Analgesik, antiinflamasi http://www.farmasiku.com/index.php?

target=categories&category_id=171 Analgesik adalah obat yang dapat mengurangi atau menghilangkan rasa nyeri dan akhirnya akan memberikan rasa nyaman pada orang yang menderita. Anti inflamasi adalah obat yang dapat menghilangkan radang yang disebabkan bukan karena mikroorganisme (non infeksi). Gejala inflamasi Inflamasi dapat disertai dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Proses inflamasi meliputi kerusakan mikrovaskuler, meningkatnya permeabilitas vaskuler dan migrasi leukosit ke jaringan radang, dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Mediator yang dilepaskan antara lain histamin, bradikinin, leukotrin, Prostaglandin dan PAF. Penanganan inflamasi 1 2 3 4 5 6 7 Derivat Asam Salisilat à Aspirin, Benorilat, Diflunisal, Salsalat Derivat Asam Propionat à As.Tiaprofenat, Fenbufen, Flurbiprofen, Ibuprofen, Ketoprofen, Naproksen Derivat.As.Fenamat à As.Mefenamat, Meklofenamat Derivat As.Fenilasetat à Diklofenak, Fenklofenak Derivat Oksikam à Piroksikam, Tenoksikam Der.As.Asetat inden/indol à Indometasin, Sulindak, Tolmetin Deriva Pirazolon à Azapropazon, Fenilbutazon, Oksifenbutazon

ABDIFLAM CODE: C29 Harga Per Satuan Terkecil : Rp1,350.00 Abdiflam Natrium diklofenak 25 mg; 50 mg. Indikasi: sakit pasca traumatik inflamatori, inflamasi dan bentuk degeneratif rematik, rematik non artikular. Dosis: Dewasa: awal: sehari100-150 mg dalam dosis terbagi 2-3x; Anak 14th: 75-100 mg sehari dalam dosis bagi 2-3x. Kemasan: 5 x 10 tablet 50 mg.

AFI RHEUMA CODE: C1

Harga Per Satuan Terkecil : Rp2,300.00 BELI AFI RHEUMA KAPSUL KOMpOSISI : Tiap kapsul mengandung : 4 butil 1,2 difenilpirazolidina 3,5 dion ................... 100 mg CARA KERJA OBAT : Sebagai anti radang dan analgetik INDIKASI : Ankylosing spondylitis, acute gouty arthritis, active rheumatoid arthritis. CARA PEMAKAIAN: Dewasa 2-3 kali sehari 1 kapsul, sesudah makan atau diminum dengan susu, seyogyanya sesuai petunjuk dokter. EFEK SAMPING: - Iritasi gastrointestinal (mual, muntah, rasa terbakar pada lambung). - Retensi : Cairan, edema, rash. - Gangguan hematologi yang serius (leukopenia, agranulositopenia, aplastik-anemia). - Alergi INTERAKSI OBAT: Jangan diberikan bersama - sama dengan : Kumarinantikoagulan, insulin, fenitoin, oral hipoglikemik. KEMASAN : Box isi 10 blister @ 12 kapsul Reg. No. DKL 8901700901 A1 Simpanlah obat ini ditempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER Allogon 500 Harga Per Satuan Terkecil : Rp700.00 BELI ALLOGON 500 mg. Komposisi Mefenamic acid/Asam mefenamat INDIKASI Nyeri ringan, sedang sampai berat seperti sakit kepala, nyeri otot, artralgia (nyeri sendi), sakit gigi, osteoartitis rematoid, gout, nyeri saat haid, nyeri setelah operasi, nyeri setelah terjadi patah tulang, nyeri setelah melahirkan, neuralgia (nyeri pada saraf), dan nyeri pada organ-organ dalam perut. KONTRA INDIKASI Gastritis, ulkus lambung, dan anemia hemolitik. PERHATIAN Kehamilan, dehidrasi, epilepsi, asma. Interaksi obat : antikoagulan oral. EFEK SAMPING

Gangguan & perdarahan saluran pencernaan, ulkus peptikum, sakit kepala, gugup, insomnia (sulit tidur), biduran/kaligata, kemerahan pada kulit, pembengkakan wajah. INDEKS KEAMANAN PADA WANITA HAMIL C: Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin. KEMASAN Kaplet 500 mg x 2 x 10 butir. DOSIS Dewasa : 250-500 mg tiap 6 jam sekali. Anak-anak : 6,5 mg/kg berat badan tiap 6-8 jam sekali. Nyeri saat : diawali dengan 500 mg, kemudian 250 mg tiap 6 jam. haid PENYAJIAN Dikonsumsi bersamaan dengan makanan PABRIK Konimex. Analsik CODE: C2 Harga Per Satuan Terkecil : Rp1,150.00 ANALSIK Tiap kaptet mengandung : Metampiron 500 mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. Metampiron adalah suatu obat analgesik- antipiretik. Diazepam mempunyai kerja sebagai antiansietas, juga memiliki sifat relaksasi otot rangka. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral. INDIKASi : Untuk meringankan rasa nyeri sedang sampai berat, ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam. Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg, wanita hamil dan menyusui. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. Glaukoma sudut sempit, keadaan psikosis akut. EFEK SAMPING : Dapat menimbulkan agranulositosis. Reaksi hipersensitivitas, reaksi pada kulit,ngantuk,pusing,lelah yang berlebihan. Konstipasi, depresi, diplopia, hipotensi, jaundice, perubahan libido, mual, tremor, retensi urin, vertigo. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan

wanita hamil dan menyusui. Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral. sebaik-nya tidak digunakan untuk jangka pahjang.bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam. No. .- darah/kelainan darah. ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. maksimum 4 kaplet sehari. HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet. sindroma bahu lengan. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam.Indonesia Analspec CODE: C3 Harga Per Satuan Terkecil : Rp1.250. Walaupun jarang menimbulkan agranulositosis. lumbago. INDIKASI : Untuk meringankan rasa nyeri sedang sampai berat. sakit punggung. Metampiron adalah suatu obat analgesik. INTERAKSI OBAT : Penggunaan bersama . DOSIS : 1 kaplet. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. Dibuat oleh : PT SANBE FARMA Bandung . Reg.antipiretik. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut.sama dengan obat . ansietas.00 ANALSIK Tiap kaptet mengandung : Metampiron 500mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri. bursitis. Diazepam mempunyai kerja sebagai antiansietas.30°C). juga memiliki sifat relaksasi otot rangka. Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam. gangguan fungsi hati atau ginjal. karena dapat berakibat fatal. Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg.: DPL8822208609A1. PENYIMPANAN Simpan pada suhu kamar (25°.halusinasi dan gangguan tidur.

obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam. gangguan fungsi hati atau ginjal. maksimum 4 kaplet sehari. ansietas. Walaupun jarang menimbulkan agranulositosis. Konstipasi. keadaan psikosis akut. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik.: DPL8822208609A1. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut. Reaksi hipersensitivitas.halusinasi dan gangguan tidur.ngantuk. bursitis. tremor. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri. perubahan libido. Reg. jaundice.Indonesia Anastan CODE: C4 Harga Per Satuan Terkecil : Rp250. Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut.bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam. diplopia. lumbago.lelah yang berlebihan. EFEK SAMPING : Dapat menimbulkan agranulositosis.30°C). PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. PENYIMPANAN Simpan pada suhu kamar (25°. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. mual. No. retensi urin.00 ANASTAN (Mefenamic Acid) 500 mg . Dibuat oleh : PT SANBE FARMA Bandung .Glaukoma sudut sempit.sama dengan obat .pusing. INTERAKSI OBAT : Penggunaan bersama . HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet. karena dapat berakibat fatal. sakit punggung. sindroma bahu lengan. vertigo. hipotensi. sebaik-nya tidak digunakan untuk jangka pahjang. depresi. DOSIS : 1 kaplet. reaksi pada kulit.

aiergik rinrtis atau urticaria karena obat non steroid anti inflamasi yang lain. thrombocytopenia. Kemasan : Anastan forte : Dos isi 10 strip @ 10 kaplet. Peringatan dan Perhatian : Dalam pengooatan. Mempengaruhi test urine. nyeri sesudah operasi dan dysmenorrhoea primer. : Awal 1 kaplet (500 mg) kemudian Vi kaplet (250 mg) tiap 6 Indikasi : Sebagai obat untuk meringankan rasa sakit seperti pada sakit gigi.hati pada penderita yang mendapat bronkospasma. nervous dan sakit kepala. Hati . Juga pada penderita gangguan fungsi ginjal atau pernah menderita sakit ginjal atau hati. Cara penyimpanan : Disimpan di tempat tertutup dan diluar pengaruh cahaya. Tiap kapsul mengandung Acidum Mefenamicum 250 mg. berkhasiat analgesic dan anti inflamasi.Anastan adalah obat yang mengandung Acidum Mefenamicum. Juga dapat timbul kantuk. Harus dengan resep dokter No. : Anastan forte DKL 9207802304 A1 Antalgin CODE: C5 Harga Per Satuan Terkecil : Rp150. karena kemungkinan terjadi" cross sensitivity". Reg. Wanita mengandung atau sedang menyusui. Efek samping : Dapat timbul diare biasa hingga berat. sehingga hemoiytic anemia coombs positif. bila cfiare maka pengobatan dihentikan. Dapat timbul agranucytosis. Keamanan penggunaan pada anak . anemia. Enteraksi obat : Dengan obat anti coagulant. Komposisi : Tiap kaplet mengandung Acidum Mefenamicum 500 mg (Anastan Forte). Digunakart tidak lebih dari 7 hari.anak diatas 14 tahun : - Anastan forte jam. terjadi tukak lambung dan pendarahan. sakit kepaia. Kontra indikasi : Obat kontra indikasi bagi penderita sakit tukak lambung atau inflamasi pada saluran cerna.00 Antalgin . Posologi : Dewasa dan anak . albuminiea dan kencing darah. sehingga billirubin urine positif dan protein uria positif. Penderita asma. Dapat timbul asma. mengurangi kerja obat anti coagulant.anak dibawah 14 tahun belum diketahui dengan pasti. nausea dezziness. Mempengaruhi test darah.

200.Komposisi Tiap tablet mengandung antalgin 500 mg.Reg. Kontra indikasi : Pada penderita yang alergi terhadap derivat pirazolon.00 ANTRAIN TABLET . terutama kolik dan sakit setelah operasi. Pada penggunaan jangka panjang dapat menyebabkan agranulositosis. Kasus porfiria hati (amat jarang) dan defisiensi bawaan glukosa-6-fosfat-dehidrogenase. Reg. antipiretik danantiinflamasi. Indikasi : Untuk menghilangkan rasa sakit. Efek Samping : Gejala kepekaan yang manifestasinya kelainan pada kulit. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.INJEKSI© . Peringatan dan Perhatian : Karena dapat menimbulkan agranulositosis yang berakibat fatal. Antalgin mudah larut dalam air dan mudah diabsorpsi ke dalam jaringan tubuh. botol 1000 tablet No. Penderita dengan tekanan darah <100 mmHg. Tiga efek utama adalah sebagai analgesik. Bayi 3 bulan pertama atau dengan berat badandibawah 5 kg. Penderita yang hipersensitif.30°C (kondisi penyimpanan. WanitahamilteTutama^B bulan pertamanaTT6 minggu terakhir. Dewasa : sehari 3 kali 1 tablet. maka sebaiknya tidak digunakan terus-menerus dalam jangka panjang.:GKL9420906010A1 HARUS DENGAN RESEP DOKTER INDO FARMA BEKASI – INDONESIA Antrain CODE: C6 Harga Per Satuan Terkecil : Rp10. normal). Kemasan dan Nomor Registrasi Antalgin 500 mg. Dosis dan Cara Penggunaan : Melalui mulut (per oral).: GKL9420906010A1 Antalgin 500 mg. kotak 10 blister @ 10 tablet No. Cara Kerja Obat : Antalgin adalah derivat metansulfonat dan amidopirina yang bekerja terhadap susunan saraf pusat yaitu mengurangi sensitivitas reseptor rasa nyeri dan mempengaruhi pusat pengatur suhu tubuh. Cara Penyimpanan : Simpan pada suhu 25° .

