Analgesik, antiinflamasi http://www.farmasiku.com/index.php?

target=categories&category_id=171 Analgesik adalah obat yang dapat mengurangi atau menghilangkan rasa nyeri dan akhirnya akan memberikan rasa nyaman pada orang yang menderita. Anti inflamasi adalah obat yang dapat menghilangkan radang yang disebabkan bukan karena mikroorganisme (non infeksi). Gejala inflamasi Inflamasi dapat disertai dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Proses inflamasi meliputi kerusakan mikrovaskuler, meningkatnya permeabilitas vaskuler dan migrasi leukosit ke jaringan radang, dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Mediator yang dilepaskan antara lain histamin, bradikinin, leukotrin, Prostaglandin dan PAF. Penanganan inflamasi 1 2 3 4 5 6 7 Derivat Asam Salisilat à Aspirin, Benorilat, Diflunisal, Salsalat Derivat Asam Propionat à As.Tiaprofenat, Fenbufen, Flurbiprofen, Ibuprofen, Ketoprofen, Naproksen Derivat.As.Fenamat à As.Mefenamat, Meklofenamat Derivat As.Fenilasetat à Diklofenak, Fenklofenak Derivat Oksikam à Piroksikam, Tenoksikam Der.As.Asetat inden/indol à Indometasin, Sulindak, Tolmetin Deriva Pirazolon à Azapropazon, Fenilbutazon, Oksifenbutazon

ABDIFLAM CODE: C29 Harga Per Satuan Terkecil : Rp1,350.00 Abdiflam Natrium diklofenak 25 mg; 50 mg. Indikasi: sakit pasca traumatik inflamatori, inflamasi dan bentuk degeneratif rematik, rematik non artikular. Dosis: Dewasa: awal: sehari100-150 mg dalam dosis terbagi 2-3x; Anak 14th: 75-100 mg sehari dalam dosis bagi 2-3x. Kemasan: 5 x 10 tablet 50 mg.

AFI RHEUMA CODE: C1

Harga Per Satuan Terkecil : Rp2,300.00 BELI AFI RHEUMA KAPSUL KOMpOSISI : Tiap kapsul mengandung : 4 butil 1,2 difenilpirazolidina 3,5 dion ................... 100 mg CARA KERJA OBAT : Sebagai anti radang dan analgetik INDIKASI : Ankylosing spondylitis, acute gouty arthritis, active rheumatoid arthritis. CARA PEMAKAIAN: Dewasa 2-3 kali sehari 1 kapsul, sesudah makan atau diminum dengan susu, seyogyanya sesuai petunjuk dokter. EFEK SAMPING: - Iritasi gastrointestinal (mual, muntah, rasa terbakar pada lambung). - Retensi : Cairan, edema, rash. - Gangguan hematologi yang serius (leukopenia, agranulositopenia, aplastik-anemia). - Alergi INTERAKSI OBAT: Jangan diberikan bersama - sama dengan : Kumarinantikoagulan, insulin, fenitoin, oral hipoglikemik. KEMASAN : Box isi 10 blister @ 12 kapsul Reg. No. DKL 8901700901 A1 Simpanlah obat ini ditempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER Allogon 500 Harga Per Satuan Terkecil : Rp700.00 BELI ALLOGON 500 mg. Komposisi Mefenamic acid/Asam mefenamat INDIKASI Nyeri ringan, sedang sampai berat seperti sakit kepala, nyeri otot, artralgia (nyeri sendi), sakit gigi, osteoartitis rematoid, gout, nyeri saat haid, nyeri setelah operasi, nyeri setelah terjadi patah tulang, nyeri setelah melahirkan, neuralgia (nyeri pada saraf), dan nyeri pada organ-organ dalam perut. KONTRA INDIKASI Gastritis, ulkus lambung, dan anemia hemolitik. PERHATIAN Kehamilan, dehidrasi, epilepsi, asma. Interaksi obat : antikoagulan oral. EFEK SAMPING

