi gigi atau tulang. nyeri dan demam. juga menunjukkan efek analgesik pada nyeri sedang dan berat. hidung atau tenggorokan. INDIKASI : Sebagai pengobatan jangka pendek untuk kondisi-kondisi akut seperti: Nyeri inflamasi setelah trauma. Sebagai ajuvan pada nyeri inflamasi yang berat dari infeksi telinga. sakit kepala. seperti terkilir. SGPT. Peptic ulcer. peptic ulcer. Bekerja menghambat biosintesa pros-taglandin yang merupakan faktor terbesar penyebab inflamasi. PABRIK Novartis. EFEK SAMPING : Gangguan pada saluran pencernaan. Kadang-kadang peningkatan enzim SGOT. vertigo.400.00 BELI CATANAC KOMPOSISI : Tablet CATANAC 25 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac1 Tablet CATANAC 50 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac FARMAKOLOGI : Kalium Diclofenac merupakan anti inflamasi yang bukan golongan steroid. PERINGATAN DAN PERHATIAN : . Nyeri dan inflamasi setelah operasi. Catanac 50mg CODE: C18 Harga Per Satuan Terkecil : Rp2.

TAKARAN PEMAKAIAN : Dewasa : 100-150 mg dibagi atas 2-3 kali sehari. Kasus ringan dan anak lebih dari 14 th : 75-100 mg dibagi atas 2-3 kali sehari. SOHO INDUSTRI PHARMASI Jakarta . INTERAKSI OBAT : Bila diberikan bersama produk lain yang mengandung Lithium. Pada pemakaian jangka panjang. sebaiknya dilakukan pemeriksaan fungsi hati dan darah secara periodik.950.Indonesia CELEBREX 100 CODE: C32 Harga Per Satuan Terkecil : Rp7. Reg. Reg.T. DKL 9806707515A1 Dus 30 tablet CATANAC 50 mg (3 strip @ 10 tablet salut enterik) No. Methotrexate.Indonesia Untuk: P. ETHICA Jakarta .00 BELI Celebrex Selekoksib 100 mg. KEMASAN : Dus 30 tablet CATANAC 25 mg (3 strip @ 10 tablet salut enterik) No. DKL 9806707515B1 HARUS DENGAN RESEP DOKTER SIMPAN Dl TEMPAT SEJUK DAN KERING Dibuat oleh : P. Bila diberikan bersama Neomycin. tukak lambung.Penderita dengan riwayat gangguan saluran cerna.T. gangguan fungsi jantung dan ginjal. . Tidak dianjurkan untuk wanita hamil dan menyusui. dapat mempengaruhi/mengurangi efek kedua obat ini. Bila diberikan bersama diuretik dan B Bloker. diclo-fenac akan mempertinggi konsentrasi obat-obat tersebut dalam plasma. Cholestiramin dan liquid parafin. akan berkurang absorbsinya. 200mg. Cyclosporin atau Digoxin.

Efek samping : Intoksikasi saluran cerna. Cetalgin Harga Per Satuan Terkecil : Rp850. Perihal : Dapat menyebakan intoksikasi saluran cerna. Kemasan : Dos 3x10 kapsul 100 mg. Kontra Indikasi : Hipersensivitas. intoksikasi sistem saraf periferal. reaksi anafilaktik. artritis reumatoid 2x sehari 100200 mg. pasien penderita asma. urtikaria.00 BELI CETALGIN-T KOMPOSISI : Na Metamizol 500 mg .. jangan diberikan pada wanita hamil karena dapat menyebabkan kelahiran prematur. Dosis : Osteoartritis:1x sehari 200 mg atau 2z sehari 100 mg.Indikasi: penobatan ostoeartritis dan artritis rematoid. intoksikasi kardovaskuler.

perdarahan lambung-usus. 1-2 kali sehari &frac12-1 kaplet. porfiria. EFEK SAMPING : Reaksi alergi. neuralgia. KEMASAN : Kaplet 10 x 10 biji. Interaksi obat : Klorpromazin. PENYAJIAN : Dikonsumsi bersamaan dengan makanan PABRIK: Soho Cetalmic 500 mg CODE: C19 Harga Per Satuan Terkecil : Rp1. KONTRA INDIKASI : Kelainan perdarahan. sakit pinggang. rasa sakit/nyeri yang berkaitan dengan penyakit lainnya. agranulositosis.Vitamin B1 Vitamin B6 Vitamin B12 Kafein INDIKASI : 60 mg 15 mg 15 mg 50mg Sakit kepala.00 BELI CETALMICT . DOSIS • Dewasa • Anak berusia 8-12 tahun 3 kali sehari 1 kaplet. PERHATIAN : Hipersensitif terhadap Aspirin.100.

KOMPOSISI : • CETALMIC® 250 kapsul Tiap kapsul mengandung asam mefenamat 250 mg • CETALMIC® 500 kaplet salut selaput Tiap kaplet mengandung asam mefenamat 500 mg FARMAKOLOGI : CETALMIC® mengandung asam mefenamat yang mempunyai khasiat analgesik. penderita yang hipersensitif. Asam mefenamat cepat diabsorpsi. asam mefenamat merupakan satu-satunya derivat fenamat yang memiliki daya kerja baik central maupun perifer. Jangan digunakan pada wanita hamil/menyusui. nyeri otot. rhinitis alergi atau mendapat obat non steroid anti inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. nyeri trauma. kadar puncak tercapai setelah 2 jam. Juga sebagai antipiretik pada keadaan demam. INDIKASI : Untuk menghilangkan berbagai rasa sakit dan nyeri dari ringan sampai sedang termasuk sakit kepala. penderita asma. perdarahan lambung. PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. sakit gigi. anti inflamasi dan antipiretik. KONTRA INDIKASI : Penderita tukak lambung/usus. Asam mefenamat terikat sangat kuat pada protein plasma. diare. penderita ginjal. Keamanan pada anak-anak dibawah 14 tahun . Kira . Sebagai analgesik. agranulasitosis. pusing. EFEK SAMPING : Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. waktu paruh dalam plasma adalah 3-4 jam. nyeri haid. nyeri setelah operasi dan melahirkan. hemolotik anemia. muntah.kira 50% diekskresi dalam urine dan 20% ditemukan dalam faeces.

angioedema or exacerbation of nasal polyps. CYBUFEN may also be used for other painful inflammatory conditions CONTRAINDICATIONS CYBUFEN should not be used in patients who have exhibited hypersensitivity during previous administration.00 BELI INDICATIONS CYBUFEN is indicated for acute and long-term use in the relief of signs and symptoms of osteoarthritis and rheumatoid arthritis.050. urticaria. Danalgin CODE: C20 Harga Per Satuan Terkecil : Rp1.350. dilanjutkan 250 mg tiap 6 jam. 10 strip @ 10 kaplet salut selaput DKL 9224209509A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH SUHU 30°C TERLINDUNG DARI CAHAYA PT SOHO INDUSTRI PHARMASI JAKARTA-INDONESIA Cybufen 300mg Harga Per Satuan Terkecil : Rp5.00 BELI Danalgin Metampiron Diazepam . CYBUFEN should not be given to patients in whom aspirin or other nonsteroidal anti-inflammatory drugs have induced an asthmatic syndrome. KEMASAN : • CETALMIC® 250 mg kapsul Box. CYBUFEN is also contraindicated in patients with active peptic ulcer. Due to the possibility of cross sensitivity. Sebaiknya diberikan pada waktu makan. rhinitis. 10 strip @ 10 kapsul DKL9224209401A1 • CETALMIC8 500 mg kaplet salut selaput Box. Jangan digunakan lebih dari 7 hari kecuali atas petunjuk dokter.belum diketahui dengan pasti. TAKARAN PEMAKAIAN : Dewasa dan anak di atas 14 tahun : Dosis awal 500 mg.

