Analgesik, antiinflamasi http://www.farmasiku.com/index.php?

target=categories&category_id=171 Analgesik adalah obat yang dapat mengurangi atau menghilangkan rasa nyeri dan akhirnya akan memberikan rasa nyaman pada orang yang menderita. Anti inflamasi adalah obat yang dapat menghilangkan radang yang disebabkan bukan karena mikroorganisme (non infeksi). Gejala inflamasi Inflamasi dapat disertai dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Proses inflamasi meliputi kerusakan mikrovaskuler, meningkatnya permeabilitas vaskuler dan migrasi leukosit ke jaringan radang, dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Mediator yang dilepaskan antara lain histamin, bradikinin, leukotrin, Prostaglandin dan PAF. Penanganan inflamasi 1 2 3 4 5 6 7 Derivat Asam Salisilat à Aspirin, Benorilat, Diflunisal, Salsalat Derivat Asam Propionat à As.Tiaprofenat, Fenbufen, Flurbiprofen, Ibuprofen, Ketoprofen, Naproksen Derivat.As.Fenamat à As.Mefenamat, Meklofenamat Derivat As.Fenilasetat à Diklofenak, Fenklofenak Derivat Oksikam à Piroksikam, Tenoksikam Der.As.Asetat inden/indol à Indometasin, Sulindak, Tolmetin Deriva Pirazolon à Azapropazon, Fenilbutazon, Oksifenbutazon

ABDIFLAM CODE: C29 Harga Per Satuan Terkecil : Rp1,350.00 Abdiflam Natrium diklofenak 25 mg; 50 mg. Indikasi: sakit pasca traumatik inflamatori, inflamasi dan bentuk degeneratif rematik, rematik non artikular. Dosis: Dewasa: awal: sehari100-150 mg dalam dosis terbagi 2-3x; Anak 14th: 75-100 mg sehari dalam dosis bagi 2-3x. Kemasan: 5 x 10 tablet 50 mg.

AFI RHEUMA CODE: C1

Harga Per Satuan Terkecil : Rp2,300.00 BELI AFI RHEUMA KAPSUL KOMpOSISI : Tiap kapsul mengandung : 4 butil 1,2 difenilpirazolidina 3,5 dion ................... 100 mg CARA KERJA OBAT : Sebagai anti radang dan analgetik INDIKASI : Ankylosing spondylitis, acute gouty arthritis, active rheumatoid arthritis. CARA PEMAKAIAN: Dewasa 2-3 kali sehari 1 kapsul, sesudah makan atau diminum dengan susu, seyogyanya sesuai petunjuk dokter. EFEK SAMPING: - Iritasi gastrointestinal (mual, muntah, rasa terbakar pada lambung). - Retensi : Cairan, edema, rash. - Gangguan hematologi yang serius (leukopenia, agranulositopenia, aplastik-anemia). - Alergi INTERAKSI OBAT: Jangan diberikan bersama - sama dengan : Kumarinantikoagulan, insulin, fenitoin, oral hipoglikemik. KEMASAN : Box isi 10 blister @ 12 kapsul Reg. No. DKL 8901700901 A1 Simpanlah obat ini ditempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER Allogon 500 Harga Per Satuan Terkecil : Rp700.00 BELI ALLOGON 500 mg. Komposisi Mefenamic acid/Asam mefenamat INDIKASI Nyeri ringan, sedang sampai berat seperti sakit kepala, nyeri otot, artralgia (nyeri sendi), sakit gigi, osteoartitis rematoid, gout, nyeri saat haid, nyeri setelah operasi, nyeri setelah terjadi patah tulang, nyeri setelah melahirkan, neuralgia (nyeri pada saraf), dan nyeri pada organ-organ dalam perut. KONTRA INDIKASI Gastritis, ulkus lambung, dan anemia hemolitik. PERHATIAN Kehamilan, dehidrasi, epilepsi, asma. Interaksi obat : antikoagulan oral. EFEK SAMPING

Gangguan & perdarahan saluran pencernaan, ulkus peptikum, sakit kepala, gugup, insomnia (sulit tidur), biduran/kaligata, kemerahan pada kulit, pembengkakan wajah. INDEKS KEAMANAN PADA WANITA HAMIL C: Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin. KEMASAN Kaplet 500 mg x 2 x 10 butir. DOSIS Dewasa : 250-500 mg tiap 6 jam sekali. Anak-anak : 6,5 mg/kg berat badan tiap 6-8 jam sekali. Nyeri saat : diawali dengan 500 mg, kemudian 250 mg tiap 6 jam. haid PENYAJIAN Dikonsumsi bersamaan dengan makanan PABRIK Konimex. Analsik CODE: C2 Harga Per Satuan Terkecil : Rp1,150.00 ANALSIK Tiap kaptet mengandung : Metampiron 500 mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. Metampiron adalah suatu obat analgesik- antipiretik. Diazepam mempunyai kerja sebagai antiansietas, juga memiliki sifat relaksasi otot rangka. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral. INDIKASi : Untuk meringankan rasa nyeri sedang sampai berat, ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam. Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg, wanita hamil dan menyusui. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. Glaukoma sudut sempit, keadaan psikosis akut. EFEK SAMPING : Dapat menimbulkan agranulositosis. Reaksi hipersensitivitas, reaksi pada kulit,ngantuk,pusing,lelah yang berlebihan. Konstipasi, depresi, diplopia, hipotensi, jaundice, perubahan libido, mual, tremor, retensi urin, vertigo. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan

Penderita dengan tekanan darah lebih rendah dari 100 mmHg. sakit punggung. maksimum 4 kaplet sehari. karena dapat berakibat fatal. INTERAKSI OBAT : Penggunaan bersama . KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. Diazepam mempunyai kerja sebagai antiansietas. sebaik-nya tidak digunakan untuk jangka pahjang.antipiretik. No.Indonesia Analspec CODE: C3 Harga Per Satuan Terkecil : Rp1. bursitis.bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam.30°C).: DPL8822208609A1. Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik.250. Metampiron adalah suatu obat analgesik.00 ANALSIK Tiap kaptet mengandung : Metampiron 500mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. gangguan fungsi hati atau ginjal. wanita hamil dan menyusui. PENYIMPANAN Simpan pada suhu kamar (25°.sama dengan obat . HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri. juga memiliki sifat relaksasi otot rangka. INDIKASI : Untuk meringankan rasa nyeri sedang sampai berat. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral. sindroma bahu lengan. Dibuat oleh : PT SANBE FARMA Bandung . Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg.halusinasi dan gangguan tidur. DOSIS : 1 kaplet. lumbago. Walaupun jarang menimbulkan agranulositosis.- darah/kelainan darah. ansietas.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam. ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. . Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut. Reg.

ansietas. vertigo.pusing.: DPL8822208609A1. Konstipasi. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. sebaik-nya tidak digunakan untuk jangka pahjang. DOSIS : 1 kaplet. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut. PENYIMPANAN Simpan pada suhu kamar (25°. keadaan psikosis akut. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet. retensi urin. mual. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri. tremor. No. karena dapat berakibat fatal. Reg. jaundice.bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam. EFEK SAMPING : Dapat menimbulkan agranulositosis. perubahan libido. diplopia. sakit punggung. maksimum 4 kaplet sehari.halusinasi dan gangguan tidur.Glaukoma sudut sempit. gangguan fungsi hati atau ginjal. Dibuat oleh : PT SANBE FARMA Bandung . Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik. INTERAKSI OBAT : Penggunaan bersama . Reaksi hipersensitivitas.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam. lumbago.Indonesia Anastan CODE: C4 Harga Per Satuan Terkecil : Rp250. bursitis. sindroma bahu lengan.sama dengan obat . Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut.30°C).lelah yang berlebihan. depresi.00 ANASTAN (Mefenamic Acid) 500 mg . Walaupun jarang menimbulkan agranulositosis. hipotensi.ngantuk. reaksi pada kulit.

Harus dengan resep dokter No. Peringatan dan Perhatian : Dalam pengooatan. Enteraksi obat : Dengan obat anti coagulant. Komposisi : Tiap kaplet mengandung Acidum Mefenamicum 500 mg (Anastan Forte). aiergik rinrtis atau urticaria karena obat non steroid anti inflamasi yang lain.anak dibawah 14 tahun belum diketahui dengan pasti. karena kemungkinan terjadi" cross sensitivity". Cara penyimpanan : Disimpan di tempat tertutup dan diluar pengaruh cahaya. mengurangi kerja obat anti coagulant. Juga dapat timbul kantuk. berkhasiat analgesic dan anti inflamasi. albuminiea dan kencing darah. Tiap kapsul mengandung Acidum Mefenamicum 250 mg. Reg. nervous dan sakit kepala. Digunakart tidak lebih dari 7 hari.anak diatas 14 tahun : - Anastan forte jam. Mempengaruhi test darah.Anastan adalah obat yang mengandung Acidum Mefenamicum. Penderita asma. thrombocytopenia. Mempengaruhi test urine. Wanita mengandung atau sedang menyusui.00 Antalgin . : Anastan forte DKL 9207802304 A1 Antalgin CODE: C5 Harga Per Satuan Terkecil : Rp150. sehingga billirubin urine positif dan protein uria positif. Juga pada penderita gangguan fungsi ginjal atau pernah menderita sakit ginjal atau hati. sakit kepaia.hati pada penderita yang mendapat bronkospasma. Kemasan : Anastan forte : Dos isi 10 strip @ 10 kaplet. anemia. bila cfiare maka pengobatan dihentikan. : Awal 1 kaplet (500 mg) kemudian Vi kaplet (250 mg) tiap 6 Indikasi : Sebagai obat untuk meringankan rasa sakit seperti pada sakit gigi. Keamanan penggunaan pada anak . terjadi tukak lambung dan pendarahan. Kontra indikasi : Obat kontra indikasi bagi penderita sakit tukak lambung atau inflamasi pada saluran cerna. nyeri sesudah operasi dan dysmenorrhoea primer. sehingga hemoiytic anemia coombs positif. nausea dezziness. Posologi : Dewasa dan anak . Efek samping : Dapat timbul diare biasa hingga berat. Dapat timbul asma. Hati . Dapat timbul agranucytosis.

Bayi 3 bulan pertama atau dengan berat badandibawah 5 kg.: GKL9420906010A1 Antalgin 500 mg.200. normal). Reg. Indikasi : Untuk menghilangkan rasa sakit.30°C (kondisi penyimpanan.00 ANTRAIN TABLET . maka sebaiknya tidak digunakan terus-menerus dalam jangka panjang. Penderita dengan tekanan darah <100 mmHg. kotak 10 blister @ 10 tablet No. Cara Kerja Obat : Antalgin adalah derivat metansulfonat dan amidopirina yang bekerja terhadap susunan saraf pusat yaitu mengurangi sensitivitas reseptor rasa nyeri dan mempengaruhi pusat pengatur suhu tubuh. antipiretik danantiinflamasi.INJEKSI© . Peringatan dan Perhatian : Karena dapat menimbulkan agranulositosis yang berakibat fatal. botol 1000 tablet No. Penderita yang hipersensitif. Dewasa : sehari 3 kali 1 tablet. Tiga efek utama adalah sebagai analgesik. Pada penggunaan jangka panjang dapat menyebabkan agranulositosis.Komposisi Tiap tablet mengandung antalgin 500 mg.Reg. Antalgin mudah larut dalam air dan mudah diabsorpsi ke dalam jaringan tubuh. Kontra indikasi : Pada penderita yang alergi terhadap derivat pirazolon.:GKL9420906010A1 HARUS DENGAN RESEP DOKTER INDO FARMA BEKASI – INDONESIA Antrain CODE: C6 Harga Per Satuan Terkecil : Rp10. terutama kolik dan sakit setelah operasi. Efek Samping : Gejala kepekaan yang manifestasinya kelainan pada kulit. Cara Penyimpanan : Simpan pada suhu 25° . Dosis dan Cara Penggunaan : Melalui mulut (per oral). Kemasan dan Nomor Registrasi Antalgin 500 mg. WanitahamilteTutama^B bulan pertamanaTT6 minggu terakhir. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah. Kasus porfiria hati (amat jarang) dan defisiensi bawaan glukosa-6-fosfat-dehidrogenase.