Mekanisme kerjanya adalah menghambat transmisi rasa sakit ke susunan saraf pusat dan perifer. INDIKASI : Untuk meringankan rasa sakit. Karena dapat menimbulkan agranulositosis yang berakibat fatal.sindroma bahu lengan.ANAK HARUS DENGAN RESEP DOKTER . Karena itu perlu dilakukan pemeriksaan fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. diberikan secara injeksi I. Pada pemakaian jangka lama dapat menimbulkan sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan. INTERAKSI OBAT : Bila Metamizole Na diberikan bersamaan dengan Chlorpromazine dapat mengakibatkan hipotermia. berikutnya 1 tablet tiap 6-8 jam.maksimum 4 tablet sehari. Penderita dengan tekanan darah sistolik < 100 mmHg. Injeksi : 500 mg jika sakit timbul. Bayi di bawah 3 buian atau dengan berat badan kurang dari 5 kg.No. PERINGATAN / PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. diabsorpsi dari saluran pencernaan mempunyai waktu paruh 1-4 jam. KONTRA INDIKASI : Penderita hipersensitif terhadap Metamizole Na. gangguan fungsi hati atau ginjal. Agranulositosis. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. maksimum 3 kali sehari. No.KOMPOSISI : Tiap tablet mengandung : Metamizole Na 500 mg ANTRAINI Injeksi Tiap ml mengandung: Metamizole Na 500 mg CARA KERJA OBAT : Metamizole Na adalah derivat metansulfonat dari aminopirin yang mempunyai khasiat analgesik. EFEK SAMPING : Reaksi hipersensitivitas: reaksi pada kulitmisal kemerahan.bursitis.sakit punggung.lumbago. maka sebaiknya tidak digunakan dalam jangka panjang. berikutnya 500 mg tiap 6-8 jam.V. KEMASAN : ANTRAIN* Tablet Kotak berisi 10 strip @ 10 tablet Reg. Wanita hamil dan menyusui.M.: DKL0117616843A1 JAUHKAN DARI JANGKAUAN ANAK .terutama nyeri kolik operasi. Metamizole Na bekerja sebagai analgesik. ATURAN PAKAI : Dewasa: Tablet : 1 tablet jika sakit timbul. atau I.:DKL7617611210A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA ANTRAIN* Injeksi Kotak berisi 5 ampul @ 2 ml netto Reg.

karena dapat terjadi sensitivitas silang.: DKL0033201I301A1 ARGESID 500 . sakit kepala. dispepsia.M.100. mual. H. hipersensitif usus. asetosal. ruam makulo papular. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase sehingga mempunyai efek analgetik dan antiinflamasi. Sidoarjo-61252 Jawa Timur. diare. radang gangguan ginjal. No. Kontra indikasi : Tukak lambung. Mangundiprojo no. Interbat Jl. Efek samping : Gangguan saluran cerna seperti iritasi lambung. Indonesia Argesid 500mg Harga Per Satuan Terkecil : Rp1.SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA JANGAN DISIMPAN DALAM LEMARI PEMBEKU Diproduksi Oleh : PT. ARGESID 500 Tiap Kaplet salut selaput mengandung Asam Mefenamat 500 mg Farmakologi : Asam Mefenamat merupakan anti inflamasi non-steroid. 1 Buduran. sakit kepala. Interaksi Obat : Obat-obatan antikoagulan oral seperti warfarin. muntah. Tidak boleh melebihi dosis yang dianjurkan dan lebih dari 7 hari. Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahui. meredakan rasa nyeri seperti nyeri otot.00 ARGESID Asam Mefenamat KOMPOSISI : ARGESID 250 Tiap kapsul mengandung Asam Mefenamat 250 mg. usus. vertigo. Reg. Pada penggunaan terusmenerus dengan dosis 2000 mg atau lebih sehari dapat mengakibatkan agranulositosis dan hemolitik anemia. Hati-hati pemberian pada penderita bronkhospasme. Box 10 Strip @10 Kapsul. dismenore. Indikasi : untuk meredakan rasa sakit seperti sakit gigi. pusing. Dosis : Dewasa dan anak-anak di atas 14 tahun: Dosis awal 500mg kemudian dilanjutkan 250 mg tiap 6 jam. nyeri sesudah operasi. kolik. urtikaria atau mendapat pengobatan antiinflamasi non-steroid lainnya. kecuali atas petunjuk dokter. Kemasan: ARGESID 250. nyeri karena trauma. alergik rinitis. nyeri saat melahirkan.R. Peringatan dan Perhatian Tidak dianjurkan diberikan pada wanita hamil dan menyusui.

Box 10 Strip @10 Kaplet No. Pada kulit : pruritus.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. rasa mual.00 Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. Penghambatan COX2 menentukan efek terapi NSAI. EFEK SAMPING : Saluran cerna : dispepsia.700. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik). Pendarahan gastrointestinal. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma. lekopenia dan trombosito penia. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serumkreatinin dan/atau serum urea. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1.5 mg mengandung Meloxicam 7. jarang terjadi fotosensitisasi. stomatitis. bersendawa. rasa sakit di perut. urtikaria. diare. PROMEDRAHARDJO FARMASIINDUSTRI Sukabumi – Indonesia Artrilox 15 CODE: C8 Harga Per Satuan Terkecil : Rp7. analgesik. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. Mekanisme kerja meloxicam sebagai efek anti-inflamasi. muntah-muntah. Insufisiensi ginjal berat yang tidak didialisa. pendarahan gastro-intestinal makroskopik. rasa kembung. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan. ulkus gastroduodenal. Insufisiensi hepar yang berat. Reg. esofagitis. jarang terjadi kolitis.konstipasi.: DKL0033201109A1 ( Simpan di tempat sejuk (15-25)°C dan kering ) HARUS DENGAN RESEP DOKTER PROMED PT. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. gangguan jumlah sel darah : lekosit. ruam kulit. KONTRA INDIKASI : Ulkus lambung yang aktif. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya. terutama . Anemia. x Anakanak dan remaja yang berumur kurang dari 15 tahun. Masa kehamilan dan menyusui. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. polip dihidung. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). Bila diberikan bersama-sama dengan obat mielotoksik yang potent.

Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. nekrosis medularis ginjal. Seperti halnya obat-obat NSAI lainnya. pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. ngantuk. heparin secara sistemik. Pada pasien tersebut. NSAI jarang menimbulkan nefritis interstitial. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. hati ataupun jantung. Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis.methotrexate. Pemberian bersama ticlopidine (anti-koagulan oral). diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. Pada pasien yang volume & aliran darah ke ginjal menurun. Sistem susunan saraf pusat : kepala terasa ringan. Bila pemberian bersama obat anti koagulan tidak dapat dihindari. peningkatan tekanan darah. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. sindrom nefrotik. trombolitik dapat meningkatkan resiko pendarahan. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. dianjurkan untuk menghentikan aktivitas. pusing. Pasien yang beresiko tinggi adalah pasien yang dehidrasi. muka kemerahan. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. sindrom nefrotik dan penyakit ginjal. vertigo. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. Bila kondisi ini dalam waktu lama. sirosis hati. Seperti pada obat-obat NSAI. hati atau jantung. glomerulonefritis. tinitus. dosis meloxicam tidak boleh melebihi 7. Kardiovaskuler: edema. Pernafasan : jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. palpitasi. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. akan menyebabkan terjadinya sitopenia. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. Seperti hal obat-obat NSAI. maka harus dimonitor efek - . Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). dan pada umumnya orang tua menderita gangguan fungsi ginjal.5 mg/hari. pasien dengan gagal jantung kongestif.

diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi.5 mg/hari. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2.5 CODE: C7 Harga Per Satuan Terkecil : Rp4. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate. dianjurkan untuk memonitor jumlah sel darah. sehingga akan mempercepat eliminasi meloxicam.5 mg per hari. 2 Strip @ 10 Tablet No. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas.5 mg per hari. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak.farmasiku. DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari. Tablet harus ditelan dengan air/minuman pada waktu makan. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari. Kontrasepsi : menurunkan efektivitas alat KB IUD. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium. Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal.Reg. Osteoartritis:7. 2 Strip @ 10 Tablet No.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN. Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7.5 mg Tablet Box. Dosis terapeutik dapat dikurangi sampai 7. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut. ACE inhibitor. Artritis reumatoid :15 mg/hari. sehingga perlu dimonitor fungsi ginjal. KEMASAN : Artrilox 7. Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam.antikoagulan. vasodilator.5 mg/hari tergantung respon klinis. Pada pasien yang dehidrasi.Reg. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal.com Artrilox 7. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEPDOKTER Diproduksi oleh: COMBIPHAR BANDUNG-INDONESIA http://www.DKL9904125810A1 Artrilox 15 mg Tablet Box. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker.00 . Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7.700.

muntah-muntah. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut. Insufisiensi ginjal berat yang tidak didialisa. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik). bersendawa. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin. KONTRA INDIKASI : Ulkus lambung yang aktif. jarang terjadi kolitis. diare. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox).5 mg mengandung Meloxicam 7. pendarahan gastro-intestinal makroskopik. Insufisiensi hepar yang berat. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya.BELI Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. Pendarahan gastrointestinal. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. polip dihidung. rasa kembung.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. rasa mual. x Anakanak dan remaja yang berumur kurang dari 15 tahun. Masa kehamilan dan menyusui. esofagitis. ulkus gastroduodenal. konstipasi. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma. Mekanisme kerja meloxicam sebagai efek anti-inflamasi. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serum kreatinin . Penghambatan COX2 menentukan efek terapi NSAI. analgesik. EFEK SAMPING : Saluran cerna : dispepsia. rasa sakit di perut.

muka kemerahan. gangguan jumlah sel darah : lekosit. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. dianjurkan untuk menghentikan aktivitas. jarang terjadi fotosensitisasi. tinitus. ruam kulit. glomerulonefritis. Seperti halnya obat-obat NSAI lainnya. terutama methotrexate. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. hati ataupun jantung. Bila kondisi ini dalam waktu lama. sindrom nefrotik. akan menyebabkan terjadinya sitopenia.5 mg/hari. pusing. hati atau jantung. Pernafasan:jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. Pada pasien yang volume & aliran darah ke ginjal menurun. Pasien yang beresiko tinggi adalah pasien yang dehidrasi. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. stomatitis. dan pada umumnya orang tua menderita gangguan fungsi ginjal. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. Pada pasien tersebut. Kardiovaskuler : edema. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. Bila diberikan bersama-sama dengan obat mielotoksik yang potent. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. Sistem susunan saraf pusat : kepala terasa ringan. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. dosis meloxicam tidak boleh melebihi 7. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. - - - - . Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. lekopenia dan trombosito penia. Anemia. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. peningkatan tekanan darah.- dan/atau serum urea. pasien dengan gagal jantung kongestif. Pada kulit : pruritus. ngantuk. Seperti hal obat-obat NSAI. pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. palpitasi. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. NSAI jarang menimbulkan nefritis interstitial. urtikaria. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). Seperti pada obat-obat NSAI. sindrom nefrotik dan penyakit ginjal. nekrosis medularis ginjal. vertigo. sirosis hati.

Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam. Bila pemberian bersama obat anti koagulan tidak dapat dihindari. Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker. sehingga perlu dimonitor fungsi ginjal. sehingga akan mempercepat eliminasi meloxicam. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak. dianjurkan untuk memonitor jumlah sel darah.5 mg/hari tergantung respon klinis. . Pada pasien yang dehidrasi.5 mg/hari. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. trombolitik dapat meningkatkan resiko pendarahan. Kontrasepsi : menurunkan efektivitas alat KB IUD. ACE inhibitor. Pemberian bersama ticlopidine (anti-koagulan oral). Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7.5 mg per hari. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari. heparin secara sistemik. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal. Osteoartritis:7. Dosis terapeutik dapat dikurangi sampai 7. vasodilator. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas.5 mg per hari. maka harus dimonitor efek antikoagulan. Tablet harus ditelan dengan air/minuman pada waktu makan. - - - DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi.INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate. Artritis reumatoid :15 mg/hari.

2 Strip @ 10 Tablet No.Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya.Reg. INDIKASI : . POSOLOGI : Dewasa dan anak diatas 14 tahun Dosis awal dianjurkan 500 mg kemudian dilanjutkan250 mg tiap jam sesudah makan.Reg.DKL9904125810A1 Artrilox 15 mg Tablet Box. Kaplet 500 mg. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEP DOKTER Di produksi oleh: COMBIPHAR BANDUNG-INDONESIA Asam Mefenamat Kapsul 250 mg. 2 Strip @ 10 Tablet No. KEMASAN : Artrilox 7. KOMPOSISI : Tiap kapsui mengandung 250 mg Asam mefenamat "Flap kaplet 500 mg salut selaput mengandung 500 mg Asam mefenamat.5 mg Tablet Box.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN.

T. PERINGATAN DAN PERHATIAN : Jangan dibenkan pada penderita bronkospasme aliergik rhinitis. sakit sehabis operasi dan melahirkan. KEMASAN : Kapsul 250mg : Dus 10 strip® 10 Kapsui . Harus dengan resep dokter. Jangan digunakan lebih dan dosis yang dianjurkan atau lebih dari 7 hari kecuali atas petunjuk dokter. muntah.Indonesia Asimat CODE: C10 Harga Per Satuan Terkecil : Rp800. No.00 BELI ASIMAT 500 . PHYTO KEMO AGUNG FARM A Jakarta . pada penggunaan jangka panjang yang terus menerus dengan dosis 2000 mg atau lebih sehan dapat mengakibatkan agranulositosis dan hemolitik anemia. nyeri sendi. nyeri otot. sakit kepala dan sakit gigi. P. terhindar dari cahaya. termasuk nyeri karena trauma. diare. No Reg GKL 9830010709 A1 CARA PENYIMPANAN : Simpan ditempat kering dansejuk. nyeri sewaktu haid.penderita ginjal dan penderita yang hipersensitif. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. urticaria atau mendapat obat non steroid anti-inflamasi yang lain karena kemungkinan terjadi sensitiyitas silang Jangan digunakan pada wanita hamil dan menyusui. KONTRA INDIKASI : Pada penderita dengati tukak lambung / usus. Keamanan penggunaan pada anak-anak dibawah umur 14 tahun belum diketahui dengan pasti.Untuk menghitangkan segala macam nyeri dan ringan sampai sedang dalam kondisi akut dan kronis. EFEK SAMPING : Umumnya Asam Mefenamat dapat dibenkan dengan baik pada dosis yang dianjurkan. pendenta asma. Reg : GKL9930011201 A1 Kaplet 500 mg : Dus 10 strip® 10 Kaplet .