Karena dapat menimbulkan agranulositosis yang berakibat fatal. Konsentrasi plasma puncak diazepam dicapai setelah 15 . Ttdak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. maka sebaiknya tidak digunakan dalam jangka panjang terus menerus. bursitis.4 jam. sindroma bahu-lengan. Penderita dengan tekanan darah sistolik < 100 mmHg. Gangguan pulmoner akut. Keadaan psikosis akut. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/ kelainan darah. Waktu paruh bervariasi antara 20-70 jam. usia lanjut dan penderita dengan gangguan hati yang berat.Komposisi : Tiap kaplet mengandung : Metampiron 500 mg Diazepam 2 mg Farmakologi : DANALGIN bekerja sebagai anatgetik dan tranquillizer. Metampiron bekerja sebagai analgetik. sakit punggung. lumbago. Peringatan dan perhatian : Jangan mengemudikan kendaraan atau menjalankan mesin selama minum obat ini.19 menit. Bayi dibawah 6 buian. sistem limbik dan korteks serebral. diabsorpsi dari saluran pencernaan dan mempunyai waktu paruh 1 . Depresi pernapasan. Diazepam dimetabolisme terutama di hati dan terikat pada reseptor di daerah spinal cort. tetapi metabolit aktif yang dominan yaitu desmetil diazepam mempunyai waktu paruh 30 -100 jam. gangguan fungsi hati atau ginjal. Glaukoma sudut sempit. Indikasi : Untuk meringankan rasa sakit sedang sampai berat terutama nyeri kolik dan sakit setelah operasi dimana dipehukan kombinasi dengan tranquillizer. serebelum. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada . Mempunyai aktivitas sebagai ansiolitik dan hipnotik. Kontra indikasi : Penderita hipersensitif. Wanita hamil dan menyusui. Waktu paruh diazepam dan desmetil diazepam biasanya meningkat pada neonatus.

Interaksi obat: Penggunaan bersama obat-obat depresan SSP atau alkoho! dapat meningkatkan efek depresan. Reg. keleiahan. Efek samping : Reaksi hipersensitivitas : reaksi pada kulit misal kemerahan. No. vertigo. Kemasan: Kotak berisi 10 strip x 10 kaplet. Reg. dipiopia. Hentikan pengobatan jika terjadi reaksi-reaksi paradoksikal seperti keadaankeadaan hipereksitasi akut. No. retensi urin. HARUS DENGAN RESEP DOKTER DANKOS PT DANKOS FARMA. ataksia. ansietas. Reg. depresi.250.- penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. perubahan libido. Hati-hati penggunaan pada penderita depresi berat atau yang mempunyai kecen-derungan melakukan bunuh diri. : DPL8804405304A1 Simpan pada suhu kamar (maks. maksimum 4 kaplet sehari. jaundice. Dosis : Jika sakit 1 kaplet. mual. No. tremor. hipotensi. : DPL8804405304A1 Kotak berisi 50 strip x 10 kaplet. halusinasi dan gangguan tidur. JAKARTA-INDONESIA Datan forte CODE: C21 Harga Per Satuan Terkecil : Rp1. berikutnya 1 kaplet tiap 6-8 jam. konstipasi. Agranulositosis. No.00 BELI DATAN®KapIet ASAM MEFENAMAT . Mengantuk. Reg. 30°C). : DPL8804405304A1 Botol berisi 75 kaplet. Obat ini dapat menyebabkan kelemahan otot dan ketergantungan secara fisik dan psikologis. : DPL8804405304A1 Kaleng berisi 500 kaplet.

liipersensitif.Diare dapat terjadi pada penggunaan jangka panjang yang terus menerus dengan dosis 2.nyeri otot.diare. DATAN dapat diabsorbsi dengan baik oleh saluran pencernaan. . Peringatan dan perhatian : . Indikasi : Menghilangkan segala macam rasa nyeri baik akut maupun kronis. nyeri sehabis operasi dan melaliirkan.Keamanan penggunaan DATAN pada wanita hamil belum diketahui.Keamanan pada anak di bawah usia 14 tahun belum terbukti.seperti : nyeri karena trauma. . DOSIS : .kolik usus. EFEK SAMPING : Pada beberapa orang dapat menyebabkan iritasi lambung.000 mg atau lebih perhari dan merupakan indikasi untuk menghentikan pengobatan. nyeri sewaktu haid. sakit kepala dan sakit gigi. Tiap kaplet DATAN forte mengandung 500 mg Asam Mefenamat. . renal disease. Kadar maksimal dalam darah akan tercapai dalam waktu 2 jam setelah pemberian. keseleo.Iritasi lambung jarang terjadi dan dapat dikiirangi dengan menelannya bersama makanan. nyeri sendi. Farmakologi : DATAN dengan zat aktif Asam Mefenamat. mempunyai daya kerja sebagai analgetik yang kuat dengan disertai efek anti inflamasi dan antipiretik. Sekitar 50 % dari dosis yang diberikan akan diekskresikan melalui urine dalam bentuk inetabolit terkonyugasi dalam waktu 48 jam. .Komposisi : Tiap kaplet DATAN mengandung 250 mg Asam Mefenamat.mual dan sakit kepala.Efek samping adalah minimal pada dosis yang dianjurkan. Kontraindikasi : Penderita tukak lambung dan usus.

. Reg..... Reg.. 500 mg Cara kerja obat Asam mefenamat merupakan kelompok antiinflamasi non steroid...00 BELI DENTACID™ Komposisi Tiap kaplet mengandung Asam mefenamat . No. No. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase . Cianjur-lndonesia Dentacid 500 Harga Per Satuan Terkecil : Rp1..Dewasa: Dosis awal yang dianjurkan adalah 500 mg.. Kaplet DATAN forte: Dus berisi 10 strip @ 10 kaplet. Kemasan : Kaplet DATAN : Dus berisi 10 strip @ 10 kaplet. HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT PYRIDAM FARMATbk...100. DKL8921004104B1 Penyimpanan: Simpanlah di tempat yang sejuk (15-25 * C) dan kering. DKL8921004I04A1.kemudian dilanjutkan dengan 250 500 mg setiap 6 jam.