Wanita hamil dan menyusui. KONTRA INDIKASI : Penderita hipersensitif terhadap Metamizole Na. Penderita dengan tekanan darah sistolik < 100 mmHg. Metamizole Na bekerja sebagai analgesik. diberikan secara injeksi I. berikutnya 1 tablet tiap 6-8 jam.bursitis. No. INTERAKSI OBAT : Bila Metamizole Na diberikan bersamaan dengan Chlorpromazine dapat mengakibatkan hipotermia.lumbago. Mekanisme kerjanya adalah menghambat transmisi rasa sakit ke susunan saraf pusat dan perifer. gangguan fungsi hati atau ginjal. maksimum 3 kali sehari.sakit punggung. Pada pemakaian jangka lama dapat menimbulkan sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan. Bayi di bawah 3 buian atau dengan berat badan kurang dari 5 kg.:DKL7617611210A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA ANTRAIN* Injeksi Kotak berisi 5 ampul @ 2 ml netto Reg. PERINGATAN / PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik.V. Agranulositosis. ATURAN PAKAI : Dewasa: Tablet : 1 tablet jika sakit timbul. berikutnya 500 mg tiap 6-8 jam.maksimum 4 tablet sehari. Karena dapat menimbulkan agranulositosis yang berakibat fatal. Karena itu perlu dilakukan pemeriksaan fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. EFEK SAMPING : Reaksi hipersensitivitas: reaksi pada kulitmisal kemerahan.M. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. INDIKASI : Untuk meringankan rasa sakit.: DKL0117616843A1 JAUHKAN DARI JANGKAUAN ANAK . maka sebaiknya tidak digunakan dalam jangka panjang.ANAK HARUS DENGAN RESEP DOKTER . Injeksi : 500 mg jika sakit timbul. KEMASAN : ANTRAIN* Tablet Kotak berisi 10 strip @ 10 tablet Reg.terutama nyeri kolik operasi. diabsorpsi dari saluran pencernaan mempunyai waktu paruh 1-4 jam. atau I.KOMPOSISI : Tiap tablet mengandung : Metamizole Na 500 mg ANTRAINI Injeksi Tiap ml mengandung: Metamizole Na 500 mg CARA KERJA OBAT : Metamizole Na adalah derivat metansulfonat dari aminopirin yang mempunyai khasiat analgesik.sindroma bahu lengan.No.

Peringatan dan Perhatian Tidak dianjurkan diberikan pada wanita hamil dan menyusui. Kontra indikasi : Tukak lambung. karena dapat terjadi sensitivitas silang. dismenore. nyeri saat melahirkan. muntah. Box 10 Strip @10 Kapsul. Interbat Jl. ARGESID 500 Tiap Kaplet salut selaput mengandung Asam Mefenamat 500 mg Farmakologi : Asam Mefenamat merupakan anti inflamasi non-steroid. alergik rinitis. Dosis : Dewasa dan anak-anak di atas 14 tahun: Dosis awal 500mg kemudian dilanjutkan 250 mg tiap 6 jam. Kemasan: ARGESID 250. No. radang gangguan ginjal. diare. mual.SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA JANGAN DISIMPAN DALAM LEMARI PEMBEKU Diproduksi Oleh : PT. Reg.: DKL0033201I301A1 ARGESID 500 . sakit kepala.00 ARGESID Asam Mefenamat KOMPOSISI : ARGESID 250 Tiap kapsul mengandung Asam Mefenamat 250 mg. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase sehingga mempunyai efek analgetik dan antiinflamasi. 1 Buduran. Interaksi Obat : Obat-obatan antikoagulan oral seperti warfarin. vertigo. Mangundiprojo no. Efek samping : Gangguan saluran cerna seperti iritasi lambung.R. Tidak boleh melebihi dosis yang dianjurkan dan lebih dari 7 hari. asetosal. urtikaria atau mendapat pengobatan antiinflamasi non-steroid lainnya. pusing. sakit kepala. dispepsia. Hati-hati pemberian pada penderita bronkhospasme. meredakan rasa nyeri seperti nyeri otot. usus. Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahui. kolik. nyeri karena trauma. H. ruam makulo papular. Sidoarjo-61252 Jawa Timur.M. Pada penggunaan terusmenerus dengan dosis 2000 mg atau lebih sehari dapat mengakibatkan agranulositosis dan hemolitik anemia. Indikasi : untuk meredakan rasa sakit seperti sakit gigi. Indonesia Argesid 500mg Harga Per Satuan Terkecil : Rp1. nyeri sesudah operasi. kecuali atas petunjuk dokter.100. hipersensitif usus.

Insufisiensi ginjal berat yang tidak didialisa. Pendarahan gastrointestinal. terutama .konstipasi. PROMEDRAHARDJO FARMASIINDUSTRI Sukabumi – Indonesia Artrilox 15 CODE: C8 Harga Per Satuan Terkecil : Rp7. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma. muntah-muntah.5 mg mengandung Meloxicam 7. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan.00 Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. Mekanisme kerja meloxicam sebagai efek anti-inflamasi. Anemia.Box 10 Strip @10 Kaplet No. rasa mual. polip dihidung. Masa kehamilan dan menyusui. diare. analgesik. EFEK SAMPING : Saluran cerna : dispepsia.700. esofagitis. x Anakanak dan remaja yang berumur kurang dari 15 tahun.: DKL0033201109A1 ( Simpan di tempat sejuk (15-25)°C dan kering ) HARUS DENGAN RESEP DOKTER PROMED PT. ruam kulit. ulkus gastroduodenal. Bila diberikan bersama-sama dengan obat mielotoksik yang potent. Reg. rasa kembung. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serumkreatinin dan/atau serum urea. jarang terjadi kolitis. bersendawa. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. rasa sakit di perut. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut. urtikaria. Penghambatan COX2 menentukan efek terapi NSAI. stomatitis. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya. Insufisiensi hepar yang berat. lekopenia dan trombosito penia. Pada kulit : pruritus.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik). KONTRA INDIKASI : Ulkus lambung yang aktif. jarang terjadi fotosensitisasi. pendarahan gastro-intestinal makroskopik. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. gangguan jumlah sel darah : lekosit.

hati ataupun jantung. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. sirosis hati. Pasien yang beresiko tinggi adalah pasien yang dehidrasi. Pada pasien yang volume & aliran darah ke ginjal menurun. Bila kondisi ini dalam waktu lama. vertigo. sindrom nefrotik. hati atau jantung. Pemberian bersama ticlopidine (anti-koagulan oral).methotrexate. nekrosis medularis ginjal. dosis meloxicam tidak boleh melebihi 7. Sistem susunan saraf pusat : kepala terasa ringan. sindrom nefrotik dan penyakit ginjal.5 mg/hari. Kardiovaskuler: edema. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. tinitus. Pernafasan : jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. Seperti hal obat-obat NSAI. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. maka harus dimonitor efek - . Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. palpitasi. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. ngantuk. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. Pada pasien tersebut. peningkatan tekanan darah. trombolitik dapat meningkatkan resiko pendarahan. Seperti halnya obat-obat NSAI lainnya. diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. muka kemerahan. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. dianjurkan untuk menghentikan aktivitas. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). pusing. Seperti pada obat-obat NSAI. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. akan menyebabkan terjadinya sitopenia. Bila pemberian bersama obat anti koagulan tidak dapat dihindari. Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. heparin secara sistemik. INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. pasien dengan gagal jantung kongestif. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. dan pada umumnya orang tua menderita gangguan fungsi ginjal. glomerulonefritis. NSAI jarang menimbulkan nefritis interstitial.

Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7.5 mg/hari.00 .5 CODE: C7 Harga Per Satuan Terkecil : Rp4.5 mg Tablet Box. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN. Dosis terapeutik dapat dikurangi sampai 7. dianjurkan untuk memonitor jumlah sel darah.DKL9904125810A1 Artrilox 15 mg Tablet Box. Kontrasepsi : menurunkan efektivitas alat KB IUD.farmasiku.com Artrilox 7.700. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas. sehingga perlu dimonitor fungsi ginjal. KEMASAN : Artrilox 7.5 mg per hari. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi. Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7.Reg. Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal. 2 Strip @ 10 Tablet No. vasodilator. ACE inhibitor. DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari. Tablet harus ditelan dengan air/minuman pada waktu makan. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker.Reg. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate.5 mg/hari tergantung respon klinis. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam. sehingga akan mempercepat eliminasi meloxicam. 2 Strip @ 10 Tablet No.antikoagulan. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium.5 mg per hari. Osteoartritis:7. Pada pasien yang dehidrasi. Artritis reumatoid :15 mg/hari. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEPDOKTER Diproduksi oleh: COMBIPHAR BANDUNG-INDONESIA http://www.

rasa mual. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik). EFEK SAMPING : Saluran cerna : dispepsia. rasa sakit di perut. esofagitis. Insufisiensi ginjal berat yang tidak didialisa. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan. diare. analgesik. Insufisiensi hepar yang berat. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). Penghambatan COX2 menentukan efek terapi NSAI. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. pendarahan gastro-intestinal makroskopik. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin. x Anakanak dan remaja yang berumur kurang dari 15 tahun. bersendawa. Pendarahan gastrointestinal. KONTRA INDIKASI : Ulkus lambung yang aktif. Masa kehamilan dan menyusui. muntah-muntah. Mekanisme kerja meloxicam sebagai efek anti-inflamasi. konstipasi.5 mg mengandung Meloxicam 7. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut. polip dihidung. jarang terjadi kolitis. ulkus gastroduodenal. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1.BELI Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serum kreatinin . rasa kembung.

Seperti hal obat-obat NSAI. Pada pasien tersebut. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. peningkatan tekanan darah. pusing. Pasien yang beresiko tinggi adalah pasien yang dehidrasi. palpitasi. Kardiovaskuler : edema. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. sindrom nefrotik. glomerulonefritis. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. tinitus. Bila diberikan bersama-sama dengan obat mielotoksik yang potent.- dan/atau serum urea. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. akan menyebabkan terjadinya sitopenia. Anemia. pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. Pada kulit : pruritus. stomatitis. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. hati atau jantung. gangguan jumlah sel darah : lekosit. ngantuk. Pernafasan:jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. sindrom nefrotik dan penyakit ginjal. urtikaria. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. lekopenia dan trombosito penia. vertigo. terutama methotrexate. jarang terjadi fotosensitisasi. ruam kulit. Seperti halnya obat-obat NSAI lainnya. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). - - - - . hati ataupun jantung. Seperti pada obat-obat NSAI. dan pada umumnya orang tua menderita gangguan fungsi ginjal. sirosis hati. Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. dianjurkan untuk menghentikan aktivitas. dosis meloxicam tidak boleh melebihi 7. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. Sistem susunan saraf pusat : kepala terasa ringan.5 mg/hari. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. nekrosis medularis ginjal. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. pasien dengan gagal jantung kongestif. Bila kondisi ini dalam waktu lama. muka kemerahan. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. Pada pasien yang volume & aliran darah ke ginjal menurun. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. NSAI jarang menimbulkan nefritis interstitial.

maka harus dimonitor efek antikoagulan.5 mg per hari. Kontrasepsi : menurunkan efektivitas alat KB IUD. Osteoartritis:7. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari.5 mg/hari tergantung respon klinis. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker. ACE inhibitor. . Artritis reumatoid :15 mg/hari. Dosis terapeutik dapat dikurangi sampai 7. Pemberian bersama ticlopidine (anti-koagulan oral). Pada pasien yang dehidrasi. heparin secara sistemik. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. sehingga akan mempercepat eliminasi meloxicam. Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam.5 mg per hari. - - - DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari.INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi. Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7. Bila pemberian bersama obat anti koagulan tidak dapat dihindari.5 mg/hari. dianjurkan untuk memonitor jumlah sel darah. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal. Tablet harus ditelan dengan air/minuman pada waktu makan. sehingga perlu dimonitor fungsi ginjal. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate. trombolitik dapat meningkatkan resiko pendarahan. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium. vasodilator. Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7.

Reg.Reg. 2 Strip @ 10 Tablet No. KOMPOSISI : Tiap kapsui mengandung 250 mg Asam mefenamat "Flap kaplet 500 mg salut selaput mengandung 500 mg Asam mefenamat. KEMASAN : Artrilox 7.5 mg Tablet Box.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN. POSOLOGI : Dewasa dan anak diatas 14 tahun Dosis awal dianjurkan 500 mg kemudian dilanjutkan250 mg tiap jam sesudah makan. Kaplet 500 mg. INDIKASI : .DKL9904125810A1 Artrilox 15 mg Tablet Box. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEP DOKTER Di produksi oleh: COMBIPHAR BANDUNG-INDONESIA Asam Mefenamat Kapsul 250 mg. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2.Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya. 2 Strip @ 10 Tablet No.

termasuk nyeri karena trauma. PHYTO KEMO AGUNG FARM A Jakarta . terhindar dari cahaya.Untuk menghitangkan segala macam nyeri dan ringan sampai sedang dalam kondisi akut dan kronis. KONTRA INDIKASI : Pada penderita dengati tukak lambung / usus. Jangan digunakan lebih dan dosis yang dianjurkan atau lebih dari 7 hari kecuali atas petunjuk dokter.00 BELI ASIMAT 500 .T. PERINGATAN DAN PERHATIAN : Jangan dibenkan pada penderita bronkospasme aliergik rhinitis. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. Harus dengan resep dokter. No. nyeri sewaktu haid. EFEK SAMPING : Umumnya Asam Mefenamat dapat dibenkan dengan baik pada dosis yang dianjurkan. urticaria atau mendapat obat non steroid anti-inflamasi yang lain karena kemungkinan terjadi sensitiyitas silang Jangan digunakan pada wanita hamil dan menyusui. KEMASAN : Kapsul 250mg : Dus 10 strip® 10 Kapsui . pada penggunaan jangka panjang yang terus menerus dengan dosis 2000 mg atau lebih sehan dapat mengakibatkan agranulositosis dan hemolitik anemia. P. sakit sehabis operasi dan melahirkan. Reg : GKL9930011201 A1 Kaplet 500 mg : Dus 10 strip® 10 Kaplet .Indonesia Asimat CODE: C10 Harga Per Satuan Terkecil : Rp800. muntah. sakit kepala dan sakit gigi. Keamanan penggunaan pada anak-anak dibawah umur 14 tahun belum diketahui dengan pasti. diare. No Reg GKL 9830010709 A1 CARA PENYIMPANAN : Simpan ditempat kering dansejuk. nyeri otot. nyeri sendi. pendenta asma.penderita ginjal dan penderita yang hipersensitif.