INDIKASI : Untuk mengurangi nyeri dari ringan sampai sedang dalam kondisi akut dan kronis. muntah dan diare. KONTRA INDIKASI : Pada penderita dengan tukak lambung / usus.KOMPOSISI : Tiap kaplet salut selaput ASIMAT500 mengandung Mefenamic Acid 500 mg CARA KERJA : Mefenamic Acid adalah suatu analgetik yang mempunyai daya anti-inflamasi. nyeri sewaktu haid. sakit kepala dan sakit gigi. penderita ginjal dan penderita yang hipersensitif terhadap Mefenamic Acid. penderita asma. termasuk nyeri karena trauma. Agranulositosis dan hemolitik anemia mungkin dapat terjadi pada penggunaan dalam jangka waktu lama yang terus menerus dengan dosis 2000 mg atau lebih sehari. sakit sehabis melahirkan. EFEK SAMPING : Efek samping yang timbul umumnya dapat ditolerir dengan baik pada dosis yang dianjurkan. perdarahan lambung. pusing. nyeri otot. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. . POSOLOGI / DOSIS : Dewasa dan anak-anak > 14 tahun : Dosis oral yang dianjurkan 500 mg kemudian dilanjutkan 250 mg setiap 6 jam jika diperiukan.

allergic rhinitis. Keamanan pengguhaan pada anak-anak di bawah 14 tahun belum diketahui dengan pasti. terlindung dari cahaya matahari. urticaria atau mendapat obat nonsteroid anti-inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. INTERAKSI OBAT : Antikoagulan oral.550. No. Jangan digunakan pada wanita hamil dan menyusui. PENGEMASAN DAN NOMOR REGISTRASI Box.00 BELI AULIN TABLET 100 MG KOMPOSISI : Tiap tablet mengandung Nimesulide 100 mg URAIAN : . 10 strip @ 10 kaplet salut selaput ASIMAT 500. Reg. DKL9833300909A1 HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT. Jangan digunakan lebih dari dosis yang dianjurkan atau lebih dari 7 hah kecuali atas petunjukdokter. Jauhkan obat dari jangkauan anak-anak. CARA PENYIMPANAN : Simpan di tempat sejuk dan kering.Indonesia BlI-24/02/05 AULIN TABLET 100 MG Harga Per Satuan Terkecil : Rp4.PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. MERSIFARMATM Sukabumi .

urticaria) terhadap OAINS dan acetosal .Pasien dengan tukak lambung atau usus.Pasien dengan kelainan fungsi ginjal berat (CCT <30 ml/menit) . .Pasien dengan riwayat reaksi hipersensitif (seperti bronkospasme.ulserasi berulang. DKI 0051900210A1 PABRIK : Helsinn Birex Pharmaceuticals HARUS DENGAN RESEP DOKTER Benostan 500 Harga Per Satuan Terkecil : Rp1.Orang dewasa 1 tablet 2xsehari setelah makan (1 tablet 100 mg) .00 BELI BENOSTAN tab KOMPOSISI Mefenamic acid/Asam mefenamat .rhinitis.Pasien yang diketahui hipersensitif terhadap Nimesulide . DOSIS & CARA PEMAKAIAN : . analgesika. pendarahan serebrovaskular. atau pendarahan aktif lainnya atau gangguan pendarahan . atau pendarahan gastrointetinal. antipiretika seperti osteoarthritis penyakit rematikekstra-artikular.250.Pasien dengan gangguan koagulasi berat .Aulin tidak dianjurkan digunakan pada anak-anak dibawah 12 tahun KONTRA INDIKASI : .Pasien dengan insufisiensi hepar sedang atau berat . Setiap box berisi 2 blister @ 10 tablet 100 mg Nimesulide. rasa nyeri dan inflamasi setelah intervensi bedah dan setelah trauma akut dan dismenoria.Penggunaan pada anak-anak KEMASAN & NO REG.4-NITRO-2-phenoxymethane sulponanilide INDIKASI : Aulin merupakan suatu obat anti inflamasi non steroid untuk berbagai kondisi yang membutuhkan anti inflamasi.

ulkus peptikum. .5 mg/kg berat badan/hari dalam 3-4 dosis terbagi. nyeri rematik PENYAJIAN Dikonsumsi bersamaan dengan makanan : : : 3 kali sehari 250 -500 mg. penyakit ginjal. EFEK SAMPING Gangguan & perdarahan saluran pencernaan. migren. kerusakan hati atau ginjal. gugup. dehidrasi. PERHATIAN Kehamilan. demam. epilepsi. 6. ruam kulit. KEMASAN Tablet 500 mg 10stp DOSIS • Dewasa Anak berusia 6 bulan atau • lebih Dismenore (nyeri saat • haid). KONTRA INDIKASI Ulkus peptikum atau ulserasi usus. INDEKS KEAMANAN PADA WANITA HAMIL Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. asma. Interaksi obat : antikoagulan oral. diskrasia darah.INDIKASI Nyeri.gangguan penglihatan. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin. 3 kali sehari 500 mg. pusing. mengantuk. penyakit radang usus besar. sakit kepala.

KONTRA INDIKASI : Pasien yang hipersensitif terhadap Mefenamie Acid. kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. CARA KERJA OBAT : Bimastan merupakan kelompok anti inflamasi non steroid. anti infiamasi dan antipiretik. INDIKASI : Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik. Penderita yang dengan Asetosal mengalami bronkospasme. Penderita dengan tukak lambung dan usus.00 BELI BIMASTAN© KOMPOSISI : Tiap kapsul mengandung: MefenamicAcid Tiap kaptab salut selaput mengandung: MefenamicAcid Tiap kaptab mengandung: MefenamicAcid 500 mg. diare dan rasa sakit pada abdominal. nyeri otot dan nyeri sesudahoperasi. alergi rhinitis dan urtikaria. EFEK SAMPING : Sistem pencernaan : mual. 250 mg.PABRIK Bernofarm. muntah. dismenore primer. sakit gigi. TAKARAN PEMAKAIAN : Dewasa dan anak-anak > 14 tahun: Dosis awai: 500 mg. Bimastan CODE: C11 Harga Per Satuan Terkecil : Rp200. . 500 mg. termasuk nyeri karena trauma. Penderita dengan gangguan ginjal yang berat.

-

Sistem hematopetik : leukopenia, eosinophilia, trombocytopenia dan agranulocytopenia. Sistem saraf : rasa mengantuk, pusing, penglihatan kabur dan insomnia.

PERINGATAN DAN PERHATIAN : Sebaiknya diminum sesudah makan. Hati-hati digunakan pada wanita hamil dan menyusui. Keamanan penggunaan pada anak - anak dibawah 14 tahun belum diketahui dengan pasti. KONTRA INDIKASI : Penggunaan bersama antikoagulan oral dapat memperpanjang "Prothrombin".

OVER DOSIS : Jika terjadi over dosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbon absorben) untuk menyerap obat. KEMASAN : Dus isi 10strip® "10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 10 strip @ 10 kaptab No. Reg. DKL 8931402104 A1 Dus isi 50 blister @ 10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 40 blister @ 10 kaptab salut selaput No. Reg. DKL 9731407209 A1 Dus isi 10 blister @ 10 kaptab salut selaput No. Reg. DKL 0431407209 A1 Botol isi 1.000 kapsul No. Reg. DKL 8931402001 A1

250mg 500 mg 250 mg 500 mg 500 mg 250 mg

SIMPAN DITEMPAT SEJUK (15 - 25)°C DAN KERINGTERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT. BIMA MITRA FARMA TANGERANG - INDONESIA Bio mega CODE: C12

Harga Per Satuan Terkecil : Rp300.00 BELI BIO MEGA

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiro Vitamin B1 Vitamin B6 Vitamin B12 INDIKASI :

500 mg 50 mg 50 mg 100 mcg

Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat. KONTRA INDIKASI : * * * * Penderita hipersensitif Bayi di bawah 3 bulan, atau dengan berat badan di bawah 5 kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg

EFEK SAMPING : Agranulositosis, reaksi kepekaan, mengantukdan pusing."

PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu, lengan. Karena dapat menimbulkan agranulositosis yang berakibat fatal, maka sebaiknya tidak digunakan dalam jangka panjang terusmenerus. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius.

DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput.

KEMASAN : Dus, isi 10 strip @ 10 tablet salut selaput NO. REG. DKL9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT. GRAHA FARMA SOLO - INDONESIA Biomega 10 Kaplet Harga Per Satuan Terkecil : Rp300.00 BELI Biomega

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiron Vitamin B1 Vitamin B6 Vitamin B12

INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat.

KONTRA INDIKASI :

DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. DKL 9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius. REG.- Penderita hipersensitif Bayi dibawah 3bulan. lumbago. GRAHA PARMA SOLO . KEMASAN : Dus.00 BELI BIROPYRON Kaplet Salut Selaput . reaksi kepekaan. bursitis. sakit punggung. gangguan fungsi hati atau ginjal. sindroma bahu. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.atau dengan berat badan dibawah 5kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg EFEK SAMPING : Agranulositosis. lengan.INDONESIA Biropyron Harga Per Satuan Terkecil : Rp300. isi 10 strip @ 10 tablet salut selaput NO. PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. mengantuk dan pusing.

Penderita hipersensitif . lumbago. KONTRA INDIKASI: .00 BELI BODREX .hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah. maka sebaiknya tidak digunakan dalam waktu panjang dan terus menerus.KOMPOSISI: Tiap kaplet salut selaput mengandung: Methampyrone 500 mg Thiamine HCl 50 mg Pyridoxine HCl 100 mg Cyanocobalamine 100 mcg INDIKASI: Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia. sakit punggung. .Pada pemakaian jangka lama dapat timbul sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan. . bursitis.Karena dapat menimbulkan agranulositosis dan berakibat fatal. Reg.Wanita hamil dan menyusui . KEMASAN: Dus isi 10 Strip® 10 Kaplet No. ginjal. DOSIS: 1 kaplet 3x sehari . karena itu perlu dilakukan pemeriksaan uji fungsi hati atau ginjal dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut.INDONESIA Bodrex CODE: C13 Harga Per Satuan Terkecil : Rp5. DKL0231406809 A1 SIMPAN DITEMPAT SEJUK (15-25)°C DAN KERING TERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT.Penderita dengan tekanan darah sistolik < 100 mm Hg EFEKSAMPING: Reaksi hipersensitif pada kulit.Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. misalnya kemerahan dan agranulositosis. PERINGATAN DAN PERHATIAN: . DKL0231406809 A2 Botol isi 1.000 kaplet No. gangguan fungsi hati. . Reg. sindroma bahu lengan. BIMA MITRA FARMA TANGERANG .Hati.500.

DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. dapat meningkatkan resiko kerusakan fungsi hati. • Reaksi hipersensitifitas. sakit gigi. . KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. INDIKASI : Meringankan SAKIT KEPALA.Meringankan SAKIT KEPALA. SAKIT GIGI dan menurunkan DEMAM. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. segera hubungi dokter/unit pelayanan kesehatan terdekat. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. • Penderita Hipersensitif. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam.

......700.50 mg CARA KERJA OBAT paracetamol merupakan analgetik-antipiretik dan ibuprofen merupakan obat golongan analgetik-antipiretik dan anti inflamasi non steroid (AINS) yang memiliki efek analgetik(menghilangkan rasa nyeri)..........200 mg caffeine....... No.... PHARM....350 mg ibuprofen....... DBL 8522700810 A1 Dibuat oleh P....T............. Bekasi-lndonesia atas lisensi dari DR........... TEMPO SCAN PACIFIC Tbk.efek analgesik dari paracetamol dan ibuprofen bejerja sinergis dengan caffeine dalam meredakan sakit kepala INDIKASI .00 BELI BODREX EXTRA KOMPOSISI tiap tablet mengandung : paracetamol..... FABRIK / Rheinfelden / Germany P91108000 Bodrex Extra CODE: C111 Harga Per Satuan Terkecil : Rp3.. FRITZ BODE GmbH/ CHEM...antipiretik(demam) dan anti inflamasi(mengurangi proses peradangan)....SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg...

3-4 kali sehari EFEK SAMPING gangguan saluran cerna seperti mual. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : .No.200. 3-4 kali sehari anak-anak 6-12 tahun : 1/2-1 kaplet.kemerahan pada kulit dan gangguan darah INTERAKSI OBAT efek toksik dari paracetamol dapat meningkat pada pemberian bersam-sama dengan obat yang menyebabkan kerusakan hati SIMPAN PADA SUHU DI BAWAH 30'C Reg.meredakan sakit kepala DOSIS dan ATURAN PAKAI dewasa dan anak-anak >12 tahun : 1-2 kaplet. Bekasi-Indonesia Bodrex Flu batuk CODE: C14 Harga Per Satuan Terkecil : Rp1.Tempo Scan Pacific Tbk.00 BELI BODREX Meringankan SAKIT KEPALA.DTL0622719204A1 PT.nyeri ulu hati.muntah.

PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. INDIKASI : Meringankan SAKIT KEPALA. SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. SAKIT GIGI dan menurunkan DEMAM. • Reaksi hipersensitifitas. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. • Penderita Hipersensitif.Parasetamol Kofein CARA KERJA OBAT : 600 mg 50 mg bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. DBL 8522700810 A1 Dibuat oleh . No. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. sakit gigi. segera hubungi dokter/unit pelayanan kesehatan terdekat. dapat meningkatkan resiko kerusakan fungsi hati.

T. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. Bekasi-lndonesia atas lisensi dari DR. SAKIT GIGI dan menurunkan DEMAM. • Penderita Hipersensitif.00 BELI BODREX Meringankan SAKIT KEPALA. PHARM.300. FRITZ BODE GmbH/ CHEM. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. dapat . FABRIK / Rheinfelden / Germany P91108000 Bodrex migra CODE: C15 Harga Per Satuan Terkecil : Rp1. • Reaksi hipersensitifitas. TEMPO SCAN PACIFIC Tbk. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. sakit gigi. segera hubungi dokter/unit pelayanan kesehatan terdekat. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat.P. INDIKASI : Meringankan SAKIT KEPALA. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter.

..... PHARM................. .......• meningkatkan resiko kerusakan fungsi hati. KONTRA INDIKASI: ........Penderita dengan tultaK lambung dan usus...... dismenore primer... 500 mg Asam Mefenamat merupakan kelompok anti-inftamasi non steroid...... diare dan rasa sakit pada abdominal..... EFEK SAMPING : . DBL 8522700810 A1 Dibuat oleh P.....Sebaiknya diminum sesudah makan..............T....... eosinophilia.. sakit gigi. TEMPO SCAN PACIFIC Tbk.Penderita dengan gangguan ginjal yang berat. muntah.. FABRIK / Rheinfelden / Germany P91108000 Cargesik 500 Kaplet CODE: C111 Harga Per Satuan Terkecil : Rp250........ nyeri otot dan nyeri sesudah operasi.Penderita yang dengan aspirin mengalami bronkospasme....00 BELI Cargesik KOMPOSISI: Tiap kaplet mengandung Asam Mefenamat... .. anti-inflamasi dan antipiretik... SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg..Sistem saraf: rasa mengantuk... bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik..Sistem pencemaan : mual... . . INDIKASI Meredam nyeri ringan sampai sedang sehubungan dengan sakit kepala... ... .... Bekasi-lndonesia atas lisensi dari DR. trombocytopenia dan agranulocytopenia.....Penderita yang hipersensitif terhadap asam mefenamat.. termasuk nyeri karena trauma.. No......... alergi rhinitis dan urtikaria... Hati-hati penggunaan obat ini pada penderita penyakit ginjal. pusing. PERINGATAN DAN PERHATIAN : .. penglihatan kabur dan insomnia.... 500 mg Tiap kapsul mengandung Asam Mefenamat.....Sistem hematopoetik : Leukopenia... FRITZ BODE GmbH/ CHEM....

USA. Dengan ramuan yang berhasil itu.Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahul dengan pasti. Reg. Atau menurut petunjuk dokter. isi 10 blister @ 10 kaplet No. kemudian dianjurion 250 mg tiap 6 jam sesuai dengan kebutuhan. INTERAKSI OBAT : Penggunaan bersamaan antikoagulan oral dapat memperpanjang "prothrombln*. KEMASAN & No.Botol plastik @ 500 kapsul No.: DKL 9323402504 A2 HARUS DENGAN RESEP DOKTER SIMPAN PADA SUHU KAMAR (25 . OVERDOSIS: Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktlf (karbo adsorben) untuk menyerap obat.: DKL 9323402504 Al ..30)°C Semarang . Pemakaian sebaiknya sesudah makan. Cara pemakaian : Dewasa : . Reg. DOSIS: Secara umum-dapat digunakan dosis pemakaian sebagai berikut: Dewasa dan anak-anak > 14 tahun : Dosis awal: 500 mg.Dus.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. rheumatik atau sering buang air diwaktu malam. isl 10 strip @ 10 kaplet No. Dokter Carroll. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan. .Hati-hati jika digunakan pada wanita hamil dan menyusui. Reg. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan.Indonesia Carroll Super Pills Botol CODE: C17 Harga Per Satuan Terkecil : Rp11. Prof. Pill ini cocok untuk : Sakit pinggang. Reg. encok pada pangkal paha. dengan melalui percobaan selama bertahun .tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik. : DKL 9123401701 Al .000. .Dus.

Pill ini cocok untuk : Sakit pinggang. PERHATIAN : Setelah menelan pill ini. 1 pill sebelum tidur.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. Cara Dewasa 1 1 pill pill sebelum sebelum tidur. diminum 2 dengan kali air sehari.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik. Keadaan yang sedikit berat boleh makan : 2 pill sebelum makan.1 pill sebelum makan. encok pada pangkal paha. Prof. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan. diminum dengan air hangat.250. warna kencing menjadi biru atau hijau. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan. dengan melalui percobaan selama bertahun .INDONESIA Carroll Super Pills Sachet CODE: C16 Harga Per Satuan Terkecil : Rp1. 3 kali sehari. 2 pill sebelum tidur. dan tidak menguatirkan. No. Dianjurkan minum banyak air. Reg. Dengan ramuan yang berhasil itu. rheumatik atau sering buang air diwaktu malam. 2 kali sehari. Perubahan warna ini adalah reaksi normal. : . USA. diminum dengan air hangat. Dokter Carroll. hangat. pemakaian : makan. D 7811980 DIPRODUKSI OLEH : ARTOIS FARMA TANGERANG .

Reg. sakit kepala. OLEH : FARMA . air. hangat. minum Setelah menelan pill ini. : sebelum sebelum tidur. pusing atau vertigo. ruam kulit. 50 mg/tablet. Dosis : Dewasa : awal :100-150 mg sehari.INDONESIA CATAFLAM 25 CODE: C30 Harga Per Satuan Terkecil : Rp2.Keadaan 2 pill 2 pill Dianjurkan PERHATIAN yang sedikit berat makan.300.00 BELI Cataflam Kalium diklofenak 25 mg. D 7811980 DIPRODUKSI ARTOIS TANGERANG . Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi Efek samping : kadang-kadang nyeri epigastrium. Perubahan warna ini adalah reaksi normal. Tidak boleh untuk anak. Kemasan : Dos 5x10 tablet 25 m. warna kencing menjadi biru atau hijau. dan tidak menguatirkan. No. diminum boleh 3 dengan banyak makan kali air : sehari.

Dosis: Dewasa : awal : 100-150 mg sehari.200. Tidak boleh untuk anak. Efek samping : kadang-kadang nyeri epigastrium. ruam kulit. Kemasan : Dos 5x10 tablet 50 m. sakit kepala. 50 mg/tablet. Cataflam D 50 Harga Per Satuan Terkecil : Rp4.00 BELI CATAFLAM D KANDUNGAN : Diclofenac / Diklofenak. INDIKASI : Pengobatan jangka pendek pada peradangan & nyeri sesudah operasi. Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi. osteoartritis (penyakit sendi degeneratif yang disertai dengan kelainan tulang . keadaan meradang setelah trauma (terpukul/terbentur/teririrs) yang disertai rasa sakit/nyeri.00 BELI Cataflam Kalium diklofenak 25 mg. pusing atau vertigo.350.CATAFLAM 50 CODE: C31 Harga Per Satuan Terkecil : Rp4.

PERHATIAN : • Gejala/riwayat penyakit lambung-usus. • Asma. • Gangguan fungsi hati. • Kemampuan mengendarai & menggunakan mesin mungkin terpengaruh. KEMASAN : Tablet 50 mg x 50 biji. peningkatan serum transaminase. perdarahan lambung-usus. pusing. antidiabetes oral. EFEK SAMPING : • Kadang-kadang : gangguan saluran pencernaan. eritroderma. DOSIS : • Dewasa: dosis awal 2-3 tablet. purpura (keadaan yang ditandai dengan bercak-bercak perdarahan dalam kulit atau selaput lendir). sindroma Stevens-Johnson. • Usia lanjut. KONTRA INDIKASI : Ulkus lambung atau usus. vertigo. INDEKS KEAMANAN PADA WANITA HAMIL : Baik penelitian reproduksi hewan tidak menunjukkan risiko pada janin maupun penelitian terkendali pada wanita hamil atau hewan coba tidak memperlihatkan efek merugikan (kecuali penurunan kesuburan) dimana tidak ada penelitian terkendali yang mengkonfirmasi risiko pada wanita hamil semester pertama (dan tidak ada bukti risiko pada trisemester selanjutnya). abnormalitas fungsi ginjal. • Hamil. atau ginjal. • Kehilangan volume ekstraseluler. diskrasia darah. pankreatitis. menyusui. • Jarang : ulkus peptikum. ruamkulit. hepatitis. gout akut. reaksi hipersensitifitas. • Kasus-kasus tertentu : gangguan perasaan atau penglihatan. gangguan sistem kardiovaskular (jantung dan pembuluh darah). meningitis aseptik. Digoksin. pneumonitis. jantung.berdekatan). Siklosporin. eritema multiform. antikoagulan. reumatisme non artikular & sindroma nyeri pada tulang belakang. sakit kepala. Dianjurkan untuk memonitor secara teratur fungsi hati & hitung darah selama • penggunaan jangka panjang. Interaksi obat : Lithium. • Porfiria. penyakit Crohn. sindroma Lyell. diuretika. Metotreksat. . • Anak berusia lebih dari 14 tahun : 2 tablet.

Catanac 50mg CODE: C18 Harga Per Satuan Terkecil : Rp2. pruritus dan depresi. vertigo. Kadang-kadang peningkatan enzim SGOT. INDIKASI : Sebagai pengobatan jangka pendek untuk kondisi-kondisi akut seperti: Nyeri inflamasi setelah trauma.Diberikan dalam 2-3 dosis terbagi. Nyeri dan inflamasi setelah operasi. Selain anti inflamasi. nyeri dan demam. sakit kepala. Bekerja menghambat biosintesa pros-taglandin yang merupakan faktor terbesar penyebab inflamasi. peptic ulcer. KONTRA INDIKASI : Hipersensitif terhadap diclofenac.400. hidung atau tenggorokan. EFEK SAMPING : Gangguan pada saluran pencernaan. PERINGATAN DAN PERHATIAN : . juga menunjukkan efek analgesik pada nyeri sedang dan berat. seperti terkilir.00 BELI CATANAC KOMPOSISI : Tablet CATANAC 25 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac1 Tablet CATANAC 50 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac FARMAKOLOGI : Kalium Diclofenac merupakan anti inflamasi yang bukan golongan steroid. Peptic ulcer. PABRIK Novartis. SGPT. seperti operasi gigi atau tulang. Sebagai ajuvan pada nyeri inflamasi yang berat dari infeksi telinga.

. INTERAKSI OBAT : Bila diberikan bersama produk lain yang mengandung Lithium. Bila diberikan bersama diuretik dan B Bloker. 200mg.Indonesia CELEBREX 100 CODE: C32 Harga Per Satuan Terkecil : Rp7. TAKARAN PEMAKAIAN : Dewasa : 100-150 mg dibagi atas 2-3 kali sehari. sebaiknya dilakukan pemeriksaan fungsi hati dan darah secara periodik. Cholestiramin dan liquid parafin. ETHICA Jakarta .950. Bila diberikan bersama Neomycin. dapat mempengaruhi/mengurangi efek kedua obat ini.00 BELI Celebrex Selekoksib 100 mg. Reg.T. DKL 9806707515B1 HARUS DENGAN RESEP DOKTER SIMPAN Dl TEMPAT SEJUK DAN KERING Dibuat oleh : P.T. gangguan fungsi jantung dan ginjal. Pada pemakaian jangka panjang. SOHO INDUSTRI PHARMASI Jakarta . Kasus ringan dan anak lebih dari 14 th : 75-100 mg dibagi atas 2-3 kali sehari. Tidak dianjurkan untuk wanita hamil dan menyusui.Penderita dengan riwayat gangguan saluran cerna. Cyclosporin atau Digoxin. Reg. Methotrexate. tukak lambung.Indonesia Untuk: P. diclo-fenac akan mempertinggi konsentrasi obat-obat tersebut dalam plasma. akan berkurang absorbsinya. DKL 9806707515A1 Dus 30 tablet CATANAC 50 mg (3 strip @ 10 tablet salut enterik) No. KEMASAN : Dus 30 tablet CATANAC 25 mg (3 strip @ 10 tablet salut enterik) No.

pasien penderita asma. Dosis : Osteoartritis:1x sehari 200 mg atau 2z sehari 100 mg. Cetalgin Harga Per Satuan Terkecil : Rp850.. Perihal : Dapat menyebakan intoksikasi saluran cerna. Kemasan : Dos 3x10 kapsul 100 mg.Indikasi: penobatan ostoeartritis dan artritis rematoid. artritis reumatoid 2x sehari 100200 mg.00 BELI CETALGIN-T KOMPOSISI : Na Metamizol 500 mg . Efek samping : Intoksikasi saluran cerna. Kontra Indikasi : Hipersensivitas. jangan diberikan pada wanita hamil karena dapat menyebabkan kelahiran prematur. urtikaria. reaksi anafilaktik. intoksikasi kardovaskuler. intoksikasi sistem saraf periferal.

sakit pinggang.Vitamin B1 Vitamin B6 Vitamin B12 Kafein INDIKASI : 60 mg 15 mg 15 mg 50mg Sakit kepala. perdarahan lambung-usus. rasa sakit/nyeri yang berkaitan dengan penyakit lainnya. KEMASAN : Kaplet 10 x 10 biji. PENYAJIAN : Dikonsumsi bersamaan dengan makanan PABRIK: Soho Cetalmic 500 mg CODE: C19 Harga Per Satuan Terkecil : Rp1. KONTRA INDIKASI : Kelainan perdarahan. Interaksi obat : Klorpromazin. PERHATIAN : Hipersensitif terhadap Aspirin. 1-2 kali sehari &frac12-1 kaplet.00 BELI CETALMICT . agranulositosis. EFEK SAMPING : Reaksi alergi. porfiria.100. neuralgia. DOSIS • Dewasa • Anak berusia 8-12 tahun 3 kali sehari 1 kaplet.