Efek samping Sistem pencernaan: mual. antiinflamasi dan antipiretik. trombocytopenia dan agranulocytopenia. . Sistem hematopoetik: leukopenia.Penderita dengan gangguan ginjal yang berat. Kontraindikasi . alergi rhinitis dan urtikaria. penglihatan kabur dan insomnia.Pasien yang hipersensitif terhadap asam mefenamat. nyeri ototdan nyeri sesudah operasi.sehingga mempunyai efek analgesik. . .anak dibawah 14 tahun belum diketahui dengan .Penderita dengan tukak lambung dan usus. Peringatan dan perhatian . . Dosis Dewasa dan anak-anak ± 14 tahun: Dosis awal 50 mg. termasuk nyeri karena trauma. kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. diare dan rasa sakit pada abdominal. Indikasi Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala.Keamanan penggunaan pada anak . muntah. Sistem saraf: rasa mengantuk.Hati-hati jika digunakan pada wanita hamil dan menyusui. sakit gigi.Sebaiknya diminum sesudah makan. .Penderita yang dengan asetosal mengalami bronkospasme. dismenore primer. pusing. eosinophilia.

Indonesia . No.pasti. Interaksi obat Penggunaan bersamaan dengan antikoagulan oral dapat memperpanjang "prothrombin". Kemasan Dus isi 10 strip x 10 kaplet HARUS DENGAN RESEP DOKTER. Penyimpanan Simpan pada suhu kamar (di bawah 30°C). Reg. Lindungi dari cahaya.: DKL0704426004A1 Diproduksi oleh: PT. HEXPHARM JAYA Cipanas . Overdosis Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbo absorben) untuk menyerap obat.

DIVOLTAR" hancur dan melarut langsung dalam usus halus. Obat ini mempunyai sifat antiinflamasi. salah urat. Menghilangkan/mengurangi rasa nyeri dan inflamasi nonreumatik. Obat ini 99.500. Dengan demikian. 2. Diklofenak mengalami metabolisme lintasan pertama dalam hati.Indonesia Divoltar 50mg CODE: C22 Harga Per Satuan Terkecil : Rp1.7% terikat pada protein plasma dan waktu paruh eliminasinya 1 . Kelainan muskulo-skeletal akut: periatritis.Indonesia Dipasarkan oleh: PT KALBE FARMA Tbk.4 jam. Diklofenakdimetabolisme hampir sempurna dalam hati: ekskresi obat yang utuh melalui ginjal kurang dari 1%. Sebagai tablet salut enterik.Untuk: PT. dan penyakit pirai akut. Bekasi . tenosinovitis. iritasi lambung dikurangi. tendinitis. osteoartritis. Indikasi : 1. dimana diklofenak diabsorpsi dengan oepat. Kadar puncak dalam plasma dicapai setelah 1 . Penyakit reumatik inflamatoar dan degeneratif: artritis reumatoid.2 jam. DIVOLTAR® merupakan penghambat prostaglandin sintetase. termasuk bentuk juvenil. 3. Seperti obat-obat antiinflamasi nonsteroid lainnya. dan dislokasi. ankilosing spondilitis. DANKOS FARMA Jakarta . analgesik dan antipiretik yang kuat. bursitis. .00 BELI DIVOLTAR® Diklofenak natrium tablet salut enterik Komposisi : Tiap tablet salut enterik mengandung : Diklofenak natrium 25 mg atau 50 mg Farmakologi : DIVOLTAR® adalah obat antiinflamasi nonsteroid dengan struktur kimia yang baru (suatu derivat asam asetat).

DIVOLTAR® dapat meningkatkan kadar plasma lithium atau digoksin. Efek samping ini biasanya ringan. penderita dengan insufisiensi hati. Gunakan dengan hati . Penderita yang mendapat pengobatan jangka panjang dengan DIVOLTAR®. Anak 1 tahun atau lebih :1 . Tablet harus ditelan seluruhnya sewaktu makan atau setelah makan. tetapi sangat jarang. dosis biasanya 75 -100 mg sehari. DIVOLTAR® tidak boleh diberikan selama kehamilan kecuali bila mutlak diperlukan. Ulkus peptikum atau perdarahan saluran cerna.hati pada: penderita dengan gangguan saluran cerna atau dengan riwayat ulkus peptikum. fungsi ginjal. No.3 mg/kg sehari. hati dan hitung darah). Reg. Hipersensitivitas terhadap diklofenak. sendawa. Reg. jantung atau ginjal yang parah.Kontra indikasi : 1. Efek samping: Pada awal pengobatan. seperti halnya dengan obat-obat antiiflamasi nonsteroid lainnya. nausea dan diare. Bila ini terjadi. nyeri kepala atau pusing. DKL8811606917A1 Dos isi 5 strip x 10 tablet salut enterik. hepatitis. Penderita asma yang mengalami serangan asma. dan anemia aplastik dapat juga terjadi.3 dosis. Userasi dan perdarahan saluran cerna. 3. ikterus. Untuk terapi jangka panjang. atau rinitis akut bila mendapat asetosal atau obat-obat antiinflamasi nonsteroid lainnya. DKL8811606917B1 PT KALBE FARMA Tbk. No. 2. dibagi dalam 2 . Kemasan : Tablet 25 mg : Tablet 50 mg : Dosisi 5 strip x 10 tablet salut enterik. 2.3 dosis. trombositopenia. dapat terjadi nyeri epigastrium. dibagi dalam 2 . penderita usia lanjut (lebih mudah mengalami efek samping obat-obat antiinflamasi nonsteroid). 3. retensi cairan dan peningkatan serum transaminase kadang-kadang terjadi. gagal ginjal dan sindroma nefrotik juga terjadi. urtikaria. Dosis dan cara pemberian Dewasa : Dosis awal 75 -150 mg sehari. harus dimonitor sebagai tindakan berjaga-jaga (mis. Leukopenia. Reaksi kulir. . 4. DIVOLTAR® harus dihentikan. Peringatan dan perhatian : 1.

Untuk anak yang bobot badannya kurang dari 30 kg. serta reaktivitas bronkospastik terhadap asam asetilsalisilat atau antiinflamasi non steroid lainnya.Indonesia Lindungi dari cahaya. 20 mg/kg bobot badan sehari.2 gram sehari.6 . Dosis penunjang 0. Rasa nyeri ringan sampai sedang dan rasa nyeri pada waktu haid. Kontra indikasi: Jangan diberikan kepada penderita yang hipersensitif terhadap ibuprofen atau penderita dengan sindroma polip hidung. Atau menurut petunjuk dokter.2. sakit kepala atau vertigo. maksimum diberikan sebanyak 500 mg sehari. Efek samping: Efek samping yang biasa timbul adalah gangguan saluran cerna. HARUS DENGAN RESEP DOKTER. Simpan pada suhu kamar (di bawah 30°C).4 gram sehari.1. dibagi dalam beberapa dosis. Dofen Forte 400mg CODE: 121 Harga Per Satuan Terkecil : Rp400. Komposisi: DOFEN® 200 Tiap tablet salut selaput mengandung: Ibuprofen DOFEN® FORTE Tiap tablet salut selaput mengandung: Ibuprofen Indikasi: Reumatik artritis. osteoartritis dan gout artritis.Bekasi .9 . dibagi dalam beberapa dosis. angiodema. .00 BELI DOFEN® 200 DOFEN® FORTE Tablet salut selaput DOFEN adalah tablet bersalut selaput (film coat) yang mempunyai khasiat sebagai analgetika-antipiretika dan antiinflamasi. Dosis : Dewasa : Anak-anak : 200 mg 400 mg 0.