INDIKASI : Untuk mengurangi nyeri dari ringan sampai sedang dalam kondisi akut dan kronis. sakit sehabis melahirkan. perdarahan lambung. . termasuk nyeri karena trauma.KOMPOSISI : Tiap kaplet salut selaput ASIMAT500 mengandung Mefenamic Acid 500 mg CARA KERJA : Mefenamic Acid adalah suatu analgetik yang mempunyai daya anti-inflamasi. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. EFEK SAMPING : Efek samping yang timbul umumnya dapat ditolerir dengan baik pada dosis yang dianjurkan. penderita asma. muntah dan diare. sakit kepala dan sakit gigi. nyeri sewaktu haid. nyeri otot. POSOLOGI / DOSIS : Dewasa dan anak-anak > 14 tahun : Dosis oral yang dianjurkan 500 mg kemudian dilanjutkan 250 mg setiap 6 jam jika diperiukan. Agranulositosis dan hemolitik anemia mungkin dapat terjadi pada penggunaan dalam jangka waktu lama yang terus menerus dengan dosis 2000 mg atau lebih sehari. penderita ginjal dan penderita yang hipersensitif terhadap Mefenamic Acid. pusing. KONTRA INDIKASI : Pada penderita dengan tukak lambung / usus.

Indonesia BlI-24/02/05 AULIN TABLET 100 MG Harga Per Satuan Terkecil : Rp4. Jangan digunakan pada wanita hamil dan menyusui. MERSIFARMATM Sukabumi . terlindung dari cahaya matahari. CARA PENYIMPANAN : Simpan di tempat sejuk dan kering.PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. 10 strip @ 10 kaplet salut selaput ASIMAT 500. INTERAKSI OBAT : Antikoagulan oral. DKL9833300909A1 HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT. Reg. Jangan digunakan lebih dari dosis yang dianjurkan atau lebih dari 7 hah kecuali atas petunjukdokter. urticaria atau mendapat obat nonsteroid anti-inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. Jauhkan obat dari jangkauan anak-anak.550. No. Keamanan pengguhaan pada anak-anak di bawah 14 tahun belum diketahui dengan pasti. PENGEMASAN DAN NOMOR REGISTRASI Box. allergic rhinitis.00 BELI AULIN TABLET 100 MG KOMPOSISI : Tiap tablet mengandung Nimesulide 100 mg URAIAN : .

atau pendarahan gastrointetinal.ulserasi berulang. DKI 0051900210A1 PABRIK : Helsinn Birex Pharmaceuticals HARUS DENGAN RESEP DOKTER Benostan 500 Harga Per Satuan Terkecil : Rp1.Penggunaan pada anak-anak KEMASAN & NO REG. urticaria) terhadap OAINS dan acetosal . .4-NITRO-2-phenoxymethane sulponanilide INDIKASI : Aulin merupakan suatu obat anti inflamasi non steroid untuk berbagai kondisi yang membutuhkan anti inflamasi.Pasien dengan insufisiensi hepar sedang atau berat . Setiap box berisi 2 blister @ 10 tablet 100 mg Nimesulide. analgesika. antipiretika seperti osteoarthritis penyakit rematikekstra-artikular. DOSIS & CARA PEMAKAIAN : .Pasien dengan kelainan fungsi ginjal berat (CCT <30 ml/menit) .250. rasa nyeri dan inflamasi setelah intervensi bedah dan setelah trauma akut dan dismenoria.Orang dewasa 1 tablet 2xsehari setelah makan (1 tablet 100 mg) .Pasien dengan tukak lambung atau usus.Aulin tidak dianjurkan digunakan pada anak-anak dibawah 12 tahun KONTRA INDIKASI : . pendarahan serebrovaskular.rhinitis.Pasien yang diketahui hipersensitif terhadap Nimesulide .Pasien dengan riwayat reaksi hipersensitif (seperti bronkospasme. atau pendarahan aktif lainnya atau gangguan pendarahan .Pasien dengan gangguan koagulasi berat .00 BELI BENOSTAN tab KOMPOSISI Mefenamic acid/Asam mefenamat .

. migren. ulkus peptikum.5 mg/kg berat badan/hari dalam 3-4 dosis terbagi. epilepsi. ruam kulit. PERHATIAN Kehamilan.gangguan penglihatan. mengantuk. asma. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin.INDIKASI Nyeri. gugup. 6. KONTRA INDIKASI Ulkus peptikum atau ulserasi usus. sakit kepala. dehidrasi. nyeri rematik PENYAJIAN Dikonsumsi bersamaan dengan makanan : : : 3 kali sehari 250 -500 mg. pusing. EFEK SAMPING Gangguan & perdarahan saluran pencernaan. penyakit ginjal. kerusakan hati atau ginjal. INDEKS KEAMANAN PADA WANITA HAMIL Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. 3 kali sehari 500 mg. demam. Interaksi obat : antikoagulan oral. penyakit radang usus besar. diskrasia darah. KEMASAN Tablet 500 mg 10stp DOSIS • Dewasa Anak berusia 6 bulan atau • lebih Dismenore (nyeri saat • haid).

muntah. EFEK SAMPING : Sistem pencernaan : mual. Bimastan CODE: C11 Harga Per Satuan Terkecil : Rp200. 250 mg. . INDIKASI : Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala.00 BELI BIMASTAN© KOMPOSISI : Tiap kapsul mengandung: MefenamicAcid Tiap kaptab salut selaput mengandung: MefenamicAcid Tiap kaptab mengandung: MefenamicAcid 500 mg. nyeri otot dan nyeri sesudahoperasi. CARA KERJA OBAT : Bimastan merupakan kelompok anti inflamasi non steroid. sakit gigi. TAKARAN PEMAKAIAN : Dewasa dan anak-anak > 14 tahun: Dosis awai: 500 mg. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik. Penderita dengan gangguan ginjal yang berat. diare dan rasa sakit pada abdominal. alergi rhinitis dan urtikaria. termasuk nyeri karena trauma. KONTRA INDIKASI : Pasien yang hipersensitif terhadap Mefenamie Acid. kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. anti infiamasi dan antipiretik. 500 mg. dismenore primer.PABRIK Bernofarm. Penderita yang dengan Asetosal mengalami bronkospasme. Penderita dengan tukak lambung dan usus.

-

Sistem hematopetik : leukopenia, eosinophilia, trombocytopenia dan agranulocytopenia. Sistem saraf : rasa mengantuk, pusing, penglihatan kabur dan insomnia.

PERINGATAN DAN PERHATIAN : Sebaiknya diminum sesudah makan. Hati-hati digunakan pada wanita hamil dan menyusui. Keamanan penggunaan pada anak - anak dibawah 14 tahun belum diketahui dengan pasti. KONTRA INDIKASI : Penggunaan bersama antikoagulan oral dapat memperpanjang "Prothrombin".

OVER DOSIS : Jika terjadi over dosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbon absorben) untuk menyerap obat. KEMASAN : Dus isi 10strip® "10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 10 strip @ 10 kaptab No. Reg. DKL 8931402104 A1 Dus isi 50 blister @ 10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 40 blister @ 10 kaptab salut selaput No. Reg. DKL 9731407209 A1 Dus isi 10 blister @ 10 kaptab salut selaput No. Reg. DKL 0431407209 A1 Botol isi 1.000 kapsul No. Reg. DKL 8931402001 A1

250mg 500 mg 250 mg 500 mg 500 mg 250 mg

SIMPAN DITEMPAT SEJUK (15 - 25)°C DAN KERINGTERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT. BIMA MITRA FARMA TANGERANG - INDONESIA Bio mega CODE: C12

Harga Per Satuan Terkecil : Rp300.00 BELI BIO MEGA

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiro Vitamin B1 Vitamin B6 Vitamin B12 INDIKASI :

500 mg 50 mg 50 mg 100 mcg

Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat. KONTRA INDIKASI : * * * * Penderita hipersensitif Bayi di bawah 3 bulan, atau dengan berat badan di bawah 5 kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg

EFEK SAMPING : Agranulositosis, reaksi kepekaan, mengantukdan pusing."

PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu, lengan. Karena dapat menimbulkan agranulositosis yang berakibat fatal, maka sebaiknya tidak digunakan dalam jangka panjang terusmenerus. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius.

DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput.

KEMASAN : Dus, isi 10 strip @ 10 tablet salut selaput NO. REG. DKL9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT. GRAHA FARMA SOLO - INDONESIA Biomega 10 Kaplet Harga Per Satuan Terkecil : Rp300.00 BELI Biomega

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiron Vitamin B1 Vitamin B6 Vitamin B12

INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat.

KONTRA INDIKASI :

GRAHA PARMA SOLO . mengantuk dan pusing. REG. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.INDONESIA Biropyron Harga Per Satuan Terkecil : Rp300. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius. PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. lengan. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut.- Penderita hipersensitif Bayi dibawah 3bulan. reaksi kepekaan. KEMASAN : Dus. DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput. sindroma bahu. gangguan fungsi hati atau ginjal. DKL 9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT.atau dengan berat badan dibawah 5kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg EFEK SAMPING : Agranulositosis. sakit punggung. bursitis. lumbago. isi 10 strip @ 10 tablet salut selaput NO.00 BELI BIROPYRON Kaplet Salut Selaput .

Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. maka sebaiknya tidak digunakan dalam waktu panjang dan terus menerus.500. sindroma bahu lengan. Reg. DKL0231406809 A2 Botol isi 1. ginjal. lumbago. KONTRA INDIKASI: . Reg.Wanita hamil dan menyusui . BIMA MITRA FARMA TANGERANG . karena itu perlu dilakukan pemeriksaan uji fungsi hati atau ginjal dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. . .Karena dapat menimbulkan agranulositosis dan berakibat fatal. DOSIS: 1 kaplet 3x sehari . gangguan fungsi hati.000 kaplet No. PERINGATAN DAN PERHATIAN: . .Penderita hipersensitif .Hati.Penderita dengan tekanan darah sistolik < 100 mm Hg EFEKSAMPING: Reaksi hipersensitif pada kulit. DKL0231406809 A1 SIMPAN DITEMPAT SEJUK (15-25)°C DAN KERING TERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT. KEMASAN: Dus isi 10 Strip® 10 Kaplet No. misalnya kemerahan dan agranulositosis.INDONESIA Bodrex CODE: C13 Harga Per Satuan Terkecil : Rp5.hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.KOMPOSISI: Tiap kaplet salut selaput mengandung: Methampyrone 500 mg Thiamine HCl 50 mg Pyridoxine HCl 100 mg Cyanocobalamine 100 mcg INDIKASI: Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia. bursitis.00 BELI BODREX . sakit punggung.Pada pemakaian jangka lama dapat timbul sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan.

EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. • Penderita Hipersensitif. segera hubungi dokter/unit pelayanan kesehatan terdekat. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter.Meringankan SAKIT KEPALA. sakit gigi. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. . dapat meningkatkan resiko kerusakan fungsi hati. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. SAKIT GIGI dan menurunkan DEMAM. INDIKASI : Meringankan SAKIT KEPALA. • Reaksi hipersensitifitas. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat.

... TEMPO SCAN PACIFIC Tbk....... DBL 8522700810 A1 Dibuat oleh P.antipiretik(demam) dan anti inflamasi(mengurangi proses peradangan)..........efek analgesik dari paracetamol dan ibuprofen bejerja sinergis dengan caffeine dalam meredakan sakit kepala INDIKASI .. Bekasi-lndonesia atas lisensi dari DR. PHARM.........T........350 mg ibuprofen.... No.00 BELI BODREX EXTRA KOMPOSISI tiap tablet mengandung : paracetamol....700....... FRITZ BODE GmbH/ CHEM.SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg.50 mg CARA KERJA OBAT paracetamol merupakan analgetik-antipiretik dan ibuprofen merupakan obat golongan analgetik-antipiretik dan anti inflamasi non steroid (AINS) yang memiliki efek analgetik(menghilangkan rasa nyeri).............. FABRIK / Rheinfelden / Germany P91108000 Bodrex Extra CODE: C111 Harga Per Satuan Terkecil : Rp3..........200 mg caffeine...

3-4 kali sehari anak-anak 6-12 tahun : 1/2-1 kaplet.muntah.meredakan sakit kepala DOSIS dan ATURAN PAKAI dewasa dan anak-anak >12 tahun : 1-2 kaplet.No. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : .00 BELI BODREX Meringankan SAKIT KEPALA.kemerahan pada kulit dan gangguan darah INTERAKSI OBAT efek toksik dari paracetamol dapat meningkat pada pemberian bersam-sama dengan obat yang menyebabkan kerusakan hati SIMPAN PADA SUHU DI BAWAH 30'C Reg.DTL0622719204A1 PT.Tempo Scan Pacific Tbk.200. Bekasi-Indonesia Bodrex Flu batuk CODE: C14 Harga Per Satuan Terkecil : Rp1. 3-4 kali sehari EFEK SAMPING gangguan saluran cerna seperti mual.nyeri ulu hati.

• Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. • Reaksi hipersensitifitas. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. No. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. INDIKASI : Meringankan SAKIT KEPALA.Parasetamol Kofein CARA KERJA OBAT : 600 mg 50 mg bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. DBL 8522700810 A1 Dibuat oleh . SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg. • Penderita Hipersensitif. segera hubungi dokter/unit pelayanan kesehatan terdekat. sakit gigi. SAKIT GIGI dan menurunkan DEMAM. dapat meningkatkan resiko kerusakan fungsi hati.

PHARM. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. SAKIT GIGI dan menurunkan DEMAM. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. dapat . FABRIK / Rheinfelden / Germany P91108000 Bodrex migra CODE: C15 Harga Per Satuan Terkecil : Rp1. sakit gigi. segera hubungi dokter/unit pelayanan kesehatan terdekat. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. FRITZ BODE GmbH/ CHEM. TEMPO SCAN PACIFIC Tbk. Bekasi-lndonesia atas lisensi dari DR. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang.00 BELI BODREX Meringankan SAKIT KEPALA. • Reaksi hipersensitifitas. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam.P. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala.T. INDIKASI : Meringankan SAKIT KEPALA.300. • Penderita Hipersensitif. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter.

..... .......... FABRIK / Rheinfelden / Germany P91108000 Cargesik 500 Kaplet CODE: C111 Harga Per Satuan Terkecil : Rp250. SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg.. TEMPO SCAN PACIFIC Tbk.... INDIKASI Meredam nyeri ringan sampai sedang sehubungan dengan sakit kepala..• meningkatkan resiko kerusakan fungsi hati.... penglihatan kabur dan insomnia................. alergi rhinitis dan urtikaria.. ..Penderita yang dengan aspirin mengalami bronkospasme..... 500 mg Asam Mefenamat merupakan kelompok anti-inftamasi non steroid.....Penderita dengan tultaK lambung dan usus.. muntah. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik.. . pusing.... trombocytopenia dan agranulocytopenia...... EFEK SAMPING : ..... dismenore primer.Sistem saraf: rasa mengantuk... FRITZ BODE GmbH/ CHEM...00 BELI Cargesik KOMPOSISI: Tiap kaplet mengandung Asam Mefenamat. PHARM.. PERINGATAN DAN PERHATIAN : ...Sebaiknya diminum sesudah makan............T.....Sistem pencemaan : mual.. 500 mg Tiap kapsul mengandung Asam Mefenamat..... eosinophilia...... diare dan rasa sakit pada abdominal...Penderita dengan gangguan ginjal yang berat. Hati-hati penggunaan obat ini pada penderita penyakit ginjal.......... KONTRA INDIKASI: . sakit gigi.Penderita yang hipersensitif terhadap asam mefenamat... .Sistem hematopoetik : Leukopenia... anti-inflamasi dan antipiretik. nyeri otot dan nyeri sesudah operasi......... termasuk nyeri karena trauma..... No......... ... Bekasi-lndonesia atas lisensi dari DR. DBL 8522700810 A1 Dibuat oleh P. ..

OVERDOSIS: Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktlf (karbo adsorben) untuk menyerap obat. Prof. Pill ini cocok untuk : Sakit pinggang. DOSIS: Secara umum-dapat digunakan dosis pemakaian sebagai berikut: Dewasa dan anak-anak > 14 tahun : Dosis awal: 500 mg. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan. USA. Dengan ramuan yang berhasil itu.Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahul dengan pasti. Reg. Reg. . INTERAKSI OBAT : Penggunaan bersamaan antikoagulan oral dapat memperpanjang "prothrombln*. kemudian dianjurion 250 mg tiap 6 jam sesuai dengan kebutuhan.Hati-hati jika digunakan pada wanita hamil dan menyusui.: DKL 9323402504 A2 HARUS DENGAN RESEP DOKTER SIMPAN PADA SUHU KAMAR (25 . encok pada pangkal paha.000.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. Reg.30)°C Semarang . yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan. Pemakaian sebaiknya sesudah makan.Dus.Dus.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik. ..Botol plastik @ 500 kapsul No. KEMASAN & No. Atau menurut petunjuk dokter. rheumatik atau sering buang air diwaktu malam. Reg.: DKL 9323402504 Al . dengan melalui percobaan selama bertahun . : DKL 9123401701 Al . Cara pemakaian : Dewasa : .Indonesia Carroll Super Pills Botol CODE: C17 Harga Per Satuan Terkecil : Rp11. isl 10 strip @ 10 kaplet No. Dokter Carroll. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide. isi 10 blister @ 10 kaplet No.

2 pill sebelum tidur. warna kencing menjadi biru atau hijau. : . dengan melalui percobaan selama bertahun . Perubahan warna ini adalah reaksi normal. encok pada pangkal paha. rheumatik atau sering buang air diwaktu malam. PERHATIAN : Setelah menelan pill ini. D 7811980 DIPRODUKSI OLEH : ARTOIS FARMA TANGERANG . Dianjurkan minum banyak air. diminum dengan air hangat. diminum 2 dengan kali air sehari. No.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik. 3 kali sehari. Reg. Pill ini cocok untuk : Sakit pinggang. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide.1 pill sebelum makan. hangat. Cara Dewasa 1 1 pill pill sebelum sebelum tidur. Keadaan yang sedikit berat boleh makan : 2 pill sebelum makan.INDONESIA Carroll Super Pills Sachet CODE: C16 Harga Per Satuan Terkecil : Rp1. diminum dengan air hangat. USA. Prof.250. pemakaian : makan. dan tidak menguatirkan. 2 kali sehari. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan. 1 pill sebelum tidur. Dokter Carroll.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan. Dengan ramuan yang berhasil itu.

minum Setelah menelan pill ini. OLEH : FARMA . Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi Efek samping : kadang-kadang nyeri epigastrium.INDONESIA CATAFLAM 25 CODE: C30 Harga Per Satuan Terkecil : Rp2.00 BELI Cataflam Kalium diklofenak 25 mg. air. : sebelum sebelum tidur. ruam kulit. D 7811980 DIPRODUKSI ARTOIS TANGERANG . Perubahan warna ini adalah reaksi normal. pusing atau vertigo.300. Kemasan : Dos 5x10 tablet 25 m. Reg. Dosis : Dewasa : awal :100-150 mg sehari. No. diminum boleh 3 dengan banyak makan kali air : sehari.Keadaan 2 pill 2 pill Dianjurkan PERHATIAN yang sedikit berat makan. 50 mg/tablet. sakit kepala. hangat. dan tidak menguatirkan. warna kencing menjadi biru atau hijau. Tidak boleh untuk anak.

Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi. Efek samping : kadang-kadang nyeri epigastrium. INDIKASI : Pengobatan jangka pendek pada peradangan & nyeri sesudah operasi. Cataflam D 50 Harga Per Satuan Terkecil : Rp4.00 BELI CATAFLAM D KANDUNGAN : Diclofenac / Diklofenak. Tidak boleh untuk anak.CATAFLAM 50 CODE: C31 Harga Per Satuan Terkecil : Rp4.350. Dosis: Dewasa : awal : 100-150 mg sehari. Kemasan : Dos 5x10 tablet 50 m. keadaan meradang setelah trauma (terpukul/terbentur/teririrs) yang disertai rasa sakit/nyeri.200. ruam kulit.00 BELI Cataflam Kalium diklofenak 25 mg. 50 mg/tablet. pusing atau vertigo. sakit kepala. osteoartritis (penyakit sendi degeneratif yang disertai dengan kelainan tulang .

• Anak berusia lebih dari 14 tahun : 2 tablet. hepatitis. pankreatitis. Metotreksat. antidiabetes oral. EFEK SAMPING : • Kadang-kadang : gangguan saluran pencernaan. DOSIS : • Dewasa: dosis awal 2-3 tablet. ruamkulit. pusing. perdarahan lambung-usus. penyakit Crohn. abnormalitas fungsi ginjal. gout akut. • Porfiria. • Jarang : ulkus peptikum. • Hamil. reumatisme non artikular & sindroma nyeri pada tulang belakang. eritema multiform. pneumonitis. vertigo. • Gangguan fungsi hati. KONTRA INDIKASI : Ulkus lambung atau usus. • Usia lanjut. Interaksi obat : Lithium. Siklosporin. jantung. . purpura (keadaan yang ditandai dengan bercak-bercak perdarahan dalam kulit atau selaput lendir). meningitis aseptik. atau ginjal. sindroma Stevens-Johnson.berdekatan). PERHATIAN : • Gejala/riwayat penyakit lambung-usus. sindroma Lyell. reaksi hipersensitifitas. eritroderma. diuretika. sakit kepala. • Kasus-kasus tertentu : gangguan perasaan atau penglihatan. antikoagulan. • Kehilangan volume ekstraseluler. menyusui. diskrasia darah. • Asma. INDEKS KEAMANAN PADA WANITA HAMIL : Baik penelitian reproduksi hewan tidak menunjukkan risiko pada janin maupun penelitian terkendali pada wanita hamil atau hewan coba tidak memperlihatkan efek merugikan (kecuali penurunan kesuburan) dimana tidak ada penelitian terkendali yang mengkonfirmasi risiko pada wanita hamil semester pertama (dan tidak ada bukti risiko pada trisemester selanjutnya). gangguan sistem kardiovaskular (jantung dan pembuluh darah). Dianjurkan untuk memonitor secara teratur fungsi hati & hitung darah selama • penggunaan jangka panjang. Digoksin. KEMASAN : Tablet 50 mg x 50 biji. • Kemampuan mengendarai & menggunakan mesin mungkin terpengaruh. peningkatan serum transaminase.

juga menunjukkan efek analgesik pada nyeri sedang dan berat. Nyeri dan inflamasi setelah operasi. PERINGATAN DAN PERHATIAN : . hidung atau tenggorokan. pruritus dan depresi. Kadang-kadang peningkatan enzim SGOT. SGPT.Diberikan dalam 2-3 dosis terbagi. PABRIK Novartis.00 BELI CATANAC KOMPOSISI : Tablet CATANAC 25 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac1 Tablet CATANAC 50 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac FARMAKOLOGI : Kalium Diclofenac merupakan anti inflamasi yang bukan golongan steroid. sakit kepala. Selain anti inflamasi. peptic ulcer. seperti operasi gigi atau tulang. nyeri dan demam. Catanac 50mg CODE: C18 Harga Per Satuan Terkecil : Rp2.400. vertigo. Peptic ulcer. Sebagai ajuvan pada nyeri inflamasi yang berat dari infeksi telinga. EFEK SAMPING : Gangguan pada saluran pencernaan. Bekerja menghambat biosintesa pros-taglandin yang merupakan faktor terbesar penyebab inflamasi. KONTRA INDIKASI : Hipersensitif terhadap diclofenac. INDIKASI : Sebagai pengobatan jangka pendek untuk kondisi-kondisi akut seperti: Nyeri inflamasi setelah trauma. seperti terkilir.

950. SOHO INDUSTRI PHARMASI Jakarta .T. 200mg. Tidak dianjurkan untuk wanita hamil dan menyusui. . Reg. INTERAKSI OBAT : Bila diberikan bersama produk lain yang mengandung Lithium. Bila diberikan bersama diuretik dan B Bloker. Cholestiramin dan liquid parafin. Pada pemakaian jangka panjang.Indonesia CELEBREX 100 CODE: C32 Harga Per Satuan Terkecil : Rp7. dapat mempengaruhi/mengurangi efek kedua obat ini. Kasus ringan dan anak lebih dari 14 th : 75-100 mg dibagi atas 2-3 kali sehari. Reg. DKL 9806707515B1 HARUS DENGAN RESEP DOKTER SIMPAN Dl TEMPAT SEJUK DAN KERING Dibuat oleh : P. ETHICA Jakarta . gangguan fungsi jantung dan ginjal. Bila diberikan bersama Neomycin.T. diclo-fenac akan mempertinggi konsentrasi obat-obat tersebut dalam plasma.Indonesia Untuk: P. Methotrexate. Cyclosporin atau Digoxin. akan berkurang absorbsinya.00 BELI Celebrex Selekoksib 100 mg. tukak lambung. sebaiknya dilakukan pemeriksaan fungsi hati dan darah secara periodik. TAKARAN PEMAKAIAN : Dewasa : 100-150 mg dibagi atas 2-3 kali sehari. DKL 9806707515A1 Dus 30 tablet CATANAC 50 mg (3 strip @ 10 tablet salut enterik) No. KEMASAN : Dus 30 tablet CATANAC 25 mg (3 strip @ 10 tablet salut enterik) No.Penderita dengan riwayat gangguan saluran cerna.