Sebagai analgesik. nyeri setelah operasi dan melahirkan. sakit gigi. anti inflamasi dan antipiretik. nyeri otot. hemolotik anemia. perdarahan lambung. rhinitis alergi atau mendapat obat non steroid anti inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. diare. nyeri trauma. Jangan digunakan pada wanita hamil/menyusui.KOMPOSISI : • CETALMIC® 250 kapsul Tiap kapsul mengandung asam mefenamat 250 mg • CETALMIC® 500 kaplet salut selaput Tiap kaplet mengandung asam mefenamat 500 mg FARMAKOLOGI : CETALMIC® mengandung asam mefenamat yang mempunyai khasiat analgesik. INDIKASI : Untuk menghilangkan berbagai rasa sakit dan nyeri dari ringan sampai sedang termasuk sakit kepala. penderita asma. pusing. penderita yang hipersensitif. KONTRA INDIKASI : Penderita tukak lambung/usus. waktu paruh dalam plasma adalah 3-4 jam. Juga sebagai antipiretik pada keadaan demam. Asam mefenamat terikat sangat kuat pada protein plasma. EFEK SAMPING : Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. muntah. nyeri haid. Keamanan pada anak-anak dibawah 14 tahun . agranulasitosis. Kira . asam mefenamat merupakan satu-satunya derivat fenamat yang memiliki daya kerja baik central maupun perifer. Asam mefenamat cepat diabsorpsi.kira 50% diekskresi dalam urine dan 20% ditemukan dalam faeces. kadar puncak tercapai setelah 2 jam. penderita ginjal. PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma.

angioedema or exacerbation of nasal polyps. TAKARAN PEMAKAIAN : Dewasa dan anak di atas 14 tahun : Dosis awal 500 mg. rhinitis. dilanjutkan 250 mg tiap 6 jam. Sebaiknya diberikan pada waktu makan.00 BELI INDICATIONS CYBUFEN is indicated for acute and long-term use in the relief of signs and symptoms of osteoarthritis and rheumatoid arthritis. 10 strip @ 10 kaplet salut selaput DKL 9224209509A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH SUHU 30°C TERLINDUNG DARI CAHAYA PT SOHO INDUSTRI PHARMASI JAKARTA-INDONESIA Cybufen 300mg Harga Per Satuan Terkecil : Rp5. CYBUFEN should not be given to patients in whom aspirin or other nonsteroidal anti-inflammatory drugs have induced an asthmatic syndrome. 10 strip @ 10 kapsul DKL9224209401A1 • CETALMIC8 500 mg kaplet salut selaput Box.050.00 BELI Danalgin Metampiron Diazepam . urticaria.belum diketahui dengan pasti. Due to the possibility of cross sensitivity. KEMASAN : • CETALMIC® 250 mg kapsul Box.350. CYBUFEN may also be used for other painful inflammatory conditions CONTRAINDICATIONS CYBUFEN should not be used in patients who have exhibited hypersensitivity during previous administration. Danalgin CODE: C20 Harga Per Satuan Terkecil : Rp1. Jangan digunakan lebih dari 7 hari kecuali atas petunjuk dokter. CYBUFEN is also contraindicated in patients with active peptic ulcer.

usia lanjut dan penderita dengan gangguan hati yang berat. Peringatan dan perhatian : Jangan mengemudikan kendaraan atau menjalankan mesin selama minum obat ini. Depresi pernapasan. Penderita dengan tekanan darah sistolik < 100 mmHg. Bayi dibawah 6 buian. Karena dapat menimbulkan agranulositosis yang berakibat fatal. Keadaan psikosis akut. Wanita hamil dan menyusui. serebelum. Glaukoma sudut sempit. tetapi metabolit aktif yang dominan yaitu desmetil diazepam mempunyai waktu paruh 30 -100 jam. sistem limbik dan korteks serebral. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada .Komposisi : Tiap kaplet mengandung : Metampiron 500 mg Diazepam 2 mg Farmakologi : DANALGIN bekerja sebagai anatgetik dan tranquillizer. diabsorpsi dari saluran pencernaan dan mempunyai waktu paruh 1 . sakit punggung. Indikasi : Untuk meringankan rasa sakit sedang sampai berat terutama nyeri kolik dan sakit setelah operasi dimana dipehukan kombinasi dengan tranquillizer. Kontra indikasi : Penderita hipersensitif. Ttdak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. gangguan fungsi hati atau ginjal. lumbago. bursitis. Diazepam dimetabolisme terutama di hati dan terikat pada reseptor di daerah spinal cort. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/ kelainan darah. Konsentrasi plasma puncak diazepam dicapai setelah 15 . Mempunyai aktivitas sebagai ansiolitik dan hipnotik.19 menit. Waktu paruh diazepam dan desmetil diazepam biasanya meningkat pada neonatus. Gangguan pulmoner akut. Waktu paruh bervariasi antara 20-70 jam.4 jam. Metampiron bekerja sebagai analgetik. sindroma bahu-lengan. maka sebaiknya tidak digunakan dalam jangka panjang terus menerus.

maksimum 4 kaplet sehari.- penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. ataksia. Hati-hati penggunaan pada penderita depresi berat atau yang mempunyai kecen-derungan melakukan bunuh diri. Dosis : Jika sakit 1 kaplet. Mengantuk. Reg. Reg. : DPL8804405304A1 Kotak berisi 50 strip x 10 kaplet. jaundice. : DPL8804405304A1 Simpan pada suhu kamar (maks. mual. Obat ini dapat menyebabkan kelemahan otot dan ketergantungan secara fisik dan psikologis. 30°C). Reg. No. No.250. halusinasi dan gangguan tidur. depresi. Kemasan: Kotak berisi 10 strip x 10 kaplet. dipiopia. retensi urin. konstipasi. No. Agranulositosis. Efek samping : Reaksi hipersensitivitas : reaksi pada kulit misal kemerahan. tremor. : DPL8804405304A1 Kaleng berisi 500 kaplet. perubahan libido. vertigo. : DPL8804405304A1 Botol berisi 75 kaplet. JAKARTA-INDONESIA Datan forte CODE: C21 Harga Per Satuan Terkecil : Rp1. Reg. HARUS DENGAN RESEP DOKTER DANKOS PT DANKOS FARMA. No. hipotensi. Hentikan pengobatan jika terjadi reaksi-reaksi paradoksikal seperti keadaankeadaan hipereksitasi akut. ansietas. berikutnya 1 kaplet tiap 6-8 jam. keleiahan. Interaksi obat: Penggunaan bersama obat-obat depresan SSP atau alkoho! dapat meningkatkan efek depresan.00 BELI DATAN®KapIet ASAM MEFENAMAT .

Farmakologi : DATAN dengan zat aktif Asam Mefenamat. DOSIS : .Iritasi lambung jarang terjadi dan dapat dikiirangi dengan menelannya bersama makanan. nyeri sehabis operasi dan melaliirkan. Sekitar 50 % dari dosis yang diberikan akan diekskresikan melalui urine dalam bentuk inetabolit terkonyugasi dalam waktu 48 jam. Tiap kaplet DATAN forte mengandung 500 mg Asam Mefenamat. keseleo. .kolik usus.Keamanan penggunaan DATAN pada wanita hamil belum diketahui.nyeri otot. sakit kepala dan sakit gigi. EFEK SAMPING : Pada beberapa orang dapat menyebabkan iritasi lambung.000 mg atau lebih perhari dan merupakan indikasi untuk menghentikan pengobatan.Komposisi : Tiap kaplet DATAN mengandung 250 mg Asam Mefenamat.diare. . liipersensitif.seperti : nyeri karena trauma. nyeri sendi. . Kontraindikasi : Penderita tukak lambung dan usus. . DATAN dapat diabsorbsi dengan baik oleh saluran pencernaan. renal disease. Indikasi : Menghilangkan segala macam rasa nyeri baik akut maupun kronis.Efek samping adalah minimal pada dosis yang dianjurkan. nyeri sewaktu haid. Kadar maksimal dalam darah akan tercapai dalam waktu 2 jam setelah pemberian.Diare dapat terjadi pada penggunaan jangka panjang yang terus menerus dengan dosis 2. Peringatan dan perhatian : .mual dan sakit kepala.Keamanan pada anak di bawah usia 14 tahun belum terbukti. mempunyai daya kerja sebagai analgetik yang kuat dengan disertai efek anti inflamasi dan antipiretik.

... Reg.... No.. Kemasan : Kaplet DATAN : Dus berisi 10 strip @ 10 kaplet. Kaplet DATAN forte: Dus berisi 10 strip @ 10 kaplet.. No.. HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT PYRIDAM FARMATbk. Cianjur-lndonesia Dentacid 500 Harga Per Satuan Terkecil : Rp1. DKL8921004104B1 Penyimpanan: Simpanlah di tempat yang sejuk (15-25 * C) dan kering. 500 mg Cara kerja obat Asam mefenamat merupakan kelompok antiinflamasi non steroid.100.kemudian dilanjutkan dengan 250 500 mg setiap 6 jam. Reg.. DKL8921004I04A1. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase .00 BELI DENTACID™ Komposisi Tiap kaplet mengandung Asam mefenamat .Dewasa: Dosis awal yang dianjurkan adalah 500 mg...

penglihatan kabur dan insomnia. Efek samping Sistem pencernaan: mual. trombocytopenia dan agranulocytopenia.Pasien yang hipersensitif terhadap asam mefenamat. antiinflamasi dan antipiretik. Indikasi Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala. muntah.Sebaiknya diminum sesudah makan. . termasuk nyeri karena trauma. pusing. . dismenore primer. kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. sakit gigi.Penderita dengan tukak lambung dan usus. eosinophilia.Keamanan penggunaan pada anak .Penderita yang dengan asetosal mengalami bronkospasme.Penderita dengan gangguan ginjal yang berat. nyeri ototdan nyeri sesudah operasi. Dosis Dewasa dan anak-anak ± 14 tahun: Dosis awal 50 mg. Peringatan dan perhatian . Sistem hematopoetik: leukopenia. Kontraindikasi . alergi rhinitis dan urtikaria. .anak dibawah 14 tahun belum diketahui dengan .sehingga mempunyai efek analgesik. Sistem saraf: rasa mengantuk. .Hati-hati jika digunakan pada wanita hamil dan menyusui. . diare dan rasa sakit pada abdominal.

Overdosis Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbo absorben) untuk menyerap obat. Lindungi dari cahaya.pasti. Kemasan Dus isi 10 strip x 10 kaplet HARUS DENGAN RESEP DOKTER. Penyimpanan Simpan pada suhu kamar (di bawah 30°C).: DKL0704426004A1 Diproduksi oleh: PT. Interaksi obat Penggunaan bersamaan dengan antikoagulan oral dapat memperpanjang "prothrombin".Indonesia . No. HEXPHARM JAYA Cipanas . Reg.