gangguan fungsi ginjal tetapi ini jarang terjadi. BAMBANG UTOYO 138 PALEMBANG-INDONESIA Dogmatil CODE: C23 Harga Per Satuan Terkecil : Rp3. DKL8505001617A1 DOFEN FORTE: Kotak.650. 10 strip @ 10 tablet. pruritus. . Pada penderita dengan riwayat penyakit saluran cerna bagian atas perlu dilakukan pengawasan yang ketat. Hati-hati bila digunakan pada penderita dengan gangguan fungsi ginial dan perlu dilakukan monitor yang ketat.3 ampul/hari selama 1 . Terapi penunjang : 3 kapsul @ 50 mg/hari selama 3 minggu.Juga dapat menimbulkan ruam kulit. Tidak boleh digunakan pada penderita yang diketahui hipersensitif terhadap aspirin atau antiinflamasi non steroid lainnya Hati-hati bila digunakan pada penderita dengan kelainan faktor intrinsik untuk pembekuan darah. Peringatan dan perhatian: Hati-hati bila digunakan pada penderita dengan riwayat dekompensasi jantung atau hipertensi.00 BELI DOGMATIL SULPIRIDE 3 bidang pengobatan utama : ITUKAK SALURAN PENCERNAAN PSIKIATRI VERTIGO ■ Tukak saluran pencernaan Pengobatan pada waktu serangan : 2 . Dibuat oleh: DEXAMEDICA JL. Pada dosis yang berlebihan dapat terjadi gejala saluran cerna dan gejala susunan saraf pusat. 10 strip @ 10 tablet.2 minggu. Kemasan dan Nomor Registrasi: DOFEN 200 : Kotak. TERLINDUNG DARI CAHAYA. DKL8505001617B1 HARUS DENGAN RESEP DOKTER. SIMPAN PADA SUHU DI BAWAH 30°C.

■ Vertigo karena berbagai sebab 3. Anak-anak : 5 -10 mg/kg b. Tanpa kontraindikasi maupun incompatibility. remaja Anak-anak : 10 mg/kg b. Dewasa : 2 .3 kapsul/hari selama 3 ./hari. Reg.4 minggu. dibagi dalam beberapa dosis. Reg. kebingungan. KEMASAN: Tablet dalam strip berisi 20 @ 200 mg (khusus pemakaian psikiatri) No.6 ampul/hari. ■ Kelainan psikiatri utama Pengobatan pada waktu serangan : • Psikosa akut dengan gejala-gejala 3 . • Psikosa pada masa anak-anak./hari. EFEK SAMPING : Kadang-kadang dapat menyebabkan gangguan siklus menstmasi atau efek extra pyramidal ringan yang mudah hilang. • Depresi pada geriatrik. D 6015158 . • Kelainan tingkah laku yang berat.Terapi lanjutan : 1 . D 6015425 -Kapsul dalam strip berisi 20 dan 100 @ 50 mg. dan keadaan pra-psikosa. • Depresi karena berbagai sebab.4 kapsul @ 50 mg/hari. D 7811131 -Ampul 6 @ 100 mg/2 ml No. • Keadaan depresi yang reaktif.b. delusi.4 tablet @ 200 mg/hari.b. • Neurosa dengan harnbatan psikomotor. (waham) kronis. dibagi dalam beberapa dosis. halusinasi. keadaan delusi 2 . • Sindroma post gegar-otak. No. dibagi daTam beberapa dosis.6 kapsul/hari. Tidak mempengaruhi sistim neurovegetative. • Kelainan psikofungsionil • Kelainan tingkah laku yang ringan. Kewaspadaan tetap terpelihara bahkan sering kali meninggi. TOLERANSI : Pada terapi jangka panjang atau pada pengobatan ulangan tidak menimbulkan adiksi. dibagi dalam beberapa dosis. Reg. Terapi penunjang per oral: • Skizofrenia akut.

untuk PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Dengan lisensi dari DELAGRANGE. dengan sifatnya sebagai agonis partial pada reseptor opioid (reseptor U) yang berperan pada efek analgesik.JAKARTA.SIMPAN Dl BAWAH SUHU 30°C. Dengan menghambat "reuptake". baik akut maupun kronik serta nyeri setelah operasi. preparat hipnotik.PARIS . TERLINDUNG DARI CAHAYA Tablet dan Kapsul di produksi oleh : PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Injeksi diproduksi oleh : PT ETHICA. SESIF . Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg INDIKASI : Untuk mengatasi nyeri berat.00 BELI Dolana KOMPOSISI : Setiap Kapsul mengandung : Setiap Suppositoria mengandung : Setiap 1 mL Larutan injeksi DOLANA 50 mg mengandung : Setiap 2 mL Larutan injeksi DOLANA 100 mg mengandung : CARA KERJA OBAT : Tramadol HCl adalah analgesik yang bekerja sentral.450. noradrenaline pasca sinaptik dan memblok reseptor serotonergik. . Disamping itu juga bekerja pada reseptor monoaminergik di susunan saraf pusat.FRANCE DELAGRANGE Dolana Kapsul CODE: C122 Harga Per Satuan Terkecil : Rp3. memperkuat efek analgesik Tramadol HCl namun dengan efek samping opioid yang minimal. KONTRA INDIKASI : Intoksikasi akut bila digunakan bersama dengan alkohol.

mulut kering dan lelah. sakit kepala. pusing. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. INTERAKSI OBAT : Dengan obat-obat yang bekerja pada susunan saraf pusat seperti Trankuilizer. pruritus. Pada penderita dengan gangguan fungsi ginjal / hati perlu dilakukan penyesuaian dosis. peningkatan tekanao intrakranial. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi tramadol dengan cepat. kemerahan. Penderita yang hipersensitif terhadap tramadol atau opiat. PERINGATAN DAN PERHATIAN : Tramadol tidak boleh digunakan pada penderita ketergantungan obat.00 BELI Dolfenal . Penderita dengan depresi pernapasan terutama jika ada cyanosis dan sekresi bronkial yang berlebihan. Pertimbangkan manfaat dan resiko yang mungkin terjadi bila digunakan pada wanita hamil dan menyusui karena 0. paru-paru kronik EFEK SAMPING Berkeringat.1 % tramadol diekskresikan melalui ASI. gangguan fungsi ginjal dan hati yang berat atau hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok (renjatan ) Dapat terjadi penurunan fungsi paru-paru apabila penggunaan tramadol dikombinasi dengan obat depresi SSP lainnya atau bila melebihi dosis yang dianjurkan. Dispepsia obstipasi. Penderita yang mendapat pengobatan penghambat MAO. mual. muntah. sedasi. Hendaknya tidak diberikan selama serangan asma bronkial atau kegagalan jantung sekunder sampai penyakit. Hati-hati bila digunakan pada penderita trauma kepala.000. hipnotik maka efek sedasi/kelelahan kemungkinan meningkat. tramadol tidak dapat menekan gejala "withdrawal" akibat pemberian morfin.- analgesik atau obat-obat lain yang bekerja pada susunan saraf pusat. Tramadol HCl tidak boleh diberikan pada pasien yang menerima MAO Inhibitors. DOLFENAL CODE: C33 Harga Per Satuan Terkecil : Rp1. Meskipun termasuk antagonis opiat.