00 BELI CETALGIN-T KOMPOSISI : Na Metamizol 500 mg . intoksikasi sistem saraf periferal. Perihal : Dapat menyebakan intoksikasi saluran cerna. artritis reumatoid 2x sehari 100200 mg. Dosis : Osteoartritis:1x sehari 200 mg atau 2z sehari 100 mg. Kemasan : Dos 3x10 kapsul 100 mg. reaksi anafilaktik. pasien penderita asma. Kontra Indikasi : Hipersensivitas.Indikasi: penobatan ostoeartritis dan artritis rematoid. Cetalgin Harga Per Satuan Terkecil : Rp850. intoksikasi kardovaskuler. Efek samping : Intoksikasi saluran cerna.. urtikaria. jangan diberikan pada wanita hamil karena dapat menyebabkan kelahiran prematur.

EFEK SAMPING : Reaksi alergi. perdarahan lambung-usus. PERHATIAN : Hipersensitif terhadap Aspirin.00 BELI CETALMICT . sakit pinggang. rasa sakit/nyeri yang berkaitan dengan penyakit lainnya. Interaksi obat : Klorpromazin.100.Vitamin B1 Vitamin B6 Vitamin B12 Kafein INDIKASI : 60 mg 15 mg 15 mg 50mg Sakit kepala. KEMASAN : Kaplet 10 x 10 biji. 1-2 kali sehari &frac12-1 kaplet. KONTRA INDIKASI : Kelainan perdarahan. DOSIS • Dewasa • Anak berusia 8-12 tahun 3 kali sehari 1 kaplet. PENYAJIAN : Dikonsumsi bersamaan dengan makanan PABRIK: Soho Cetalmic 500 mg CODE: C19 Harga Per Satuan Terkecil : Rp1. agranulositosis. porfiria. neuralgia.

perdarahan lambung. penderita ginjal.kira 50% diekskresi dalam urine dan 20% ditemukan dalam faeces. hemolotik anemia. Sebagai analgesik. pusing. sakit gigi. anti inflamasi dan antipiretik. nyeri otot. Juga sebagai antipiretik pada keadaan demam. rhinitis alergi atau mendapat obat non steroid anti inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. Kira .KOMPOSISI : • CETALMIC® 250 kapsul Tiap kapsul mengandung asam mefenamat 250 mg • CETALMIC® 500 kaplet salut selaput Tiap kaplet mengandung asam mefenamat 500 mg FARMAKOLOGI : CETALMIC® mengandung asam mefenamat yang mempunyai khasiat analgesik. Keamanan pada anak-anak dibawah 14 tahun . nyeri trauma. KONTRA INDIKASI : Penderita tukak lambung/usus. Asam mefenamat cepat diabsorpsi. Jangan digunakan pada wanita hamil/menyusui. kadar puncak tercapai setelah 2 jam. penderita asma. PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. nyeri setelah operasi dan melahirkan. EFEK SAMPING : Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. Asam mefenamat terikat sangat kuat pada protein plasma. diare. agranulasitosis. asam mefenamat merupakan satu-satunya derivat fenamat yang memiliki daya kerja baik central maupun perifer. muntah. INDIKASI : Untuk menghilangkan berbagai rasa sakit dan nyeri dari ringan sampai sedang termasuk sakit kepala. penderita yang hipersensitif. waktu paruh dalam plasma adalah 3-4 jam. nyeri haid.

Sebaiknya diberikan pada waktu makan. CYBUFEN is also contraindicated in patients with active peptic ulcer.belum diketahui dengan pasti. Danalgin CODE: C20 Harga Per Satuan Terkecil : Rp1. TAKARAN PEMAKAIAN : Dewasa dan anak di atas 14 tahun : Dosis awal 500 mg. Due to the possibility of cross sensitivity. KEMASAN : • CETALMIC® 250 mg kapsul Box. dilanjutkan 250 mg tiap 6 jam. 10 strip @ 10 kapsul DKL9224209401A1 • CETALMIC8 500 mg kaplet salut selaput Box.350. urticaria. 10 strip @ 10 kaplet salut selaput DKL 9224209509A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH SUHU 30°C TERLINDUNG DARI CAHAYA PT SOHO INDUSTRI PHARMASI JAKARTA-INDONESIA Cybufen 300mg Harga Per Satuan Terkecil : Rp5.050. CYBUFEN may also be used for other painful inflammatory conditions CONTRAINDICATIONS CYBUFEN should not be used in patients who have exhibited hypersensitivity during previous administration.00 BELI INDICATIONS CYBUFEN is indicated for acute and long-term use in the relief of signs and symptoms of osteoarthritis and rheumatoid arthritis. rhinitis. CYBUFEN should not be given to patients in whom aspirin or other nonsteroidal anti-inflammatory drugs have induced an asthmatic syndrome. Jangan digunakan lebih dari 7 hari kecuali atas petunjuk dokter. angioedema or exacerbation of nasal polyps.00 BELI Danalgin Metampiron Diazepam .

Metampiron bekerja sebagai analgetik. gangguan fungsi hati atau ginjal. usia lanjut dan penderita dengan gangguan hati yang berat.19 menit. Keadaan psikosis akut. Konsentrasi plasma puncak diazepam dicapai setelah 15 . sistem limbik dan korteks serebral. Indikasi : Untuk meringankan rasa sakit sedang sampai berat terutama nyeri kolik dan sakit setelah operasi dimana dipehukan kombinasi dengan tranquillizer. Waktu paruh diazepam dan desmetil diazepam biasanya meningkat pada neonatus. Glaukoma sudut sempit. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada . Depresi pernapasan. Peringatan dan perhatian : Jangan mengemudikan kendaraan atau menjalankan mesin selama minum obat ini.Komposisi : Tiap kaplet mengandung : Metampiron 500 mg Diazepam 2 mg Farmakologi : DANALGIN bekerja sebagai anatgetik dan tranquillizer. Kontra indikasi : Penderita hipersensitif. Diazepam dimetabolisme terutama di hati dan terikat pada reseptor di daerah spinal cort. maka sebaiknya tidak digunakan dalam jangka panjang terus menerus. sindroma bahu-lengan. diabsorpsi dari saluran pencernaan dan mempunyai waktu paruh 1 . Bayi dibawah 6 buian. bursitis. serebelum. Karena dapat menimbulkan agranulositosis yang berakibat fatal. Gangguan pulmoner akut. lumbago. Penderita dengan tekanan darah sistolik < 100 mmHg. Waktu paruh bervariasi antara 20-70 jam. Wanita hamil dan menyusui. tetapi metabolit aktif yang dominan yaitu desmetil diazepam mempunyai waktu paruh 30 -100 jam.4 jam. Mempunyai aktivitas sebagai ansiolitik dan hipnotik. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/ kelainan darah. Ttdak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. sakit punggung.

perubahan libido. Reg. HARUS DENGAN RESEP DOKTER DANKOS PT DANKOS FARMA. : DPL8804405304A1 Kotak berisi 50 strip x 10 kaplet. maksimum 4 kaplet sehari. Hati-hati penggunaan pada penderita depresi berat atau yang mempunyai kecen-derungan melakukan bunuh diri. : DPL8804405304A1 Botol berisi 75 kaplet. jaundice. Dosis : Jika sakit 1 kaplet. dipiopia. Reg. ansietas. No. halusinasi dan gangguan tidur. JAKARTA-INDONESIA Datan forte CODE: C21 Harga Per Satuan Terkecil : Rp1. keleiahan. retensi urin. Kemasan: Kotak berisi 10 strip x 10 kaplet. Reg. Mengantuk. Interaksi obat: Penggunaan bersama obat-obat depresan SSP atau alkoho! dapat meningkatkan efek depresan. depresi. ataksia.- penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. Agranulositosis. hipotensi. Efek samping : Reaksi hipersensitivitas : reaksi pada kulit misal kemerahan. No. : DPL8804405304A1 Kaleng berisi 500 kaplet. berikutnya 1 kaplet tiap 6-8 jam. vertigo. No. Reg.00 BELI DATAN®KapIet ASAM MEFENAMAT . No. Hentikan pengobatan jika terjadi reaksi-reaksi paradoksikal seperti keadaankeadaan hipereksitasi akut. mual. 30°C). : DPL8804405304A1 Simpan pada suhu kamar (maks.250. tremor. Obat ini dapat menyebabkan kelemahan otot dan ketergantungan secara fisik dan psikologis. konstipasi.

Keamanan pada anak di bawah usia 14 tahun belum terbukti.Efek samping adalah minimal pada dosis yang dianjurkan.diare. DOSIS : .Diare dapat terjadi pada penggunaan jangka panjang yang terus menerus dengan dosis 2. keseleo. .kolik usus. Kontraindikasi : Penderita tukak lambung dan usus. Farmakologi : DATAN dengan zat aktif Asam Mefenamat. liipersensitif. .000 mg atau lebih perhari dan merupakan indikasi untuk menghentikan pengobatan. renal disease.Komposisi : Tiap kaplet DATAN mengandung 250 mg Asam Mefenamat. EFEK SAMPING : Pada beberapa orang dapat menyebabkan iritasi lambung. Sekitar 50 % dari dosis yang diberikan akan diekskresikan melalui urine dalam bentuk inetabolit terkonyugasi dalam waktu 48 jam. sakit kepala dan sakit gigi.seperti : nyeri karena trauma. nyeri sewaktu haid. mempunyai daya kerja sebagai analgetik yang kuat dengan disertai efek anti inflamasi dan antipiretik. nyeri sehabis operasi dan melaliirkan.nyeri otot. Indikasi : Menghilangkan segala macam rasa nyeri baik akut maupun kronis. nyeri sendi. DATAN dapat diabsorbsi dengan baik oleh saluran pencernaan. .Iritasi lambung jarang terjadi dan dapat dikiirangi dengan menelannya bersama makanan.Keamanan penggunaan DATAN pada wanita hamil belum diketahui. Kadar maksimal dalam darah akan tercapai dalam waktu 2 jam setelah pemberian. Tiap kaplet DATAN forte mengandung 500 mg Asam Mefenamat.mual dan sakit kepala. Peringatan dan perhatian : . .

Kemasan : Kaplet DATAN : Dus berisi 10 strip @ 10 kaplet.... No. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase . Reg..Dewasa: Dosis awal yang dianjurkan adalah 500 mg..00 BELI DENTACID™ Komposisi Tiap kaplet mengandung Asam mefenamat .. Cianjur-lndonesia Dentacid 500 Harga Per Satuan Terkecil : Rp1.100. 500 mg Cara kerja obat Asam mefenamat merupakan kelompok antiinflamasi non steroid.kemudian dilanjutkan dengan 250 500 mg setiap 6 jam. DKL8921004104B1 Penyimpanan: Simpanlah di tempat yang sejuk (15-25 * C) dan kering. DKL8921004I04A1... Reg. HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT PYRIDAM FARMATbk. Kaplet DATAN forte: Dus berisi 10 strip @ 10 kaplet..... No.

sakit gigi. Sistem saraf: rasa mengantuk. Efek samping Sistem pencernaan: mual. diare dan rasa sakit pada abdominal. . . muntah. . eosinophilia. Peringatan dan perhatian . Dosis Dewasa dan anak-anak ± 14 tahun: Dosis awal 50 mg. nyeri ototdan nyeri sesudah operasi.Sebaiknya diminum sesudah makan.Pasien yang hipersensitif terhadap asam mefenamat. Indikasi Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala. . antiinflamasi dan antipiretik.Hati-hati jika digunakan pada wanita hamil dan menyusui.anak dibawah 14 tahun belum diketahui dengan . trombocytopenia dan agranulocytopenia.sehingga mempunyai efek analgesik. penglihatan kabur dan insomnia.Penderita dengan gangguan ginjal yang berat.Penderita yang dengan asetosal mengalami bronkospasme. .Keamanan penggunaan pada anak . kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. Sistem hematopoetik: leukopenia. Kontraindikasi . dismenore primer. pusing.Penderita dengan tukak lambung dan usus. alergi rhinitis dan urtikaria. termasuk nyeri karena trauma.

pasti. No.: DKL0704426004A1 Diproduksi oleh: PT. Lindungi dari cahaya. Reg. Kemasan Dus isi 10 strip x 10 kaplet HARUS DENGAN RESEP DOKTER. Interaksi obat Penggunaan bersamaan dengan antikoagulan oral dapat memperpanjang "prothrombin". HEXPHARM JAYA Cipanas . Penyimpanan Simpan pada suhu kamar (di bawah 30°C).Indonesia . Overdosis Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbo absorben) untuk menyerap obat.

termasuk bentuk juvenil. dimana diklofenak diabsorpsi dengan oepat. Obat ini 99. Sebagai tablet salut enterik. Indikasi : 1. dan penyakit pirai akut. 2. 3. salah urat. Penyakit reumatik inflamatoar dan degeneratif: artritis reumatoid. DIVOLTAR" hancur dan melarut langsung dalam usus halus. tendinitis. DIVOLTAR® merupakan penghambat prostaglandin sintetase. . Menghilangkan/mengurangi rasa nyeri dan inflamasi nonreumatik. Bekasi .4 jam. ankilosing spondilitis. DANKOS FARMA Jakarta . Kelainan muskulo-skeletal akut: periatritis. Diklofenak mengalami metabolisme lintasan pertama dalam hati. Seperti obat-obat antiinflamasi nonsteroid lainnya. osteoartritis. Obat ini mempunyai sifat antiinflamasi. dan dislokasi.500. bursitis.Indonesia Dipasarkan oleh: PT KALBE FARMA Tbk. tenosinovitis. analgesik dan antipiretik yang kuat. Diklofenakdimetabolisme hampir sempurna dalam hati: ekskresi obat yang utuh melalui ginjal kurang dari 1%. Dengan demikian.00 BELI DIVOLTAR® Diklofenak natrium tablet salut enterik Komposisi : Tiap tablet salut enterik mengandung : Diklofenak natrium 25 mg atau 50 mg Farmakologi : DIVOLTAR® adalah obat antiinflamasi nonsteroid dengan struktur kimia yang baru (suatu derivat asam asetat).Indonesia Divoltar 50mg CODE: C22 Harga Per Satuan Terkecil : Rp1.7% terikat pada protein plasma dan waktu paruh eliminasinya 1 . Kadar puncak dalam plasma dicapai setelah 1 .2 jam. iritasi lambung dikurangi.Untuk: PT.