Seperti obat-obat antiinflamasi nonsteroid lainnya. tendinitis. dimana diklofenak diabsorpsi dengan oepat. osteoartritis. Dengan demikian.4 jam. DIVOLTAR® merupakan penghambat prostaglandin sintetase. dan penyakit pirai akut.Indonesia Dipasarkan oleh: PT KALBE FARMA Tbk. bursitis. Diklofenak mengalami metabolisme lintasan pertama dalam hati. salah urat. 2. Obat ini 99. Bekasi . ankilosing spondilitis. termasuk bentuk juvenil. 3. DIVOLTAR" hancur dan melarut langsung dalam usus halus. dan dislokasi.2 jam. Kadar puncak dalam plasma dicapai setelah 1 .Indonesia Divoltar 50mg CODE: C22 Harga Per Satuan Terkecil : Rp1.Untuk: PT. Diklofenakdimetabolisme hampir sempurna dalam hati: ekskresi obat yang utuh melalui ginjal kurang dari 1%. Penyakit reumatik inflamatoar dan degeneratif: artritis reumatoid.7% terikat pada protein plasma dan waktu paruh eliminasinya 1 . .00 BELI DIVOLTAR® Diklofenak natrium tablet salut enterik Komposisi : Tiap tablet salut enterik mengandung : Diklofenak natrium 25 mg atau 50 mg Farmakologi : DIVOLTAR® adalah obat antiinflamasi nonsteroid dengan struktur kimia yang baru (suatu derivat asam asetat).500. tenosinovitis. Menghilangkan/mengurangi rasa nyeri dan inflamasi nonreumatik. DANKOS FARMA Jakarta . Kelainan muskulo-skeletal akut: periatritis. analgesik dan antipiretik yang kuat. Sebagai tablet salut enterik. iritasi lambung dikurangi. Indikasi : 1. Obat ini mempunyai sifat antiinflamasi.

jantung atau ginjal yang parah. Leukopenia.3 mg/kg sehari. dibagi dalam 2 . Anak 1 tahun atau lebih :1 . 2. dan anemia aplastik dapat juga terjadi. Reg. Reaksi kulir. . retensi cairan dan peningkatan serum transaminase kadang-kadang terjadi. penderita usia lanjut (lebih mudah mengalami efek samping obat-obat antiinflamasi nonsteroid). nausea dan diare.3 dosis. Penderita yang mendapat pengobatan jangka panjang dengan DIVOLTAR®. 3. hati dan hitung darah). harus dimonitor sebagai tindakan berjaga-jaga (mis.3 dosis. seperti halnya dengan obat-obat antiiflamasi nonsteroid lainnya. DKL8811606917B1 PT KALBE FARMA Tbk. Gunakan dengan hati . Hipersensitivitas terhadap diklofenak. Tablet harus ditelan seluruhnya sewaktu makan atau setelah makan. gagal ginjal dan sindroma nefrotik juga terjadi. penderita dengan insufisiensi hati.Kontra indikasi : 1. trombositopenia. Bila ini terjadi. Peringatan dan perhatian : 1. Userasi dan perdarahan saluran cerna. DIVOLTAR® harus dihentikan. DKL8811606917A1 Dos isi 5 strip x 10 tablet salut enterik. Ulkus peptikum atau perdarahan saluran cerna. 2. 3. No. fungsi ginjal. No. 4. Efek samping ini biasanya ringan. nyeri kepala atau pusing. Untuk terapi jangka panjang. hepatitis. Efek samping: Pada awal pengobatan. dibagi dalam 2 . sendawa. Kemasan : Tablet 25 mg : Tablet 50 mg : Dosisi 5 strip x 10 tablet salut enterik. DIVOLTAR® tidak boleh diberikan selama kehamilan kecuali bila mutlak diperlukan. ikterus. tetapi sangat jarang. dapat terjadi nyeri epigastrium. atau rinitis akut bila mendapat asetosal atau obat-obat antiinflamasi nonsteroid lainnya. dosis biasanya 75 -100 mg sehari. Penderita asma yang mengalami serangan asma. urtikaria.hati pada: penderita dengan gangguan saluran cerna atau dengan riwayat ulkus peptikum. DIVOLTAR® dapat meningkatkan kadar plasma lithium atau digoksin. Dosis dan cara pemberian Dewasa : Dosis awal 75 -150 mg sehari. Reg.

Kontra indikasi: Jangan diberikan kepada penderita yang hipersensitif terhadap ibuprofen atau penderita dengan sindroma polip hidung.Indonesia Lindungi dari cahaya.2.00 BELI DOFEN® 200 DOFEN® FORTE Tablet salut selaput DOFEN adalah tablet bersalut selaput (film coat) yang mempunyai khasiat sebagai analgetika-antipiretika dan antiinflamasi.9 . dibagi dalam beberapa dosis. Untuk anak yang bobot badannya kurang dari 30 kg.6 .4 gram sehari. sakit kepala atau vertigo. dibagi dalam beberapa dosis. 20 mg/kg bobot badan sehari. Dofen Forte 400mg CODE: 121 Harga Per Satuan Terkecil : Rp400. . Komposisi: DOFEN® 200 Tiap tablet salut selaput mengandung: Ibuprofen DOFEN® FORTE Tiap tablet salut selaput mengandung: Ibuprofen Indikasi: Reumatik artritis. maksimum diberikan sebanyak 500 mg sehari. serta reaktivitas bronkospastik terhadap asam asetilsalisilat atau antiinflamasi non steroid lainnya. HARUS DENGAN RESEP DOKTER. Efek samping: Efek samping yang biasa timbul adalah gangguan saluran cerna. Dosis penunjang 0. angiodema.1. osteoartritis dan gout artritis. Simpan pada suhu kamar (di bawah 30°C).Bekasi . Rasa nyeri ringan sampai sedang dan rasa nyeri pada waktu haid.2 gram sehari. Atau menurut petunjuk dokter. Dosis : Dewasa : Anak-anak : 200 mg 400 mg 0.

Pada dosis yang berlebihan dapat terjadi gejala saluran cerna dan gejala susunan saraf pusat.3 ampul/hari selama 1 . pruritus. Pada penderita dengan riwayat penyakit saluran cerna bagian atas perlu dilakukan pengawasan yang ketat. DKL8505001617B1 HARUS DENGAN RESEP DOKTER. BAMBANG UTOYO 138 PALEMBANG-INDONESIA Dogmatil CODE: C23 Harga Per Satuan Terkecil : Rp3. TERLINDUNG DARI CAHAYA. . Hati-hati bila digunakan pada penderita dengan gangguan fungsi ginial dan perlu dilakukan monitor yang ketat. Tidak boleh digunakan pada penderita yang diketahui hipersensitif terhadap aspirin atau antiinflamasi non steroid lainnya Hati-hati bila digunakan pada penderita dengan kelainan faktor intrinsik untuk pembekuan darah. Dibuat oleh: DEXAMEDICA JL.Juga dapat menimbulkan ruam kulit.2 minggu.00 BELI DOGMATIL SULPIRIDE 3 bidang pengobatan utama : ITUKAK SALURAN PENCERNAAN PSIKIATRI VERTIGO ■ Tukak saluran pencernaan Pengobatan pada waktu serangan : 2 .650. Kemasan dan Nomor Registrasi: DOFEN 200 : Kotak. Terapi penunjang : 3 kapsul @ 50 mg/hari selama 3 minggu. Peringatan dan perhatian: Hati-hati bila digunakan pada penderita dengan riwayat dekompensasi jantung atau hipertensi. 10 strip @ 10 tablet. gangguan fungsi ginjal tetapi ini jarang terjadi. SIMPAN PADA SUHU DI BAWAH 30°C. DKL8505001617A1 DOFEN FORTE: Kotak. 10 strip @ 10 tablet.

• Kelainan psikofungsionil • Kelainan tingkah laku yang ringan. dibagi dalam beberapa dosis. • Kelainan tingkah laku yang berat. keadaan delusi 2 . dibagi dalam beberapa dosis. Reg./hari. D 6015158 .b. Tidak mempengaruhi sistim neurovegetative. Reg./hari. EFEK SAMPING : Kadang-kadang dapat menyebabkan gangguan siklus menstmasi atau efek extra pyramidal ringan yang mudah hilang. Reg. • Depresi pada geriatrik. ■ Kelainan psikiatri utama Pengobatan pada waktu serangan : • Psikosa akut dengan gejala-gejala 3 . remaja Anak-anak : 10 mg/kg b. dibagi dalam beberapa dosis. dibagi daTam beberapa dosis. Dewasa : 2 . dan keadaan pra-psikosa. kebingungan. • Neurosa dengan harnbatan psikomotor.4 minggu. TOLERANSI : Pada terapi jangka panjang atau pada pengobatan ulangan tidak menimbulkan adiksi. No. • Depresi karena berbagai sebab. delusi. Kewaspadaan tetap terpelihara bahkan sering kali meninggi.6 ampul/hari. • Sindroma post gegar-otak. ■ Vertigo karena berbagai sebab 3.b. D 6015425 -Kapsul dalam strip berisi 20 dan 100 @ 50 mg.4 kapsul @ 50 mg/hari. • Keadaan depresi yang reaktif. • Psikosa pada masa anak-anak. (waham) kronis. D 7811131 -Ampul 6 @ 100 mg/2 ml No.4 tablet @ 200 mg/hari. Tanpa kontraindikasi maupun incompatibility. Anak-anak : 5 -10 mg/kg b. halusinasi.Terapi lanjutan : 1 . KEMASAN: Tablet dalam strip berisi 20 @ 200 mg (khusus pemakaian psikiatri) No. Terapi penunjang per oral: • Skizofrenia akut.6 kapsul/hari.3 kapsul/hari selama 3 .

Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg INDIKASI : Untuk mengatasi nyeri berat.JAKARTA. Disamping itu juga bekerja pada reseptor monoaminergik di susunan saraf pusat.PARIS . . TERLINDUNG DARI CAHAYA Tablet dan Kapsul di produksi oleh : PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Injeksi diproduksi oleh : PT ETHICA. dengan sifatnya sebagai agonis partial pada reseptor opioid (reseptor U) yang berperan pada efek analgesik. noradrenaline pasca sinaptik dan memblok reseptor serotonergik.450. baik akut maupun kronik serta nyeri setelah operasi.00 BELI Dolana KOMPOSISI : Setiap Kapsul mengandung : Setiap Suppositoria mengandung : Setiap 1 mL Larutan injeksi DOLANA 50 mg mengandung : Setiap 2 mL Larutan injeksi DOLANA 100 mg mengandung : CARA KERJA OBAT : Tramadol HCl adalah analgesik yang bekerja sentral. untuk PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Dengan lisensi dari DELAGRANGE. SESIF .FRANCE DELAGRANGE Dolana Kapsul CODE: C122 Harga Per Satuan Terkecil : Rp3. preparat hipnotik.SIMPAN Dl BAWAH SUHU 30°C. KONTRA INDIKASI : Intoksikasi akut bila digunakan bersama dengan alkohol. memperkuat efek analgesik Tramadol HCl namun dengan efek samping opioid yang minimal. Dengan menghambat "reuptake".

Dispepsia obstipasi. gangguan fungsi ginjal dan hati yang berat atau hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok (renjatan ) Dapat terjadi penurunan fungsi paru-paru apabila penggunaan tramadol dikombinasi dengan obat depresi SSP lainnya atau bila melebihi dosis yang dianjurkan.1 % tramadol diekskresikan melalui ASI.- analgesik atau obat-obat lain yang bekerja pada susunan saraf pusat. peningkatan tekanao intrakranial. mulut kering dan lelah. INTERAKSI OBAT : Dengan obat-obat yang bekerja pada susunan saraf pusat seperti Trankuilizer. Meskipun termasuk antagonis opiat. Hendaknya tidak diberikan selama serangan asma bronkial atau kegagalan jantung sekunder sampai penyakit. Pertimbangkan manfaat dan resiko yang mungkin terjadi bila digunakan pada wanita hamil dan menyusui karena 0. PERINGATAN DAN PERHATIAN : Tramadol tidak boleh digunakan pada penderita ketergantungan obat.00 BELI Dolfenal . pusing. tramadol tidak dapat menekan gejala "withdrawal" akibat pemberian morfin. paru-paru kronik EFEK SAMPING Berkeringat. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi tramadol dengan cepat. Hati-hati bila digunakan pada penderita trauma kepala.000. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. Penderita dengan depresi pernapasan terutama jika ada cyanosis dan sekresi bronkial yang berlebihan. pruritus. DOLFENAL CODE: C33 Harga Per Satuan Terkecil : Rp1. Penderita yang hipersensitif terhadap tramadol atau opiat. Tramadol HCl tidak boleh diberikan pada pasien yang menerima MAO Inhibitors. kemerahan. Pada penderita dengan gangguan fungsi ginjal / hati perlu dilakukan penyesuaian dosis. hipnotik maka efek sedasi/kelelahan kemungkinan meningkat. mual. muntah. Penderita yang mendapat pengobatan penghambat MAO. sedasi. sakit kepala.