perdarahan saluran cerna. Dolika Kapsul CODE: C123 Harga Per Satuan Terkecil : Rp2.gangguan penglihaan. hipersensivitas. kerusakan hati dan ginjal.Asam mefenamat 500 mg.00 BELI DOLIKA INJEKSI / KAPSUL KOMPOSISI Tiap ml Dolika 50 Injeksi mengandung : Tiap ml Dolika 100 Injeksi mengandung : Tiap kapsul mengandung : Tramadol HCI Tramadol HCI Tramadol HCI 25 mg 5 mg 50 mg Dewasa dan anak >14 tahun : kemudian 250 mg.nefropati.mengantuk.700.reaksi kulit. . de3hidrasi. asma. Efek samping : Gangguan saluran cerna. Indikasi : nyeri. Perihal : tukak lambung.diskrasia darah.pusing. peradangan. Dosis : 4x sehari : Kemasan : Dos 100 tablet.sakit kepala. Kontra indikasi : Tukak/inflamasi saluran cerna.

dosis Dolika yang diberikan adalah sebagai berikut : Dosis untuk orang dewasa dan anak umur di atas 14 tahun : DOLIKA KAPSUL : Dosis tunggal : 1 kapsul Dosis harian : sampai 8 kapsul Dosis tersebut biasanya cukup untuk meredakan nyeri. Pada penderita dengan gangguan fungsi ginjal atau hati. kemungkinan terjadinya ketergantungan tidak dapat disingkirkan. Dolika tidak boleh diberikan lebih lama daripada yang diperlukan.60 menit. Nyeri akibat tindakan diagnostik. INDIKASI Nyeri akut dan kronik berat. Nyeri pasca operasi. atau bila pengobatan perlu dihentikan sementara. perlu dilakukan penyesuaian dosis. dapat ditambahkan injeksi 1 ml Dolika atau 1 kapsul Dolika setelah selang waktu 30 . EFEK SAMPING . Lama pengobatan : Pada pengobatan Dolika jangka panjang. Karenanya dokter harus menetapkan lamanya pengobatan. Dosis harian sebesar 400 mg/hari jangan dilampaui.CARA KERJA OBAT Tramadol HCI merupakan Non-Opioid Analgetika yang bekerja pada reseptor opioid. biasanya diberikan dalam bentuk injeksi DOSIS PEMAKAIAN Dosis yang diberikan sebaiknya disesuaikan dengan intensitas nyeri Bila tidak ada petunjuk lain dari dokter. Apabila masih terasa nyeri.

muntah. efek samping berikut dapat terjadi pada pengobatan Dolika : mual. hipnotika. obstipasi. Dolo fenac CODE: C24 Harga Per Satuan Terkecil : Rp3. INTERAKSI OBAT Penggunaan injeksi Dolika bersama dengan obat-obat yang bekerja pada SSP (seperti tranquiliser. kulit kemerahan.- Sama seperti analgesik sentral lainnya. mulut kering dan sakit kepala. berkeringat. KONTRA INDIKASI Intoksikasi akut dengan alkohol. sedasi. Simpan di tempat kering dan sejuk. Sebaliknya penggunaan tramadol bersama dengan tranquiliser juga dapat meningkatkan efek analgesiknya.00 BELI DOLO FENAC iniamme Monomtrate + Lyanocobalamin Vitamin Neurotropik + NSAID Komposisi : Setiap tablet salut enterik mengandung: . lelah. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi Tramadol dengan cepat. hipnotika) dapat meningkatkan efek sedasinya. Penderita yang hipersensitif terhadap tramadol atau opiat. sampai sekarang terbukti insidens ketergantungan setelah penggunaan Dolika jarang dijumpai. Penderita yang mendapat pengobatan penghambat MAO. CARA PENYIMPANAN Jauhkan dari jangkauan anak-anak.100. pruritus. analgesik atau obat-obat yang mempengaruhi SSP lainnya. Meskipun tramadol berinteraksi dengan reseptor opiat. pusing. dispepsia. terhindar dari cahaya.

Pada anak. dengan demikian mempengaruhi pematangan sel dan memelihara keutuhan jaringan syaraf.Penderita dengan luka atau pendarahan pada saluran cerna. lebih baik setelah makan. mempunyai efek sebagai anti rematik. Perhatian atau larangan penggunaan selama hamil dan menyusui : . pemberian Diclofenac bersama NSAID lainnya tidak direkomendasikan. Pyridoxol HCI di dalam tubuh diubah menjadi pyridoxol fosfat. berfungsi terutama dalam metabolisme protein dan asam amino. akan meningkatkan resiko toksisitas ginjal.OiclofenacSodium Pyridoxol HCI Thiamine Mononitrate Vitamin B12 Mekanisme Kerja : 50 mg 50 mg 50 mg 1 mg Diclofenac merupaKan obat anti inflamasi non steroid. Vitamin B. Perhatian : Diclofenac dapat menyebabkan retensi cairan. yang merupakan koenzim reaksi karboksilasi dan transaminasi. hati dan jantung penderita usia lanjut.pada pasien dengan dehidrasi. Efek anti inflamasi serta efek farmakologis lainnya berhubungan dengan efek penghambatan sintesa prostaglandin.s diperiukan dalam sintesis asam nukleat dan mielin. Thiamin penting untuk metabolisme karbohidrat. Indikasi : Meringankan rasa sakitsedangsampai beratyangdisertai neuritisdan/atau neuralgia. Untun oengobatan inflamasi dan penyakit-penyakit rematik degeneratif. dan gangguan koagulasi pada pasien dengan penyakit kardiovaskular atau hipertensi. dalam tubuh dikonversi menjadi bentuk aktifnya thiamin pirofosfat yang merupakan koenzim pada reaksi dekarboksilasi asam aketo. edema. anti inflamasi analgesik. Pasien dapat diobati dalam waktu lama iika diperiukan sesuai anjurandokter. Dosis dan Pemberian Tiga tablet per hari. efektivitas dan banannya belum diketahui. Obat ini harus diberikan dengan hati-hati pada pasien dengan gangguan ginjal.