. Reaksi kulir.3 dosis. trombositopenia. DIVOLTAR® harus dihentikan. Reg. penderita usia lanjut (lebih mudah mengalami efek samping obat-obat antiinflamasi nonsteroid). Gunakan dengan hati . Hipersensitivitas terhadap diklofenak. 4. No. 2. dan anemia aplastik dapat juga terjadi. fungsi ginjal.3 dosis. Untuk terapi jangka panjang. Penderita yang mendapat pengobatan jangka panjang dengan DIVOLTAR®. Efek samping: Pada awal pengobatan.Kontra indikasi : 1. gagal ginjal dan sindroma nefrotik juga terjadi. 3. jantung atau ginjal yang parah. Peringatan dan perhatian : 1. 3. DIVOLTAR® tidak boleh diberikan selama kehamilan kecuali bila mutlak diperlukan. ikterus. hati dan hitung darah). hepatitis. retensi cairan dan peningkatan serum transaminase kadang-kadang terjadi. dosis biasanya 75 -100 mg sehari. Leukopenia. DIVOLTAR® dapat meningkatkan kadar plasma lithium atau digoksin. urtikaria. Dosis dan cara pemberian Dewasa : Dosis awal 75 -150 mg sehari. No. seperti halnya dengan obat-obat antiiflamasi nonsteroid lainnya. DKL8811606917A1 Dos isi 5 strip x 10 tablet salut enterik. sendawa. Userasi dan perdarahan saluran cerna. penderita dengan insufisiensi hati.3 mg/kg sehari. tetapi sangat jarang. dibagi dalam 2 . DKL8811606917B1 PT KALBE FARMA Tbk. Efek samping ini biasanya ringan.hati pada: penderita dengan gangguan saluran cerna atau dengan riwayat ulkus peptikum. Anak 1 tahun atau lebih :1 . Penderita asma yang mengalami serangan asma. 2. Kemasan : Tablet 25 mg : Tablet 50 mg : Dosisi 5 strip x 10 tablet salut enterik. nyeri kepala atau pusing. atau rinitis akut bila mendapat asetosal atau obat-obat antiinflamasi nonsteroid lainnya. dapat terjadi nyeri epigastrium. Ulkus peptikum atau perdarahan saluran cerna. Bila ini terjadi. Reg. nausea dan diare. Tablet harus ditelan seluruhnya sewaktu makan atau setelah makan. dibagi dalam 2 . harus dimonitor sebagai tindakan berjaga-jaga (mis.

2 gram sehari.6 .00 BELI DOFEN® 200 DOFEN® FORTE Tablet salut selaput DOFEN adalah tablet bersalut selaput (film coat) yang mempunyai khasiat sebagai analgetika-antipiretika dan antiinflamasi. Kontra indikasi: Jangan diberikan kepada penderita yang hipersensitif terhadap ibuprofen atau penderita dengan sindroma polip hidung.2. Dofen Forte 400mg CODE: 121 Harga Per Satuan Terkecil : Rp400. osteoartritis dan gout artritis. Untuk anak yang bobot badannya kurang dari 30 kg. Atau menurut petunjuk dokter. HARUS DENGAN RESEP DOKTER.Indonesia Lindungi dari cahaya.Bekasi . angiodema. Simpan pada suhu kamar (di bawah 30°C). 20 mg/kg bobot badan sehari. dibagi dalam beberapa dosis.1. serta reaktivitas bronkospastik terhadap asam asetilsalisilat atau antiinflamasi non steroid lainnya. sakit kepala atau vertigo. Dosis : Dewasa : Anak-anak : 200 mg 400 mg 0.9 . Komposisi: DOFEN® 200 Tiap tablet salut selaput mengandung: Ibuprofen DOFEN® FORTE Tiap tablet salut selaput mengandung: Ibuprofen Indikasi: Reumatik artritis. .4 gram sehari. Efek samping: Efek samping yang biasa timbul adalah gangguan saluran cerna. dibagi dalam beberapa dosis. Rasa nyeri ringan sampai sedang dan rasa nyeri pada waktu haid. maksimum diberikan sebanyak 500 mg sehari. Dosis penunjang 0.

Pada penderita dengan riwayat penyakit saluran cerna bagian atas perlu dilakukan pengawasan yang ketat. . BAMBANG UTOYO 138 PALEMBANG-INDONESIA Dogmatil CODE: C23 Harga Per Satuan Terkecil : Rp3.650. Dibuat oleh: DEXAMEDICA JL. 10 strip @ 10 tablet. DKL8505001617A1 DOFEN FORTE: Kotak. TERLINDUNG DARI CAHAYA.00 BELI DOGMATIL SULPIRIDE 3 bidang pengobatan utama : ITUKAK SALURAN PENCERNAAN PSIKIATRI VERTIGO ■ Tukak saluran pencernaan Pengobatan pada waktu serangan : 2 . pruritus. SIMPAN PADA SUHU DI BAWAH 30°C. gangguan fungsi ginjal tetapi ini jarang terjadi.3 ampul/hari selama 1 . 10 strip @ 10 tablet. DKL8505001617B1 HARUS DENGAN RESEP DOKTER. Peringatan dan perhatian: Hati-hati bila digunakan pada penderita dengan riwayat dekompensasi jantung atau hipertensi. Pada dosis yang berlebihan dapat terjadi gejala saluran cerna dan gejala susunan saraf pusat. Terapi penunjang : 3 kapsul @ 50 mg/hari selama 3 minggu. Tidak boleh digunakan pada penderita yang diketahui hipersensitif terhadap aspirin atau antiinflamasi non steroid lainnya Hati-hati bila digunakan pada penderita dengan kelainan faktor intrinsik untuk pembekuan darah. Kemasan dan Nomor Registrasi: DOFEN 200 : Kotak.Juga dapat menimbulkan ruam kulit.2 minggu. Hati-hati bila digunakan pada penderita dengan gangguan fungsi ginial dan perlu dilakukan monitor yang ketat.

dibagi dalam beberapa dosis. • Keadaan depresi yang reaktif. halusinasi. • Psikosa pada masa anak-anak. D 6015158 . (waham) kronis. ■ Vertigo karena berbagai sebab 3. remaja Anak-anak : 10 mg/kg b.4 tablet @ 200 mg/hari. • Kelainan tingkah laku yang berat. No. dibagi dalam beberapa dosis. • Depresi karena berbagai sebab. • Neurosa dengan harnbatan psikomotor. kebingungan. Reg. Anak-anak : 5 -10 mg/kg b. delusi./hari. KEMASAN: Tablet dalam strip berisi 20 @ 200 mg (khusus pemakaian psikiatri) No. D 7811131 -Ampul 6 @ 100 mg/2 ml No. TOLERANSI : Pada terapi jangka panjang atau pada pengobatan ulangan tidak menimbulkan adiksi. • Kelainan psikofungsionil • Kelainan tingkah laku yang ringan.b.Terapi lanjutan : 1 . Tanpa kontraindikasi maupun incompatibility. dibagi daTam beberapa dosis. D 6015425 -Kapsul dalam strip berisi 20 dan 100 @ 50 mg./hari. Terapi penunjang per oral: • Skizofrenia akut. dan keadaan pra-psikosa. keadaan delusi 2 .6 kapsul/hari. Dewasa : 2 .3 kapsul/hari selama 3 .4 minggu.b. Reg. ■ Kelainan psikiatri utama Pengobatan pada waktu serangan : • Psikosa akut dengan gejala-gejala 3 . Reg. EFEK SAMPING : Kadang-kadang dapat menyebabkan gangguan siklus menstmasi atau efek extra pyramidal ringan yang mudah hilang. • Sindroma post gegar-otak. dibagi dalam beberapa dosis.4 kapsul @ 50 mg/hari.6 ampul/hari. • Depresi pada geriatrik. Tidak mempengaruhi sistim neurovegetative. Kewaspadaan tetap terpelihara bahkan sering kali meninggi.

SESIF .FRANCE DELAGRANGE Dolana Kapsul CODE: C122 Harga Per Satuan Terkecil : Rp3.450. dengan sifatnya sebagai agonis partial pada reseptor opioid (reseptor U) yang berperan pada efek analgesik. untuk PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Dengan lisensi dari DELAGRANGE.00 BELI Dolana KOMPOSISI : Setiap Kapsul mengandung : Setiap Suppositoria mengandung : Setiap 1 mL Larutan injeksi DOLANA 50 mg mengandung : Setiap 2 mL Larutan injeksi DOLANA 100 mg mengandung : CARA KERJA OBAT : Tramadol HCl adalah analgesik yang bekerja sentral. KONTRA INDIKASI : Intoksikasi akut bila digunakan bersama dengan alkohol. preparat hipnotik. baik akut maupun kronik serta nyeri setelah operasi.JAKARTA. .PARIS . TERLINDUNG DARI CAHAYA Tablet dan Kapsul di produksi oleh : PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Injeksi diproduksi oleh : PT ETHICA.SIMPAN Dl BAWAH SUHU 30°C. memperkuat efek analgesik Tramadol HCl namun dengan efek samping opioid yang minimal. Disamping itu juga bekerja pada reseptor monoaminergik di susunan saraf pusat. noradrenaline pasca sinaptik dan memblok reseptor serotonergik. Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg INDIKASI : Untuk mengatasi nyeri berat. Dengan menghambat "reuptake".

DOLFENAL CODE: C33 Harga Per Satuan Terkecil : Rp1. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi tramadol dengan cepat. mulut kering dan lelah. Meskipun termasuk antagonis opiat.000. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. INTERAKSI OBAT : Dengan obat-obat yang bekerja pada susunan saraf pusat seperti Trankuilizer. Pada penderita dengan gangguan fungsi ginjal / hati perlu dilakukan penyesuaian dosis. mual. kemerahan.- analgesik atau obat-obat lain yang bekerja pada susunan saraf pusat. Penderita dengan depresi pernapasan terutama jika ada cyanosis dan sekresi bronkial yang berlebihan. PERINGATAN DAN PERHATIAN : Tramadol tidak boleh digunakan pada penderita ketergantungan obat. gangguan fungsi ginjal dan hati yang berat atau hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok (renjatan ) Dapat terjadi penurunan fungsi paru-paru apabila penggunaan tramadol dikombinasi dengan obat depresi SSP lainnya atau bila melebihi dosis yang dianjurkan. sakit kepala. Penderita yang mendapat pengobatan penghambat MAO. paru-paru kronik EFEK SAMPING Berkeringat.00 BELI Dolfenal . Penderita yang hipersensitif terhadap tramadol atau opiat. sedasi. Pertimbangkan manfaat dan resiko yang mungkin terjadi bila digunakan pada wanita hamil dan menyusui karena 0.1 % tramadol diekskresikan melalui ASI. tramadol tidak dapat menekan gejala "withdrawal" akibat pemberian morfin. Tramadol HCl tidak boleh diberikan pada pasien yang menerima MAO Inhibitors. peningkatan tekanao intrakranial. Hati-hati bila digunakan pada penderita trauma kepala. pusing. Dispepsia obstipasi. Hendaknya tidak diberikan selama serangan asma bronkial atau kegagalan jantung sekunder sampai penyakit. muntah. hipnotik maka efek sedasi/kelelahan kemungkinan meningkat. pruritus.

peradangan. Efek samping : Gangguan saluran cerna. asma.perdarahan saluran cerna.700. Indikasi : nyeri.sakit kepala. Dolika Kapsul CODE: C123 Harga Per Satuan Terkecil : Rp2.pusing. de3hidrasi.gangguan penglihaan. hipersensivitas.Asam mefenamat 500 mg. kerusakan hati dan ginjal.reaksi kulit.mengantuk. Kontra indikasi : Tukak/inflamasi saluran cerna.diskrasia darah. Dosis : 4x sehari : Kemasan : Dos 100 tablet. Perihal : tukak lambung. .00 BELI DOLIKA INJEKSI / KAPSUL KOMPOSISI Tiap ml Dolika 50 Injeksi mengandung : Tiap ml Dolika 100 Injeksi mengandung : Tiap kapsul mengandung : Tramadol HCI Tramadol HCI Tramadol HCI 25 mg 5 mg 50 mg Dewasa dan anak >14 tahun : kemudian 250 mg.nefropati.