. Kontra indikasi : Tukak/inflamasi saluran cerna.mengantuk.pusing. Efek samping : Gangguan saluran cerna. Dolika Kapsul CODE: C123 Harga Per Satuan Terkecil : Rp2. hipersensivitas.perdarahan saluran cerna.reaksi kulit. de3hidrasi.sakit kepala. peradangan.Asam mefenamat 500 mg.700. Perihal : tukak lambung. Dosis : 4x sehari : Kemasan : Dos 100 tablet. asma.nefropati.diskrasia darah.00 BELI DOLIKA INJEKSI / KAPSUL KOMPOSISI Tiap ml Dolika 50 Injeksi mengandung : Tiap ml Dolika 100 Injeksi mengandung : Tiap kapsul mengandung : Tramadol HCI Tramadol HCI Tramadol HCI 25 mg 5 mg 50 mg Dewasa dan anak >14 tahun : kemudian 250 mg.gangguan penglihaan. kerusakan hati dan ginjal. Indikasi : nyeri.

perlu dilakukan penyesuaian dosis. INDIKASI Nyeri akut dan kronik berat. Pada penderita dengan gangguan fungsi ginjal atau hati. Apabila masih terasa nyeri. kemungkinan terjadinya ketergantungan tidak dapat disingkirkan.60 menit. Lama pengobatan : Pada pengobatan Dolika jangka panjang. EFEK SAMPING . biasanya diberikan dalam bentuk injeksi DOSIS PEMAKAIAN Dosis yang diberikan sebaiknya disesuaikan dengan intensitas nyeri Bila tidak ada petunjuk lain dari dokter. Nyeri akibat tindakan diagnostik. Karenanya dokter harus menetapkan lamanya pengobatan. atau bila pengobatan perlu dihentikan sementara. Dolika tidak boleh diberikan lebih lama daripada yang diperlukan. Dosis harian sebesar 400 mg/hari jangan dilampaui. dapat ditambahkan injeksi 1 ml Dolika atau 1 kapsul Dolika setelah selang waktu 30 .CARA KERJA OBAT Tramadol HCI merupakan Non-Opioid Analgetika yang bekerja pada reseptor opioid. dosis Dolika yang diberikan adalah sebagai berikut : Dosis untuk orang dewasa dan anak umur di atas 14 tahun : DOLIKA KAPSUL : Dosis tunggal : 1 kapsul Dosis harian : sampai 8 kapsul Dosis tersebut biasanya cukup untuk meredakan nyeri. Nyeri pasca operasi.

CARA PENYIMPANAN Jauhkan dari jangkauan anak-anak.- Sama seperti analgesik sentral lainnya. muntah. efek samping berikut dapat terjadi pada pengobatan Dolika : mual. analgesik atau obat-obat yang mempengaruhi SSP lainnya.00 BELI DOLO FENAC iniamme Monomtrate + Lyanocobalamin Vitamin Neurotropik + NSAID Komposisi : Setiap tablet salut enterik mengandung: . INTERAKSI OBAT Penggunaan injeksi Dolika bersama dengan obat-obat yang bekerja pada SSP (seperti tranquiliser. hipnotika) dapat meningkatkan efek sedasinya.100. Dolo fenac CODE: C24 Harga Per Satuan Terkecil : Rp3. hipnotika. dispepsia. Penderita yang mendapat pengobatan penghambat MAO. kulit kemerahan. Simpan di tempat kering dan sejuk. berkeringat. obstipasi. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi Tramadol dengan cepat. lelah. pusing. Meskipun tramadol berinteraksi dengan reseptor opiat. sedasi. mulut kering dan sakit kepala. sampai sekarang terbukti insidens ketergantungan setelah penggunaan Dolika jarang dijumpai. KONTRA INDIKASI Intoksikasi akut dengan alkohol. Penderita yang hipersensitif terhadap tramadol atau opiat. terhindar dari cahaya. pruritus. Sebaliknya penggunaan tramadol bersama dengan tranquiliser juga dapat meningkatkan efek analgesiknya.

dalam tubuh dikonversi menjadi bentuk aktifnya thiamin pirofosfat yang merupakan koenzim pada reaksi dekarboksilasi asam aketo. efektivitas dan banannya belum diketahui. Obat ini harus diberikan dengan hati-hati pada pasien dengan gangguan ginjal. berfungsi terutama dalam metabolisme protein dan asam amino. pemberian Diclofenac bersama NSAID lainnya tidak direkomendasikan.pada pasien dengan dehidrasi. Dosis dan Pemberian Tiga tablet per hari.OiclofenacSodium Pyridoxol HCI Thiamine Mononitrate Vitamin B12 Mekanisme Kerja : 50 mg 50 mg 50 mg 1 mg Diclofenac merupaKan obat anti inflamasi non steroid. Pada anak. lebih baik setelah makan. Efek anti inflamasi serta efek farmakologis lainnya berhubungan dengan efek penghambatan sintesa prostaglandin. Pasien dapat diobati dalam waktu lama iika diperiukan sesuai anjurandokter. Perhatian : Diclofenac dapat menyebabkan retensi cairan.s diperiukan dalam sintesis asam nukleat dan mielin. mempunyai efek sebagai anti rematik. dengan demikian mempengaruhi pematangan sel dan memelihara keutuhan jaringan syaraf. Untun oengobatan inflamasi dan penyakit-penyakit rematik degeneratif. edema. anti inflamasi analgesik. dan gangguan koagulasi pada pasien dengan penyakit kardiovaskular atau hipertensi. Perhatian atau larangan penggunaan selama hamil dan menyusui : . Pyridoxol HCI di dalam tubuh diubah menjadi pyridoxol fosfat. hati dan jantung penderita usia lanjut. Indikasi : Meringankan rasa sakitsedangsampai beratyangdisertai neuritisdan/atau neuralgia. yang merupakan koenzim reaksi karboksilasi dan transaminasi. akan meningkatkan resiko toksisitas ginjal. Vitamin B. Thiamin penting untuk metabolisme karbohidrat.Penderita dengan luka atau pendarahan pada saluran cerna.

Sistem pencernaan : sakit perut. kondisi sistim pencernaan. Ginjal (kasusjarang): hematuria. Erupsi kulit dan reaksi hipersensitifitas lain yang diketahui disebabkan oleh formulas! ini. .Kadang-kadang terjadi: colitis ulserativa atau Crohn's procto'colitis' gingivostomatitis. reaksi fotosensitif. glositis.kelelahan. mual. erythroderma (exfoliative dermatitis). perdarahan usus. hal ini dihubungkan dengan hipersensitifas yang jarang terjadi. hati dan ginjal harus diteliti terlebih dahulu. eczema. retensi urin. Polycythemia vera. flatulence. Kulit (kasus tersendiri) : vesicular eruptions.Obat tidak boleh digunakan selama kehamilan dan menyusui. mutagenik dan teratogenik dan efek pada fertilitas: Tidak ada bukti efek karsinogenik. diare.Tfitasi psikotik. anoreksia. Sebelum meresepkan obat ini. Pada penghentian pyridoxol. hematemesis ulkus perforasi. disorienteasi.sakit kepala.jarang terjadi : gastroduodenal hemoragik (perdarahan gastro-duodenal). mutagenik dan teratogenik atau efek fertilitas pada studi manusia atau hewan. purpura. Efek samping : Ada laporan tersendiri mengenai reaksi pada pemberian parenteral thiamin dan vitamin B12 untuk jangka panjang.gangguan sensoris dan visuat. ada perbaikan bertahap pada disfungsi neuronal dan pemulihan secara menyeluruh pada pasien-pasienini. gangguan ingatan. insufisiensi renal akut. meskipun studi histopatologik tidak menunjukkan adanya hubungan smdroma tersebut dengan semua tingkatan degenerasi neuronal. diare berdarah. insomma.pusing. konstipasi. alopecia. Pemberian pyridoxol dosis tinggi dapat menyebabkan smdroma neuropati sensoris tertentu. muntah. sindroma Stevens-Johnson toxic epidermal necrolysis.Kasus yang jarang:parestesia. Sistem saraf pusat : dizziness.TJhnifus. proteinuria. Perhatian dan kemungkinan efek karsinogenik. lesi esophagus. dispepsia. gangguan rasa. erythema multiforme.

reaksi anafilaksis. urticaria atau rhinitis yang dipicu oleh asam asetilsalisilik atau derifatnya. Jika pyridoxol diberikan bersama cyclosporine.hemolyticanemia. Vitamin B12 tidak boleh diberikan pada tingkat awal penyakit Leber (atrophl hereditari dari saraf optik). Polycythemia vera.s dan pemberian pyridoxine menurunkan efek samping neuronal dengan penggunaan obat-obat ini. meskipun signifikansinya tidakjelas. Qastroduodenal/peptic ulcer. Darah ( kasus tersendiri) : thrombocytopenia. kadar plasma ada kemungkinan menurun. Pengobatan dengan pyridoxol HCI 200 mg per hari selama satu bulan menurunkan sampai 50% konsentrasi serum phenobarbital dan phenytoin. Pemberian carbidopa dengan levodopa secara bersamaan menghambat efek pyridoxol Pyridoxol HCI tidak boleh diberikan pada dosis lebih tinggi daripada 5 mg per hari pada pasien yang sedanq diobati dengan levodopa saja. dengan atau tanpa penyakit kuning. Kontraindikasi : Hipersensitifitas terhadap obat ini.agranulocytosis. Penggunaan penicillamine yang diperpanjang dapat menyebabkan kekurangan vitamin B. edema. Pyridoxol fosfat menyebabkan dekarboksilasi perifer levodopa sehingga menurunkan efikasi pada pengobatan penyakit Parkinson.aplastic anemia. Cycloserine dan hydralazine adalah vitamin B. .leucopenia. hepatitis.. Hipersensitifitas (kasus jarang) : arterial hypotension. Interaksi : Thiamin dilaporkan berpotensi terjadinya penghambatan neuromuscular.Hati (kasus jarang) : peningkatan aktifitas aminotransferase (glutamic-pyruvic dan glutamic-oxaloacetic transaminases). Pasien yang mengalami bronchial. antagon.

Pasien diobati dengan antikoagulan harus dimonitor dengan ketat Obat-obat antnnflamasi nonsteroid harus dihentikan 24 jam sebelum memulai pengobatan dengan metotreksat untuk mencegah peningkatan plasma cytostatic dan kejadian efektoksik. Prednisone dilaporkan meningkatkan absorpsi vitamin B12 dan sekresi faktor intrinsik pada beberapa pasien dengan anemia pernicious. dan supresi pernafasan.00 BELI DOLO MEGANEURON Kaplet Salut Selaput KOMPOSISI : . Diclofenac menurunkan aktivitas obat-obat diuretik. primidone). harus diperhatikan kemungkinan ini pada saat meresepkan dosis tinggi asam askorbat dengan vitamin B12. Pemberian kloramfenikol dan vitamin B„ secara simultan dapat memperburuk responhemopoietic terhadap vitamin. antikonvulsan (phenytoin' phenobarbital. golongan potasium lepas lambat. asam aminosalisilik dan garamnya. insufisiensi qinial konvulsi. Pengukuran pendukung harus dilakukan untuk mengobati hipotensi.. dan oleh asupan aikohol yang berlebihan selama lebih dan 2 minggu. iritasi gastrointestinal. Asam askorbat dapat menghancurkan jumlah vitamin B12 secara signifikan dan faktor intrinsik dalam kondisi in vitro. tetapi tidak pada pasien dengan gastrectomy parsial atau total Kepentingan klinis dan observas* ini tidak diketahui. Pemberian diclofenac dengan obat-obat lithium-based atau digoxin atau siklosporin atau metotreksat secara simultan dapat menyebabkan peningkatan plasma obat-obat ini. pengobatan pennnjang dan simptomatik harus dilakukan Tidak ada gambaran spesifik mengenai hal itu. Tindakan berikut ini harus dilakukan: bilas lambung dan pemberian charcoal aktif.Absorpsi vitamin B„ di sistim gastrointestinal dapatditurunkan dengan pemberian berikut ini aminoglikosida colchicme. Kemasan : Boks lO blister® lO tablet salut enterik Dolo Meganeuron Harga Per Satuan Terkecil : Rp750. Overdosisatau ingestion taksengaja:Gejala dan Penanganan (Antidot) Tidak ada kasus yang dilaporkan tentang overdosis dengan thiamin atau vitamin B. iritasi pada usus halus oleh kobalt. Pemberian neomycin dan colchicine secara simultan memperburuk absorbs! vitamin B secara oral. Pada kasus intoksikasi akut dengan diclofenac. Neuropathy sensoris dan sindroma neuropati sensoris lainnya yang disebabkan pemberian pyridoxol megadoses akan sembuh dan pulih kembali dengan penghentian pengobatan. Monitoring yang cukup direkomendasikan untuk kasus-kasus ml. Penggunaan antiinflamasi nonsteroid lain secara bersamaan dapat meningkatkan resikoefeksampingvangtidakdiinginkan.

bursitis. Hati-hati dengan penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. Penderita dengan tekanan darah sistolik < 100 mmHg. Pyrldoxine HCl dan Cyanocobalamine dalam dosis besar dapat membantu memelihara fungsi sel-sel saraf. gangguan fungsi hati atau ginjal. Wanita hamil dan menyusui. sindroma bahu-lengan. maka sebaiknya tidak digunakan dalam jangka waktu terus menerus.Tiap Kaplet Salul Selaput mengandung: Methampyrane TniamineHCI Pyridoxine HCl Cyanooobalamine 500 mg 50 mg 100 mg 100 mg FARMAKOLOGI : Methampyrone bekerja sebagai analgesia. sakit punggung. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lama untuk mengatasi rasa sakit akut. Bayi dibawah 6 bulan. Karena dapat menimbulkarragranulositosis yang berakibat fatal. INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia. Thiamine HCl. PERINGATAN DAN PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. KONTRA INDIKASI : Penderita hipersensitif. lumbago. Diabsorpsl dan saluran pencemaan. terutama pada keadaan sakit yang berat. mempunyai waktu paruh 1 -4 jam. .