insufisiensi renal akut. Kulit (kasus tersendiri) : vesicular eruptions. hati dan ginjal harus diteliti terlebih dahulu. ada perbaikan bertahap pada disfungsi neuronal dan pemulihan secara menyeluruh pada pasien-pasienini. purpura.Tfitasi psikotik. reaksi fotosensitif. eczema. dispepsia. .Kadang-kadang terjadi: colitis ulserativa atau Crohn's procto'colitis' gingivostomatitis. muntah. gangguan rasa. retensi urin. hematemesis ulkus perforasi. mutagenik dan teratogenik atau efek fertilitas pada studi manusia atau hewan. mual.Obat tidak boleh digunakan selama kehamilan dan menyusui.sakit kepala. diare. Polycythemia vera. sindroma Stevens-Johnson toxic epidermal necrolysis. glositis. meskipun studi histopatologik tidak menunjukkan adanya hubungan smdroma tersebut dengan semua tingkatan degenerasi neuronal. lesi esophagus. insomma. hal ini dihubungkan dengan hipersensitifas yang jarang terjadi. kondisi sistim pencernaan. Pada penghentian pyridoxol. Erupsi kulit dan reaksi hipersensitifitas lain yang diketahui disebabkan oleh formulas! ini. Sistem saraf pusat : dizziness. Ginjal (kasusjarang): hematuria. flatulence.kelelahan. Pemberian pyridoxol dosis tinggi dapat menyebabkan smdroma neuropati sensoris tertentu.Kasus yang jarang:parestesia. Perhatian dan kemungkinan efek karsinogenik. diare berdarah. Sistem pencernaan : sakit perut.TJhnifus. Efek samping : Ada laporan tersendiri mengenai reaksi pada pemberian parenteral thiamin dan vitamin B12 untuk jangka panjang. anoreksia.gangguan sensoris dan visuat. erythroderma (exfoliative dermatitis).pusing. gangguan ingatan. perdarahan usus. erythema multiforme. konstipasi. disorienteasi. alopecia. proteinuria.jarang terjadi : gastroduodenal hemoragik (perdarahan gastro-duodenal). Sebelum meresepkan obat ini. mutagenik dan teratogenik dan efek pada fertilitas: Tidak ada bukti efek karsinogenik.

Polycythemia vera. kadar plasma ada kemungkinan menurun. dengan atau tanpa penyakit kuning. Pasien yang mengalami bronchial. meskipun signifikansinya tidakjelas.hemolyticanemia.Hati (kasus jarang) : peningkatan aktifitas aminotransferase (glutamic-pyruvic dan glutamic-oxaloacetic transaminases).leucopenia. Jika pyridoxol diberikan bersama cyclosporine.. Kontraindikasi : Hipersensitifitas terhadap obat ini.aplastic anemia. . Interaksi : Thiamin dilaporkan berpotensi terjadinya penghambatan neuromuscular.s dan pemberian pyridoxine menurunkan efek samping neuronal dengan penggunaan obat-obat ini. Cycloserine dan hydralazine adalah vitamin B. Qastroduodenal/peptic ulcer. Vitamin B12 tidak boleh diberikan pada tingkat awal penyakit Leber (atrophl hereditari dari saraf optik). antagon. urticaria atau rhinitis yang dipicu oleh asam asetilsalisilik atau derifatnya. reaksi anafilaksis. Pyridoxol fosfat menyebabkan dekarboksilasi perifer levodopa sehingga menurunkan efikasi pada pengobatan penyakit Parkinson. Hipersensitifitas (kasus jarang) : arterial hypotension. hepatitis. Darah ( kasus tersendiri) : thrombocytopenia.agranulocytosis. Pengobatan dengan pyridoxol HCI 200 mg per hari selama satu bulan menurunkan sampai 50% konsentrasi serum phenobarbital dan phenytoin. Pemberian carbidopa dengan levodopa secara bersamaan menghambat efek pyridoxol Pyridoxol HCI tidak boleh diberikan pada dosis lebih tinggi daripada 5 mg per hari pada pasien yang sedanq diobati dengan levodopa saja. Penggunaan penicillamine yang diperpanjang dapat menyebabkan kekurangan vitamin B. edema.

iritasi gastrointestinal. antikonvulsan (phenytoin' phenobarbital. Diclofenac menurunkan aktivitas obat-obat diuretik. tetapi tidak pada pasien dengan gastrectomy parsial atau total Kepentingan klinis dan observas* ini tidak diketahui. Neuropathy sensoris dan sindroma neuropati sensoris lainnya yang disebabkan pemberian pyridoxol megadoses akan sembuh dan pulih kembali dengan penghentian pengobatan. Monitoring yang cukup direkomendasikan untuk kasus-kasus ml. Pasien diobati dengan antikoagulan harus dimonitor dengan ketat Obat-obat antnnflamasi nonsteroid harus dihentikan 24 jam sebelum memulai pengobatan dengan metotreksat untuk mencegah peningkatan plasma cytostatic dan kejadian efektoksik. Pemberian diclofenac dengan obat-obat lithium-based atau digoxin atau siklosporin atau metotreksat secara simultan dapat menyebabkan peningkatan plasma obat-obat ini.Absorpsi vitamin B„ di sistim gastrointestinal dapatditurunkan dengan pemberian berikut ini aminoglikosida colchicme. Pemberian kloramfenikol dan vitamin B„ secara simultan dapat memperburuk responhemopoietic terhadap vitamin. iritasi pada usus halus oleh kobalt. Asam askorbat dapat menghancurkan jumlah vitamin B12 secara signifikan dan faktor intrinsik dalam kondisi in vitro. Pengukuran pendukung harus dilakukan untuk mengobati hipotensi. insufisiensi qinial konvulsi. dan supresi pernafasan. dan oleh asupan aikohol yang berlebihan selama lebih dan 2 minggu. Overdosisatau ingestion taksengaja:Gejala dan Penanganan (Antidot) Tidak ada kasus yang dilaporkan tentang overdosis dengan thiamin atau vitamin B.. asam aminosalisilik dan garamnya. Pemberian neomycin dan colchicine secara simultan memperburuk absorbs! vitamin B secara oral. primidone). pengobatan pennnjang dan simptomatik harus dilakukan Tidak ada gambaran spesifik mengenai hal itu. Pada kasus intoksikasi akut dengan diclofenac. Prednisone dilaporkan meningkatkan absorpsi vitamin B12 dan sekresi faktor intrinsik pada beberapa pasien dengan anemia pernicious. Tindakan berikut ini harus dilakukan: bilas lambung dan pemberian charcoal aktif. golongan potasium lepas lambat. harus diperhatikan kemungkinan ini pada saat meresepkan dosis tinggi asam askorbat dengan vitamin B12. Penggunaan antiinflamasi nonsteroid lain secara bersamaan dapat meningkatkan resikoefeksampingvangtidakdiinginkan. Kemasan : Boks lO blister® lO tablet salut enterik Dolo Meganeuron Harga Per Satuan Terkecil : Rp750.00 BELI DOLO MEGANEURON Kaplet Salut Selaput KOMPOSISI : .