biasanya diberikan dalam bentuk injeksi DOSIS PEMAKAIAN Dosis yang diberikan sebaiknya disesuaikan dengan intensitas nyeri Bila tidak ada petunjuk lain dari dokter. dapat ditambahkan injeksi 1 ml Dolika atau 1 kapsul Dolika setelah selang waktu 30 . dosis Dolika yang diberikan adalah sebagai berikut : Dosis untuk orang dewasa dan anak umur di atas 14 tahun : DOLIKA KAPSUL : Dosis tunggal : 1 kapsul Dosis harian : sampai 8 kapsul Dosis tersebut biasanya cukup untuk meredakan nyeri. INDIKASI Nyeri akut dan kronik berat. Dolika tidak boleh diberikan lebih lama daripada yang diperlukan. Dosis harian sebesar 400 mg/hari jangan dilampaui. kemungkinan terjadinya ketergantungan tidak dapat disingkirkan. perlu dilakukan penyesuaian dosis. Apabila masih terasa nyeri. atau bila pengobatan perlu dihentikan sementara.60 menit. Pada penderita dengan gangguan fungsi ginjal atau hati. Karenanya dokter harus menetapkan lamanya pengobatan. Nyeri akibat tindakan diagnostik. Lama pengobatan : Pada pengobatan Dolika jangka panjang.CARA KERJA OBAT Tramadol HCI merupakan Non-Opioid Analgetika yang bekerja pada reseptor opioid. Nyeri pasca operasi. EFEK SAMPING .

lelah. obstipasi. hipnotika) dapat meningkatkan efek sedasinya. muntah. Sebaliknya penggunaan tramadol bersama dengan tranquiliser juga dapat meningkatkan efek analgesiknya. efek samping berikut dapat terjadi pada pengobatan Dolika : mual. berkeringat. dispepsia. Dolo fenac CODE: C24 Harga Per Satuan Terkecil : Rp3. hipnotika. Meskipun tramadol berinteraksi dengan reseptor opiat.100. sampai sekarang terbukti insidens ketergantungan setelah penggunaan Dolika jarang dijumpai. CARA PENYIMPANAN Jauhkan dari jangkauan anak-anak. analgesik atau obat-obat yang mempengaruhi SSP lainnya. Penderita yang hipersensitif terhadap tramadol atau opiat.- Sama seperti analgesik sentral lainnya. INTERAKSI OBAT Penggunaan injeksi Dolika bersama dengan obat-obat yang bekerja pada SSP (seperti tranquiliser.00 BELI DOLO FENAC iniamme Monomtrate + Lyanocobalamin Vitamin Neurotropik + NSAID Komposisi : Setiap tablet salut enterik mengandung: . KONTRA INDIKASI Intoksikasi akut dengan alkohol. terhindar dari cahaya. sedasi. Penderita yang mendapat pengobatan penghambat MAO. pusing. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi Tramadol dengan cepat. Simpan di tempat kering dan sejuk. mulut kering dan sakit kepala. pruritus. kulit kemerahan.

anti inflamasi analgesik. Pyridoxol HCI di dalam tubuh diubah menjadi pyridoxol fosfat. Dosis dan Pemberian Tiga tablet per hari. edema. Indikasi : Meringankan rasa sakitsedangsampai beratyangdisertai neuritisdan/atau neuralgia. Vitamin B. Untun oengobatan inflamasi dan penyakit-penyakit rematik degeneratif.Penderita dengan luka atau pendarahan pada saluran cerna.pada pasien dengan dehidrasi. Pasien dapat diobati dalam waktu lama iika diperiukan sesuai anjurandokter. mempunyai efek sebagai anti rematik. Perhatian : Diclofenac dapat menyebabkan retensi cairan. berfungsi terutama dalam metabolisme protein dan asam amino. efektivitas dan banannya belum diketahui. dan gangguan koagulasi pada pasien dengan penyakit kardiovaskular atau hipertensi. Obat ini harus diberikan dengan hati-hati pada pasien dengan gangguan ginjal. yang merupakan koenzim reaksi karboksilasi dan transaminasi. hati dan jantung penderita usia lanjut. akan meningkatkan resiko toksisitas ginjal.s diperiukan dalam sintesis asam nukleat dan mielin. dalam tubuh dikonversi menjadi bentuk aktifnya thiamin pirofosfat yang merupakan koenzim pada reaksi dekarboksilasi asam aketo. Pada anak. Thiamin penting untuk metabolisme karbohidrat. Efek anti inflamasi serta efek farmakologis lainnya berhubungan dengan efek penghambatan sintesa prostaglandin. Perhatian atau larangan penggunaan selama hamil dan menyusui : . lebih baik setelah makan.OiclofenacSodium Pyridoxol HCI Thiamine Mononitrate Vitamin B12 Mekanisme Kerja : 50 mg 50 mg 50 mg 1 mg Diclofenac merupaKan obat anti inflamasi non steroid. dengan demikian mempengaruhi pematangan sel dan memelihara keutuhan jaringan syaraf. pemberian Diclofenac bersama NSAID lainnya tidak direkomendasikan.

lesi esophagus.Obat tidak boleh digunakan selama kehamilan dan menyusui. Erupsi kulit dan reaksi hipersensitifitas lain yang diketahui disebabkan oleh formulas! ini. mual. alopecia. Polycythemia vera.Tfitasi psikotik. muntah. mutagenik dan teratogenik dan efek pada fertilitas: Tidak ada bukti efek karsinogenik. hati dan ginjal harus diteliti terlebih dahulu. retensi urin. konstipasi. Kulit (kasus tersendiri) : vesicular eruptions.pusing. kondisi sistim pencernaan.jarang terjadi : gastroduodenal hemoragik (perdarahan gastro-duodenal). erythema multiforme. disorienteasi.gangguan sensoris dan visuat. dispepsia. Ginjal (kasusjarang): hematuria. .sakit kepala. hematemesis ulkus perforasi. Sistem pencernaan : sakit perut. Pada penghentian pyridoxol. anoreksia. glositis. reaksi fotosensitif.TJhnifus. Efek samping : Ada laporan tersendiri mengenai reaksi pada pemberian parenteral thiamin dan vitamin B12 untuk jangka panjang. proteinuria. insomma. diare berdarah. purpura. meskipun studi histopatologik tidak menunjukkan adanya hubungan smdroma tersebut dengan semua tingkatan degenerasi neuronal. Pemberian pyridoxol dosis tinggi dapat menyebabkan smdroma neuropati sensoris tertentu. Perhatian dan kemungkinan efek karsinogenik. flatulence. Sebelum meresepkan obat ini.Kadang-kadang terjadi: colitis ulserativa atau Crohn's procto'colitis' gingivostomatitis. Sistem saraf pusat : dizziness. eczema. diare. gangguan rasa.kelelahan. ada perbaikan bertahap pada disfungsi neuronal dan pemulihan secara menyeluruh pada pasien-pasienini. hal ini dihubungkan dengan hipersensitifas yang jarang terjadi.Kasus yang jarang:parestesia. perdarahan usus. gangguan ingatan. mutagenik dan teratogenik atau efek fertilitas pada studi manusia atau hewan. erythroderma (exfoliative dermatitis). sindroma Stevens-Johnson toxic epidermal necrolysis. insufisiensi renal akut.

Pyridoxol fosfat menyebabkan dekarboksilasi perifer levodopa sehingga menurunkan efikasi pada pengobatan penyakit Parkinson.hemolyticanemia. Vitamin B12 tidak boleh diberikan pada tingkat awal penyakit Leber (atrophl hereditari dari saraf optik). Pasien yang mengalami bronchial. dengan atau tanpa penyakit kuning. Penggunaan penicillamine yang diperpanjang dapat menyebabkan kekurangan vitamin B. urticaria atau rhinitis yang dipicu oleh asam asetilsalisilik atau derifatnya. . Polycythemia vera. Darah ( kasus tersendiri) : thrombocytopenia. Pengobatan dengan pyridoxol HCI 200 mg per hari selama satu bulan menurunkan sampai 50% konsentrasi serum phenobarbital dan phenytoin.. Cycloserine dan hydralazine adalah vitamin B. hepatitis. Pemberian carbidopa dengan levodopa secara bersamaan menghambat efek pyridoxol Pyridoxol HCI tidak boleh diberikan pada dosis lebih tinggi daripada 5 mg per hari pada pasien yang sedanq diobati dengan levodopa saja. meskipun signifikansinya tidakjelas. Jika pyridoxol diberikan bersama cyclosporine.agranulocytosis. kadar plasma ada kemungkinan menurun.aplastic anemia. edema. Qastroduodenal/peptic ulcer. Hipersensitifitas (kasus jarang) : arterial hypotension.Hati (kasus jarang) : peningkatan aktifitas aminotransferase (glutamic-pyruvic dan glutamic-oxaloacetic transaminases).s dan pemberian pyridoxine menurunkan efek samping neuronal dengan penggunaan obat-obat ini.leucopenia. antagon. Interaksi : Thiamin dilaporkan berpotensi terjadinya penghambatan neuromuscular. reaksi anafilaksis. Kontraindikasi : Hipersensitifitas terhadap obat ini.

primidone). Monitoring yang cukup direkomendasikan untuk kasus-kasus ml. asam aminosalisilik dan garamnya.Absorpsi vitamin B„ di sistim gastrointestinal dapatditurunkan dengan pemberian berikut ini aminoglikosida colchicme. Overdosisatau ingestion taksengaja:Gejala dan Penanganan (Antidot) Tidak ada kasus yang dilaporkan tentang overdosis dengan thiamin atau vitamin B. Neuropathy sensoris dan sindroma neuropati sensoris lainnya yang disebabkan pemberian pyridoxol megadoses akan sembuh dan pulih kembali dengan penghentian pengobatan. Diclofenac menurunkan aktivitas obat-obat diuretik. Pada kasus intoksikasi akut dengan diclofenac. dan supresi pernafasan. tetapi tidak pada pasien dengan gastrectomy parsial atau total Kepentingan klinis dan observas* ini tidak diketahui. Pengukuran pendukung harus dilakukan untuk mengobati hipotensi.. Pasien diobati dengan antikoagulan harus dimonitor dengan ketat Obat-obat antnnflamasi nonsteroid harus dihentikan 24 jam sebelum memulai pengobatan dengan metotreksat untuk mencegah peningkatan plasma cytostatic dan kejadian efektoksik. Pemberian neomycin dan colchicine secara simultan memperburuk absorbs! vitamin B secara oral. iritasi pada usus halus oleh kobalt. Asam askorbat dapat menghancurkan jumlah vitamin B12 secara signifikan dan faktor intrinsik dalam kondisi in vitro. Pemberian kloramfenikol dan vitamin B„ secara simultan dapat memperburuk responhemopoietic terhadap vitamin. Penggunaan antiinflamasi nonsteroid lain secara bersamaan dapat meningkatkan resikoefeksampingvangtidakdiinginkan. iritasi gastrointestinal. Tindakan berikut ini harus dilakukan: bilas lambung dan pemberian charcoal aktif.00 BELI DOLO MEGANEURON Kaplet Salut Selaput KOMPOSISI : . harus diperhatikan kemungkinan ini pada saat meresepkan dosis tinggi asam askorbat dengan vitamin B12. antikonvulsan (phenytoin' phenobarbital. Pemberian diclofenac dengan obat-obat lithium-based atau digoxin atau siklosporin atau metotreksat secara simultan dapat menyebabkan peningkatan plasma obat-obat ini. Kemasan : Boks lO blister® lO tablet salut enterik Dolo Meganeuron Harga Per Satuan Terkecil : Rp750. pengobatan pennnjang dan simptomatik harus dilakukan Tidak ada gambaran spesifik mengenai hal itu. dan oleh asupan aikohol yang berlebihan selama lebih dan 2 minggu. golongan potasium lepas lambat. insufisiensi qinial konvulsi. Prednisone dilaporkan meningkatkan absorpsi vitamin B12 dan sekresi faktor intrinsik pada beberapa pasien dengan anemia pernicious.

Tiap Kaplet Salul Selaput mengandung: Methampyrane TniamineHCI Pyridoxine HCl Cyanooobalamine 500 mg 50 mg 100 mg 100 mg FARMAKOLOGI : Methampyrone bekerja sebagai analgesia. gangguan fungsi hati atau ginjal. sindroma bahu-lengan. lumbago. Penderita dengan tekanan darah sistolik < 100 mmHg. Pyrldoxine HCl dan Cyanocobalamine dalam dosis besar dapat membantu memelihara fungsi sel-sel saraf. Hati-hati dengan penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lama untuk mengatasi rasa sakit akut. Diabsorpsl dan saluran pencemaan. PERINGATAN DAN PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. sakit punggung. Bayi dibawah 6 bulan. Thiamine HCl. . terutama pada keadaan sakit yang berat. Wanita hamil dan menyusui. Karena dapat menimbulkarragranulositosis yang berakibat fatal. bursitis. KONTRA INDIKASI : Penderita hipersensitif. maka sebaiknya tidak digunakan dalam jangka waktu terus menerus. mempunyai waktu paruh 1 -4 jam. INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia.