EFEK SAMPING : Reaksi hipersensitifitas: reaksi pada kulit misal kemerahan. 10 strip @ 10 kaplet salut selaput No.00 BELI DOLOCAP capsul KOMPOSISI : Tiap kapsul mengandung: Tramadol HCI 50 mg FARMAKOLOGI : Tramadol HCI merupakan suatu analgetik opioid.1 Dolocap Harga Per Satuan Terkecil : Rp1.032. .: DKL 9815706509 A1 SIMPAN DITEMPAT YANG SEJUK DAN KERING HARUS DENGAN RESEP DOKTER Produksi: PT.900.INDONESIA R. EMBA MEGAFARMA SEMARANG . Agranulositosis.Reg. DOSIS : 1 Kaplet salut selaput 3 kali sehari KEMASAN : Dus.

vertigo. Pada anak-anak dan bayi dapat terjadi kejang-kejang. dispepsia. . Untuk mengatasi depressi pernapasan dan syok dengan Naloxone HCI. mungkin juga dapat terjadi spasme uterik atau biliary. Dosis tersebut di atas biasanya cukup untuk meredakan nyeri. drowsiness. brandikardia orthostatic. Nyeri pasca bedah. muntah. sembelit. Penderita dengan depressi pernapasan.INDIKASI : • • Digunakan untuk: Nyeri akut dan kronik yang berat. DOSIS : Dosis yang diberikan disesuaikan dengan intensitas nyeri lazimnya : • 1 kapsul sehari (maksimum 8 kapsul per hari). terutama dengan adanya cyanosis. hipnotika. kolaps kardiovaskular. seperti pada golongan analgesik opiat (analgesik sentral) dapat terjadi: mual. palpitasi. muntah. Intoksikasi akut dengan alkohol. confusion. kejang dan depressi pernapasan. kelelahan dan miosis. atau obat-obat analgetik opiat atau obat-obatyang mempengaruhi SSP lainnya. hypotension.60 menit. apabila masih terasa nyeri dapat ditambahkan 1 kapsul setelah selang 30 . hypotermia. Mulut kering. koma. kulit kemerahan. KONTRA INDIKASI: • • • • Penderita yang hipersensitif terhadap Tramadol atau opiat. OVER DOSIS : • • Pada pemberian over dosis dapat terjadi miosis. berkeringat. sodasi. Penderita yang mendapat pengobatan MAO inhibitor. Pada dosis lebih besar dapat menyebabkan depressi pernapasan dan hipotensi dengan kegagalan sirkulasi dan koma. EFEK SAMPING : • • • • Pada dosis normal.

INTERAKSI OBAT : • Efek depressi / sedasi diperkuat dengan adanya obat-obat yang bekerja pada SSP seperti : alkohol. Meskipun termasuk antagonis opiat. kering dan terlindung dari cahaya. KEMASAN : Dos berisi 5 blister® 10 kapsul PENYIMPANAN : Simpanlah di tempat yang sejuk. • Sebaliknya penggunaan Tramadol bersama dengan tranquillizer juga dapat meningkatkan efekanalgesiknya. Tramadol tidak dapat menekan gejala "witdrawal" akibat pemberian morfin. HARUS DENGAN RESEP DOKTER. peningkatan tekanan intra kranial. Hati-hati bila digunakan pada penderita trauma kepala. hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok. Hati -hati pemberian pada ibu menyusui karena 0.1% Tramadol diekskresikan melalui ASI. gangguan fungsi ginjal dan hati yang berat. Keracunan akut lewat mulut dapat diatasi dengan pengosongan lambung. tranquillizer. Oleh karena itu dokter harus menentukan dengan jelas lama pengobatan. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. Dapat terjadi penurunan fungsi paru bila Tramadol digunakan bersama dengan obat-obat penekan SSP lainnya atau bila penggunaan melebihi dosis yang dianjurkan. antidepressan trisiklik dan anestetika. . sedangkan kejang dapat ditekan dengan pemberian Benzodiazepin. Tidak boleh diberikan lebih lama dari petunjuk dokter. Pemberian pada wanita hamil harus dipertimbangkan manfaat dan resiko yang mungkin terjadi. PERHATIAN : • • • • • • • • Tramadol tidak boleh digunakan pada penderita ketergantungan obat. obat-obat hipnotika.• Nalorphine HBr. dapat menyebabkan ketergantungan. Pada pengobatan jangka panjang. Levallorphan tartrat.

nyeri pasca bedah dan persalinan. Dalam waktu 48 jam. demam pada anak-anak dan dewasa. yaitu analog amin asam salisilat.Dolodon CODE: C25 Harga Per Satuan Terkecil : Rp250. Dibandingkan dengan aspirin. DOLODON Suspensi dengan rasa pisang yang enak dan manis disiapkan untuk anakanak dan penderita yang mengalami kesulitan menelan kapsul atau captab. yang mempunyai daya antipiretik dan anatgesik dengan potensi yang sama dengan aspirin dan dengan sedikit daya anti inflamasi. nyeri waktu haid. ± 50 % dari dosis yang diberikan ditemukan kembaii dalam urine. nyeri rematik. FARMAKOLOGI : DOLODON berisi Asam Mefenamat yang merupakan derivat asam antrani-lat. sakit gigi. KONTRA INDIKASI : Penderita tukak lambung .00 BELI DOLODON kapsul * captab * suspensi capsule * captab * suspension KOMPOS1SI : DOLODON 250 Kapsul : DOLODON 500 Captab : DOLODON Suspensi : Tiap kapsul berisi 250 mg Asam Mefenamat Tiap captab mengandung 500 mg Asam Mefenamat Tiap sendok takar (5ml) suspensi mengandung 50 mg Asam Mefenamat. Asam Mefenamat ku-rang menyebabkan terjadinya pendarahan gastrointestinal. Asam Mefenamat diserap dari traktus gastro intestinal dan kadar dalam sirkulasi mencapai puncaknya dalam waktu 2 jam setelah pemberian obat. INDIKASI : Untuk menghilangkan rasa nyeri pada sakit kepaia. terutama dalam bentuk metabolitnya.

No. DKL 8714504033 A1 HARUS DENGAN RESEP DOKTER . kemudian 250 mg setiap 6 jam 6. No. terutama bila digunakan bersama-an antikoagulan koumarin. DKL 8714504104 A1 Botoi isi 60 ml netto Reg. Sebaiknya tidak diberikan pada wanita hamil dan wanita menyusui. DOSIS : Dewasa : Anak-anak : Mula-mula 500 mg.PERINGATAN & PERHATIAN : * * * * * Dapat mengurangi jumiah trombosit. dosis koumarin hams dikurangi. D 7812379 . EFEK SAMPING : * * Dapat menyebabkan iritasi tractus gastro intestinal Skin rash dan diare dapat terjadi dan akan hiiang jika pengobatan dihentikan. PENYIMPANAN : Simpan pada suhu dibawah 30°C. Atau menurut petunjuk dokter. 3 kali se-hari dengan interval 6 sampai 8 jam. No. paling lama 7 hari. Pemberian harap dihentikan setelah 7 hari tidak memberikan hasil. No. D 7812379-1 Dus berisi 10 strip x 10 captab Reg. Hati-hati pada penderita gangguan fungsi hati dan ginjal.5 mg Asam Mefenamat per kilogram berat badan.Botol plastik isi 500 kapsul Reg. SEDIAAN dan KEMASAN : * DOLODON 250 Kapsul : * DOLODON 500 Captab : * DOLODON Suspensi : Dus berisi 10 strip x 10 kapsul Reg. Hati-hati pada penderita asma karena akan memperburuk keadaan.

DOSIS : 3 x sehari 1 kaplet / kapsul . KEMASAN : ( HNA + ) Dos 10 x 10 kapsul Duplopyrin Strip CODE: C111 Harga Per Satuan Terkecil : Rp2.500.00 BELI Duplopyrin KOMPOSISI : Tiap tablet DUPLOPYRIN mengandung : Fenilbutazon 125 mg Etoksibensamid 125 mg Aluminium Hidroksida Gel kering 100 mg Magnesium Trisilikat 5H2O 150 mg .00 BELI DOLOFEN – F Ibu profen 400 mg.Produksi : PT MECOSIN INDONESIA JAKARTA Dolofen-F CODE: C26 Harga Per Satuan Terkecil : Rp500. INDIKASI : Menghilangkan rasa nyeri dan gejala arthritis reumetoid dan osteoarthritis.

Reg. Reg. gouty arthritis. ginjal dan hati. 2815773-1 . juga pada penyakit tiroid dapat terjadi penahanan fungsi sumsum tulang. Disesuaikan dengan usia dan berat badan. tukak lambung. : D. gangguan fungsi ginjal. Atau menurut petunjuk Anak-anak : dokter. INTERAKSI OBAT : Dapat meningkatkan etek tolbutamide dan kumarin. pada suhu kamar (25-30°C) dan terlindung dan bahaya KEMASAN : Kaleng plastik isi 1000 tablet . PERINGATAN & PERHATIAN : Hati-hati penggunaan pada penderita ulkus peptikum. osteo arthritis. hipersensitivitas serta gangguan fungsi jantung. Magnesium Trisilikat dalam bentuk garam magnesium mudah diserap dan bila terjadi gangguan fungsi ginjal dapat menyebabkan keracunan magnesium. No. hati atau kardiovaskuler. : D. KONTRA INDIKASI Hipertensi. Harus berhati-hati pemberiannya pada penderita dengan gastritis. ATURAN PAKAI : Dewasa : 1 tablet 3 kali sehari. 2815773 Dus isi 24 blister @10 tablet . Dapat menghambat absorpsi tetrasiklin dan vitamin-vitamin serta memperlambat absorpsi quinidin. No. ankylosing spondylitis. CARA PENYIMPANAN : Simpan di tempat kering.INDIKASI Penyakit Rheumatik termasuk rheumatoid arthritis.

.. * nyeri dan inflamasi setelah operasi.HARUS DENGAN RESEP DOKTER PT.. ... INDIKASI EFLAGEN diindikasikan : Sebagai pengobatan jangka pendek untuk kondisi akut sebagai berikut: Sebagai adjuvant pada nyeri Inflamasi berat dari Infeksi telinga. * nyeri Inflamasi setelah trauma.250....25 mg/ 50 mg FARMAKOLOGI EFILAGEN mengandung Kalium Diklofenak yaitu suatu anti-inflamasi nonsteroidal CAINS. seperti operasi gigi dan tulang...INDONESIA Eflagen 25 CODE: C112 Harga Per Satuan Terkecil : Rp1. hidung atau tenggorokan.... Secara farmakologi Diklofenak menunjukkan aktivitas anti-inflamasi...00 BELI EFLAGEN Tiap tablet mengandung : Kalium Diklofenak.... Seperti obat-obat AINS yang lain mekanisme kerja belum diketahui........ seperti terkilir........ - KONTRA-INDIKASI Hipersensitivitas terhadap Kalium Diklofenak.. Coronet Crown PHARMACEUTICAL INDUSTRIES SURABAYA . analgesik dan antipiretik. akan tetapi penghambatannya terhadap sintesa prostaglandin (siklo-oksigenase) dapat dikaitkan dengan aktivitas anti-inflamasi..

edema (Jarang). eritema multiformis. telinga berdenging. diare. sakit kepala. palpitasi. DOSIS Dewasa : dosis awal 100 -150 mg/hari dalam 2 . trombositopenia. Lain-lain: hipertensi. Hati: peningkatan enzim SGOT. Saluran pencernaan: dispepsia. muntah. kram perut. EFEK SAMPING Efek samping yang mungkin terjadi pada : nyeri lambung. Pemberian bersamaan dengan metotreksat dapat meningkatkan toksisitas metotreksat. penderita dalam serangan asma. Sistem saraf pusat: pusing. Pemberian bersamaan dengan antikoagulan perinah dilaporkan dapat meningkatkan resiko perdarahan. Pada kasus-kasus sedang dan untuk 75 . Reg. anemia. Pemberian bersamaan dengan diuretik hemat kalium dapat disertai dengan kenaikan kadar kalium dalam darah. urtikarta atau rinitis akut yang ditimbulkan oleh asam asetil salisllat atau obat-obat lain yang menghambat sintesa prostaglandin. leukopenia. anak-anak usia > 14 tahun: tidak boleh diberikan pada anak-anak usia Anak-anak : < 14 tahun. SGPT dan hepatitis (Jarang). nyeri dada.: Dus Isi 5 strip @ 10 tablet DKLV722222015A1 .100 mg / hari. vertigo. impoten. INTERAKSI OBAT Pemberian bersamaan dengan litium atau digoksin dapat meningkatkan konsentrasi litium atau digosin dalam plasma. mual. Kulit: urtikaria. HARUS DENGAN RESEP DOKTER KEMASAN EFLAGEN 35: No. eksim.3 dosis terbagi.- Tukak lambung. agra-nulositosis Darah: (sangat jarang). Pemberian bersamaan dengan AINS sistemik dapat meningkatkan terjadinya efek samping. Ginjal: gangguan fungsi ginjal.

: Dus isi 5 strip @ 10 tablet DKL9722222015B1 . Reg.EFLAGEN 50: No.