Pyrldoxine HCl dan Cyanocobalamine dalam dosis besar dapat membantu memelihara fungsi sel-sel saraf. Thiamine HCl. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lama untuk mengatasi rasa sakit akut. Diabsorpsl dan saluran pencemaan. Hati-hati dengan penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. sakit punggung. Penderita dengan tekanan darah sistolik < 100 mmHg. gangguan fungsi hati atau ginjal. maka sebaiknya tidak digunakan dalam jangka waktu terus menerus.Tiap Kaplet Salul Selaput mengandung: Methampyrane TniamineHCI Pyridoxine HCl Cyanooobalamine 500 mg 50 mg 100 mg 100 mg FARMAKOLOGI : Methampyrone bekerja sebagai analgesia. Wanita hamil dan menyusui. bursitis. lumbago. INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia. KONTRA INDIKASI : Penderita hipersensitif. . sindroma bahu-lengan. terutama pada keadaan sakit yang berat. Bayi dibawah 6 bulan. PERINGATAN DAN PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. Karena dapat menimbulkarragranulositosis yang berakibat fatal. mempunyai waktu paruh 1 -4 jam.

Agranulositosis.Reg.EFEK SAMPING : Reaksi hipersensitifitas: reaksi pada kulit misal kemerahan.1 Dolocap Harga Per Satuan Terkecil : Rp1. .: DKL 9815706509 A1 SIMPAN DITEMPAT YANG SEJUK DAN KERING HARUS DENGAN RESEP DOKTER Produksi: PT. DOSIS : 1 Kaplet salut selaput 3 kali sehari KEMASAN : Dus.900. 10 strip @ 10 kaplet salut selaput No. EMBA MEGAFARMA SEMARANG .00 BELI DOLOCAP capsul KOMPOSISI : Tiap kapsul mengandung: Tramadol HCI 50 mg FARMAKOLOGI : Tramadol HCI merupakan suatu analgetik opioid.INDONESIA R.032.

Penderita dengan depressi pernapasan. atau obat-obat analgetik opiat atau obat-obatyang mempengaruhi SSP lainnya. Mulut kering.INDIKASI : • • Digunakan untuk: Nyeri akut dan kronik yang berat. kolaps kardiovaskular. KONTRA INDIKASI: • • • • Penderita yang hipersensitif terhadap Tramadol atau opiat. EFEK SAMPING : • • • • Pada dosis normal. terutama dengan adanya cyanosis. OVER DOSIS : • • Pada pemberian over dosis dapat terjadi miosis. hipnotika. kejang dan depressi pernapasan. hypotension. Dosis tersebut di atas biasanya cukup untuk meredakan nyeri. muntah. vertigo. Nyeri pasca bedah. seperti pada golongan analgesik opiat (analgesik sentral) dapat terjadi: mual. confusion. dispepsia. Pada anak-anak dan bayi dapat terjadi kejang-kejang. koma. DOSIS : Dosis yang diberikan disesuaikan dengan intensitas nyeri lazimnya : • 1 kapsul sehari (maksimum 8 kapsul per hari).60 menit. brandikardia orthostatic. kelelahan dan miosis. kulit kemerahan. palpitasi. berkeringat. hypotermia. drowsiness. Untuk mengatasi depressi pernapasan dan syok dengan Naloxone HCI. sembelit. Pada dosis lebih besar dapat menyebabkan depressi pernapasan dan hipotensi dengan kegagalan sirkulasi dan koma. Intoksikasi akut dengan alkohol. muntah. . sodasi. Penderita yang mendapat pengobatan MAO inhibitor. apabila masih terasa nyeri dapat ditambahkan 1 kapsul setelah selang 30 . mungkin juga dapat terjadi spasme uterik atau biliary.

KEMASAN : Dos berisi 5 blister® 10 kapsul PENYIMPANAN : Simpanlah di tempat yang sejuk. Dapat terjadi penurunan fungsi paru bila Tramadol digunakan bersama dengan obat-obat penekan SSP lainnya atau bila penggunaan melebihi dosis yang dianjurkan. Tramadol tidak dapat menekan gejala "witdrawal" akibat pemberian morfin. HARUS DENGAN RESEP DOKTER. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin.1% Tramadol diekskresikan melalui ASI. hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok. dapat menyebabkan ketergantungan. . Pemberian pada wanita hamil harus dipertimbangkan manfaat dan resiko yang mungkin terjadi. gangguan fungsi ginjal dan hati yang berat. peningkatan tekanan intra kranial. Meskipun termasuk antagonis opiat. INTERAKSI OBAT : • Efek depressi / sedasi diperkuat dengan adanya obat-obat yang bekerja pada SSP seperti : alkohol. obat-obat hipnotika. Hati-hati bila digunakan pada penderita trauma kepala. PERHATIAN : • • • • • • • • Tramadol tidak boleh digunakan pada penderita ketergantungan obat.• Nalorphine HBr. Tidak boleh diberikan lebih lama dari petunjuk dokter. antidepressan trisiklik dan anestetika. Pada pengobatan jangka panjang. Hati -hati pemberian pada ibu menyusui karena 0. kering dan terlindung dari cahaya. Oleh karena itu dokter harus menentukan dengan jelas lama pengobatan. tranquillizer. sedangkan kejang dapat ditekan dengan pemberian Benzodiazepin. Keracunan akut lewat mulut dapat diatasi dengan pengosongan lambung. Levallorphan tartrat. • Sebaliknya penggunaan Tramadol bersama dengan tranquillizer juga dapat meningkatkan efekanalgesiknya.

yaitu analog amin asam salisilat. Dalam waktu 48 jam. INDIKASI : Untuk menghilangkan rasa nyeri pada sakit kepaia. KONTRA INDIKASI : Penderita tukak lambung . Dibandingkan dengan aspirin.Dolodon CODE: C25 Harga Per Satuan Terkecil : Rp250. DOLODON Suspensi dengan rasa pisang yang enak dan manis disiapkan untuk anakanak dan penderita yang mengalami kesulitan menelan kapsul atau captab. Asam Mefenamat ku-rang menyebabkan terjadinya pendarahan gastrointestinal. demam pada anak-anak dan dewasa. Asam Mefenamat diserap dari traktus gastro intestinal dan kadar dalam sirkulasi mencapai puncaknya dalam waktu 2 jam setelah pemberian obat.00 BELI DOLODON kapsul * captab * suspensi capsule * captab * suspension KOMPOS1SI : DOLODON 250 Kapsul : DOLODON 500 Captab : DOLODON Suspensi : Tiap kapsul berisi 250 mg Asam Mefenamat Tiap captab mengandung 500 mg Asam Mefenamat Tiap sendok takar (5ml) suspensi mengandung 50 mg Asam Mefenamat. sakit gigi. terutama dalam bentuk metabolitnya. ± 50 % dari dosis yang diberikan ditemukan kembaii dalam urine. nyeri waktu haid. yang mempunyai daya antipiretik dan anatgesik dengan potensi yang sama dengan aspirin dan dengan sedikit daya anti inflamasi. nyeri pasca bedah dan persalinan. nyeri rematik. FARMAKOLOGI : DOLODON berisi Asam Mefenamat yang merupakan derivat asam antrani-lat.