: DKL 9815706509 A1 SIMPAN DITEMPAT YANG SEJUK DAN KERING HARUS DENGAN RESEP DOKTER Produksi: PT. .INDONESIA R.Reg.900.1 Dolocap Harga Per Satuan Terkecil : Rp1. 10 strip @ 10 kaplet salut selaput No.032.00 BELI DOLOCAP capsul KOMPOSISI : Tiap kapsul mengandung: Tramadol HCI 50 mg FARMAKOLOGI : Tramadol HCI merupakan suatu analgetik opioid.EFEK SAMPING : Reaksi hipersensitifitas: reaksi pada kulit misal kemerahan. Agranulositosis. DOSIS : 1 Kaplet salut selaput 3 kali sehari KEMASAN : Dus. EMBA MEGAFARMA SEMARANG .

sembelit. DOSIS : Dosis yang diberikan disesuaikan dengan intensitas nyeri lazimnya : • 1 kapsul sehari (maksimum 8 kapsul per hari). berkeringat. hipnotika. kejang dan depressi pernapasan. kolaps kardiovaskular.INDIKASI : • • Digunakan untuk: Nyeri akut dan kronik yang berat. hypotermia. apabila masih terasa nyeri dapat ditambahkan 1 kapsul setelah selang 30 . Mulut kering. palpitasi. dispepsia. Intoksikasi akut dengan alkohol. KONTRA INDIKASI: • • • • Penderita yang hipersensitif terhadap Tramadol atau opiat. seperti pada golongan analgesik opiat (analgesik sentral) dapat terjadi: mual. vertigo.60 menit. drowsiness. kulit kemerahan. hypotension. OVER DOSIS : • • Pada pemberian over dosis dapat terjadi miosis. kelelahan dan miosis. mungkin juga dapat terjadi spasme uterik atau biliary. Dosis tersebut di atas biasanya cukup untuk meredakan nyeri. atau obat-obat analgetik opiat atau obat-obatyang mempengaruhi SSP lainnya. Penderita yang mendapat pengobatan MAO inhibitor. EFEK SAMPING : • • • • Pada dosis normal. sodasi. confusion. koma. Pada dosis lebih besar dapat menyebabkan depressi pernapasan dan hipotensi dengan kegagalan sirkulasi dan koma. . Pada anak-anak dan bayi dapat terjadi kejang-kejang. terutama dengan adanya cyanosis. muntah. Nyeri pasca bedah. muntah. Penderita dengan depressi pernapasan. Untuk mengatasi depressi pernapasan dan syok dengan Naloxone HCI. brandikardia orthostatic.

dapat menyebabkan ketergantungan. Meskipun termasuk antagonis opiat. HARUS DENGAN RESEP DOKTER. Dapat terjadi penurunan fungsi paru bila Tramadol digunakan bersama dengan obat-obat penekan SSP lainnya atau bila penggunaan melebihi dosis yang dianjurkan. Keracunan akut lewat mulut dapat diatasi dengan pengosongan lambung. Pemberian pada wanita hamil harus dipertimbangkan manfaat dan resiko yang mungkin terjadi. KEMASAN : Dos berisi 5 blister® 10 kapsul PENYIMPANAN : Simpanlah di tempat yang sejuk. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. tranquillizer. Pada pengobatan jangka panjang. gangguan fungsi ginjal dan hati yang berat. . Hati-hati bila digunakan pada penderita trauma kepala. PERHATIAN : • • • • • • • • Tramadol tidak boleh digunakan pada penderita ketergantungan obat. Hati -hati pemberian pada ibu menyusui karena 0. peningkatan tekanan intra kranial.1% Tramadol diekskresikan melalui ASI. • Sebaliknya penggunaan Tramadol bersama dengan tranquillizer juga dapat meningkatkan efekanalgesiknya. kering dan terlindung dari cahaya. sedangkan kejang dapat ditekan dengan pemberian Benzodiazepin. Oleh karena itu dokter harus menentukan dengan jelas lama pengobatan. Tramadol tidak dapat menekan gejala "witdrawal" akibat pemberian morfin.• Nalorphine HBr. obat-obat hipnotika. hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok. antidepressan trisiklik dan anestetika. INTERAKSI OBAT : • Efek depressi / sedasi diperkuat dengan adanya obat-obat yang bekerja pada SSP seperti : alkohol. Levallorphan tartrat. Tidak boleh diberikan lebih lama dari petunjuk dokter.

yang mempunyai daya antipiretik dan anatgesik dengan potensi yang sama dengan aspirin dan dengan sedikit daya anti inflamasi. nyeri rematik. nyeri pasca bedah dan persalinan. Dibandingkan dengan aspirin. terutama dalam bentuk metabolitnya. FARMAKOLOGI : DOLODON berisi Asam Mefenamat yang merupakan derivat asam antrani-lat. Dalam waktu 48 jam. ± 50 % dari dosis yang diberikan ditemukan kembaii dalam urine. Asam Mefenamat diserap dari traktus gastro intestinal dan kadar dalam sirkulasi mencapai puncaknya dalam waktu 2 jam setelah pemberian obat.Dolodon CODE: C25 Harga Per Satuan Terkecil : Rp250. sakit gigi. INDIKASI : Untuk menghilangkan rasa nyeri pada sakit kepaia. yaitu analog amin asam salisilat. DOLODON Suspensi dengan rasa pisang yang enak dan manis disiapkan untuk anakanak dan penderita yang mengalami kesulitan menelan kapsul atau captab. KONTRA INDIKASI : Penderita tukak lambung . Asam Mefenamat ku-rang menyebabkan terjadinya pendarahan gastrointestinal. demam pada anak-anak dan dewasa.00 BELI DOLODON kapsul * captab * suspensi capsule * captab * suspension KOMPOS1SI : DOLODON 250 Kapsul : DOLODON 500 Captab : DOLODON Suspensi : Tiap kapsul berisi 250 mg Asam Mefenamat Tiap captab mengandung 500 mg Asam Mefenamat Tiap sendok takar (5ml) suspensi mengandung 50 mg Asam Mefenamat. nyeri waktu haid.

Botol plastik isi 500 kapsul Reg. SEDIAAN dan KEMASAN : * DOLODON 250 Kapsul : * DOLODON 500 Captab : * DOLODON Suspensi : Dus berisi 10 strip x 10 kapsul Reg. DKL 8714504033 A1 HARUS DENGAN RESEP DOKTER .PERINGATAN & PERHATIAN : * * * * * Dapat mengurangi jumiah trombosit. No. Pemberian harap dihentikan setelah 7 hari tidak memberikan hasil. No. Atau menurut petunjuk dokter. D 7812379-1 Dus berisi 10 strip x 10 captab Reg. DOSIS : Dewasa : Anak-anak : Mula-mula 500 mg. paling lama 7 hari. kemudian 250 mg setiap 6 jam 6. PENYIMPANAN : Simpan pada suhu dibawah 30°C. Sebaiknya tidak diberikan pada wanita hamil dan wanita menyusui. terutama bila digunakan bersama-an antikoagulan koumarin. No.5 mg Asam Mefenamat per kilogram berat badan. DKL 8714504104 A1 Botoi isi 60 ml netto Reg. Hati-hati pada penderita asma karena akan memperburuk keadaan. dosis koumarin hams dikurangi. D 7812379 . No. EFEK SAMPING : * * Dapat menyebabkan iritasi tractus gastro intestinal Skin rash dan diare dapat terjadi dan akan hiiang jika pengobatan dihentikan. Hati-hati pada penderita gangguan fungsi hati dan ginjal. 3 kali se-hari dengan interval 6 sampai 8 jam.

00 BELI DOLOFEN – F Ibu profen 400 mg. KEMASAN : ( HNA + ) Dos 10 x 10 kapsul Duplopyrin Strip CODE: C111 Harga Per Satuan Terkecil : Rp2.Produksi : PT MECOSIN INDONESIA JAKARTA Dolofen-F CODE: C26 Harga Per Satuan Terkecil : Rp500. INDIKASI : Menghilangkan rasa nyeri dan gejala arthritis reumetoid dan osteoarthritis.00 BELI Duplopyrin KOMPOSISI : Tiap tablet DUPLOPYRIN mengandung : Fenilbutazon 125 mg Etoksibensamid 125 mg Aluminium Hidroksida Gel kering 100 mg Magnesium Trisilikat 5H2O 150 mg . DOSIS : 3 x sehari 1 kaplet / kapsul .500.

pada suhu kamar (25-30°C) dan terlindung dan bahaya KEMASAN : Kaleng plastik isi 1000 tablet . : D. ginjal dan hati. No. juga pada penyakit tiroid dapat terjadi penahanan fungsi sumsum tulang. No. CARA PENYIMPANAN : Simpan di tempat kering. ATURAN PAKAI : Dewasa : 1 tablet 3 kali sehari. Atau menurut petunjuk Anak-anak : dokter. hati atau kardiovaskuler. Reg. hipersensitivitas serta gangguan fungsi jantung. tukak lambung. KONTRA INDIKASI Hipertensi. Reg.INDIKASI Penyakit Rheumatik termasuk rheumatoid arthritis. Dapat menghambat absorpsi tetrasiklin dan vitamin-vitamin serta memperlambat absorpsi quinidin. gangguan fungsi ginjal. PERINGATAN & PERHATIAN : Hati-hati penggunaan pada penderita ulkus peptikum. ankylosing spondylitis. Disesuaikan dengan usia dan berat badan. gouty arthritis. 2815773 Dus isi 24 blister @10 tablet . INTERAKSI OBAT : Dapat meningkatkan etek tolbutamide dan kumarin. 2815773-1 . osteo arthritis. Magnesium Trisilikat dalam bentuk garam magnesium mudah diserap dan bila terjadi gangguan fungsi ginjal dapat menyebabkan keracunan magnesium. Harus berhati-hati pemberiannya pada penderita dengan gastritis. : D.

... . hidung atau tenggorokan. analgesik dan antipiretik. Seperti obat-obat AINS yang lain mekanisme kerja belum diketahui........ seperti terkilir.250...25 mg/ 50 mg FARMAKOLOGI EFILAGEN mengandung Kalium Diklofenak yaitu suatu anti-inflamasi nonsteroidal CAINS. akan tetapi penghambatannya terhadap sintesa prostaglandin (siklo-oksigenase) dapat dikaitkan dengan aktivitas anti-inflamasi. Coronet Crown PHARMACEUTICAL INDUSTRIES SURABAYA ........ * nyeri dan inflamasi setelah operasi....INDONESIA Eflagen 25 CODE: C112 Harga Per Satuan Terkecil : Rp1... Secara farmakologi Diklofenak menunjukkan aktivitas anti-inflamasi. seperti operasi gigi dan tulang.HARUS DENGAN RESEP DOKTER PT....00 BELI EFLAGEN Tiap tablet mengandung : Kalium Diklofenak.. - KONTRA-INDIKASI Hipersensitivitas terhadap Kalium Diklofenak.. * nyeri Inflamasi setelah trauma...... INDIKASI EFLAGEN diindikasikan : Sebagai pengobatan jangka pendek untuk kondisi akut sebagai berikut: Sebagai adjuvant pada nyeri Inflamasi berat dari Infeksi telinga.

Pemberian bersamaan dengan antikoagulan perinah dilaporkan dapat meningkatkan resiko perdarahan. nyeri dada. INTERAKSI OBAT Pemberian bersamaan dengan litium atau digoksin dapat meningkatkan konsentrasi litium atau digosin dalam plasma. Reg. Pemberian bersamaan dengan metotreksat dapat meningkatkan toksisitas metotreksat. penderita dalam serangan asma. eritema multiformis. palpitasi. anemia. Pemberian bersamaan dengan AINS sistemik dapat meningkatkan terjadinya efek samping. leukopenia. DOSIS Dewasa : dosis awal 100 -150 mg/hari dalam 2 . Pada kasus-kasus sedang dan untuk 75 . Ginjal: gangguan fungsi ginjal. Hati: peningkatan enzim SGOT. SGPT dan hepatitis (Jarang). Sistem saraf pusat: pusing. eksim. Kulit: urtikaria. anak-anak usia > 14 tahun: tidak boleh diberikan pada anak-anak usia Anak-anak : < 14 tahun. edema (Jarang). Saluran pencernaan: dispepsia. muntah. trombositopenia.- Tukak lambung. impoten. mual. vertigo. kram perut.3 dosis terbagi. Pemberian bersamaan dengan diuretik hemat kalium dapat disertai dengan kenaikan kadar kalium dalam darah. EFEK SAMPING Efek samping yang mungkin terjadi pada : nyeri lambung. diare.: Dus Isi 5 strip @ 10 tablet DKLV722222015A1 . telinga berdenging. sakit kepala. agra-nulositosis Darah: (sangat jarang).100 mg / hari. urtikarta atau rinitis akut yang ditimbulkan oleh asam asetil salisllat atau obat-obat lain yang menghambat sintesa prostaglandin. Lain-lain: hipertensi. HARUS DENGAN RESEP DOKTER KEMASAN EFLAGEN 35: No.

: Dus isi 5 strip @ 10 tablet DKL9722222015B1 .EFLAGEN 50: No. Reg.

Sign up to vote on this title
UsefulNot useful