3 kali se-hari dengan interval 6 sampai 8 jam. paling lama 7 hari.Botol plastik isi 500 kapsul Reg. Atau menurut petunjuk dokter. DKL 8714504104 A1 Botoi isi 60 ml netto Reg. terutama bila digunakan bersama-an antikoagulan koumarin. No. SEDIAAN dan KEMASAN : * DOLODON 250 Kapsul : * DOLODON 500 Captab : * DOLODON Suspensi : Dus berisi 10 strip x 10 kapsul Reg. DKL 8714504033 A1 HARUS DENGAN RESEP DOKTER . dosis koumarin hams dikurangi. Sebaiknya tidak diberikan pada wanita hamil dan wanita menyusui. D 7812379 . No. Hati-hati pada penderita asma karena akan memperburuk keadaan. kemudian 250 mg setiap 6 jam 6. D 7812379-1 Dus berisi 10 strip x 10 captab Reg.PERINGATAN & PERHATIAN : * * * * * Dapat mengurangi jumiah trombosit. DOSIS : Dewasa : Anak-anak : Mula-mula 500 mg. No. Pemberian harap dihentikan setelah 7 hari tidak memberikan hasil. EFEK SAMPING : * * Dapat menyebabkan iritasi tractus gastro intestinal Skin rash dan diare dapat terjadi dan akan hiiang jika pengobatan dihentikan. PENYIMPANAN : Simpan pada suhu dibawah 30°C. Hati-hati pada penderita gangguan fungsi hati dan ginjal. No.5 mg Asam Mefenamat per kilogram berat badan.

00 BELI DOLOFEN – F Ibu profen 400 mg. KEMASAN : ( HNA + ) Dos 10 x 10 kapsul Duplopyrin Strip CODE: C111 Harga Per Satuan Terkecil : Rp2.500. DOSIS : 3 x sehari 1 kaplet / kapsul .00 BELI Duplopyrin KOMPOSISI : Tiap tablet DUPLOPYRIN mengandung : Fenilbutazon 125 mg Etoksibensamid 125 mg Aluminium Hidroksida Gel kering 100 mg Magnesium Trisilikat 5H2O 150 mg . INDIKASI : Menghilangkan rasa nyeri dan gejala arthritis reumetoid dan osteoarthritis.Produksi : PT MECOSIN INDONESIA JAKARTA Dolofen-F CODE: C26 Harga Per Satuan Terkecil : Rp500.

hati atau kardiovaskuler. Reg. CARA PENYIMPANAN : Simpan di tempat kering. Magnesium Trisilikat dalam bentuk garam magnesium mudah diserap dan bila terjadi gangguan fungsi ginjal dapat menyebabkan keracunan magnesium. ATURAN PAKAI : Dewasa : 1 tablet 3 kali sehari. gangguan fungsi ginjal. ginjal dan hati. hipersensitivitas serta gangguan fungsi jantung. osteo arthritis. Harus berhati-hati pemberiannya pada penderita dengan gastritis. 2815773 Dus isi 24 blister @10 tablet . Atau menurut petunjuk Anak-anak : dokter. No. INTERAKSI OBAT : Dapat meningkatkan etek tolbutamide dan kumarin. KONTRA INDIKASI Hipertensi. Dapat menghambat absorpsi tetrasiklin dan vitamin-vitamin serta memperlambat absorpsi quinidin. : D. juga pada penyakit tiroid dapat terjadi penahanan fungsi sumsum tulang. tukak lambung. Disesuaikan dengan usia dan berat badan. 2815773-1 . Reg. No. pada suhu kamar (25-30°C) dan terlindung dan bahaya KEMASAN : Kaleng plastik isi 1000 tablet . ankylosing spondylitis. PERINGATAN & PERHATIAN : Hati-hati penggunaan pada penderita ulkus peptikum. gouty arthritis.INDIKASI Penyakit Rheumatik termasuk rheumatoid arthritis. : D.

. Seperti obat-obat AINS yang lain mekanisme kerja belum diketahui.. INDIKASI EFLAGEN diindikasikan : Sebagai pengobatan jangka pendek untuk kondisi akut sebagai berikut: Sebagai adjuvant pada nyeri Inflamasi berat dari Infeksi telinga.. - KONTRA-INDIKASI Hipersensitivitas terhadap Kalium Diklofenak..... seperti terkilir....... .. akan tetapi penghambatannya terhadap sintesa prostaglandin (siklo-oksigenase) dapat dikaitkan dengan aktivitas anti-inflamasi. * nyeri Inflamasi setelah trauma.. Secara farmakologi Diklofenak menunjukkan aktivitas anti-inflamasi.... * nyeri dan inflamasi setelah operasi. hidung atau tenggorokan. Coronet Crown PHARMACEUTICAL INDUSTRIES SURABAYA .250... seperti operasi gigi dan tulang. analgesik dan antipiretik.......HARUS DENGAN RESEP DOKTER PT.........25 mg/ 50 mg FARMAKOLOGI EFILAGEN mengandung Kalium Diklofenak yaitu suatu anti-inflamasi nonsteroidal CAINS.00 BELI EFLAGEN Tiap tablet mengandung : Kalium Diklofenak.INDONESIA Eflagen 25 CODE: C112 Harga Per Satuan Terkecil : Rp1.

100 mg / hari. anemia. agra-nulositosis Darah: (sangat jarang). DOSIS Dewasa : dosis awal 100 -150 mg/hari dalam 2 .- Tukak lambung. vertigo. Lain-lain: hipertensi. mual. EFEK SAMPING Efek samping yang mungkin terjadi pada : nyeri lambung. Pemberian bersamaan dengan metotreksat dapat meningkatkan toksisitas metotreksat. edema (Jarang). penderita dalam serangan asma. leukopenia. trombositopenia. nyeri dada.: Dus Isi 5 strip @ 10 tablet DKLV722222015A1 . urtikarta atau rinitis akut yang ditimbulkan oleh asam asetil salisllat atau obat-obat lain yang menghambat sintesa prostaglandin. SGPT dan hepatitis (Jarang). kram perut.3 dosis terbagi. muntah. impoten. Kulit: urtikaria. Pemberian bersamaan dengan diuretik hemat kalium dapat disertai dengan kenaikan kadar kalium dalam darah. Ginjal: gangguan fungsi ginjal. Pemberian bersamaan dengan antikoagulan perinah dilaporkan dapat meningkatkan resiko perdarahan. eksim. sakit kepala. telinga berdenging. Hati: peningkatan enzim SGOT. palpitasi. Pemberian bersamaan dengan AINS sistemik dapat meningkatkan terjadinya efek samping. Sistem saraf pusat: pusing. INTERAKSI OBAT Pemberian bersamaan dengan litium atau digoksin dapat meningkatkan konsentrasi litium atau digosin dalam plasma. anak-anak usia > 14 tahun: tidak boleh diberikan pada anak-anak usia Anak-anak : < 14 tahun. HARUS DENGAN RESEP DOKTER KEMASAN EFLAGEN 35: No. Saluran pencernaan: dispepsia. Pada kasus-kasus sedang dan untuk 75 . diare. Reg. eritema multiformis.

EFLAGEN 50: No. Reg.: Dus isi 5 strip @ 10 tablet DKL9722222015B1 .

You're Reading a Free Preview

Download
scribd
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->