Gangguan & perdarahan saluran pencernaan, ulkus peptikum, sakit kepala, gugup, insomnia (sulit tidur), biduran/kaligata, kemerahan pada kulit, pembengkakan wajah. INDEKS KEAMANAN PADA WANITA HAMIL C: Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin. KEMASAN Kaplet 500 mg x 2 x 10 butir. DOSIS Dewasa : 250-500 mg tiap 6 jam sekali. Anak-anak : 6,5 mg/kg berat badan tiap 6-8 jam sekali. Nyeri saat : diawali dengan 500 mg, kemudian 250 mg tiap 6 jam. haid PENYAJIAN Dikonsumsi bersamaan dengan makanan PABRIK Konimex. Analsik CODE: C2 Harga Per Satuan Terkecil : Rp1,150.00 ANALSIK Tiap kaptet mengandung : Metampiron 500 mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. Metampiron adalah suatu obat analgesik- antipiretik. Diazepam mempunyai kerja sebagai antiansietas, juga memiliki sifat relaksasi otot rangka. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral. INDIKASi : Untuk meringankan rasa nyeri sedang sampai berat, ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam. Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg, wanita hamil dan menyusui. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. Glaukoma sudut sempit, keadaan psikosis akut. EFEK SAMPING : Dapat menimbulkan agranulositosis. Reaksi hipersensitivitas, reaksi pada kulit,ngantuk,pusing,lelah yang berlebihan. Konstipasi, depresi, diplopia, hipotensi, jaundice, perubahan libido, mual, tremor, retensi urin, vertigo. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan

Dibuat oleh : PT SANBE FARMA Bandung . Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg. Reg. maksimum 4 kaplet sehari. wanita hamil dan menyusui. karena dapat berakibat fatal. Walaupun jarang menimbulkan agranulositosis.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam. . Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam.bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam. No. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut.30°C).00 ANALSIK Tiap kaptet mengandung : Metampiron 500mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. INDIKASI : Untuk meringankan rasa nyeri sedang sampai berat.Indonesia Analspec CODE: C3 Harga Per Satuan Terkecil : Rp1. lumbago. ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. DOSIS : 1 kaplet.250. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin.sama dengan obat .halusinasi dan gangguan tidur. ansietas. Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut. HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet. INTERAKSI OBAT : Penggunaan bersama . gangguan fungsi hati atau ginjal.- darah/kelainan darah. sakit punggung. sebaik-nya tidak digunakan untuk jangka pahjang. Metampiron adalah suatu obat analgesik. juga memiliki sifat relaksasi otot rangka. Diazepam mempunyai kerja sebagai antiansietas.antipiretik. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral.: DPL8822208609A1. bursitis. sindroma bahu lengan. PENYIMPANAN Simpan pada suhu kamar (25°.

halusinasi dan gangguan tidur. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri. sebaik-nya tidak digunakan untuk jangka pahjang. tremor. No. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. EFEK SAMPING : Dapat menimbulkan agranulositosis. PENYIMPANAN Simpan pada suhu kamar (25°.bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam. keadaan psikosis akut.lelah yang berlebihan. maksimum 4 kaplet sehari. Reg. bursitis.sama dengan obat .Glaukoma sudut sempit.ngantuk. lumbago. jaundice. ansietas. DOSIS : 1 kaplet. Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik.30°C). mual. sakit punggung. Reaksi hipersensitivitas.: DPL8822208609A1.Indonesia Anastan CODE: C4 Harga Per Satuan Terkecil : Rp250.pusing. perubahan libido.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam. reaksi pada kulit. INTERAKSI OBAT : Penggunaan bersama . depresi. HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet. karena dapat berakibat fatal. retensi urin. Dibuat oleh : PT SANBE FARMA Bandung .00 ANASTAN (Mefenamic Acid) 500 mg . diplopia. Konstipasi. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. gangguan fungsi hati atau ginjal. Walaupun jarang menimbulkan agranulositosis. hipotensi. vertigo. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut. sindroma bahu lengan. Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut.

Enteraksi obat : Dengan obat anti coagulant. Komposisi : Tiap kaplet mengandung Acidum Mefenamicum 500 mg (Anastan Forte).00 Antalgin . sakit kepaia. Peringatan dan Perhatian : Dalam pengooatan. Juga dapat timbul kantuk. Posologi : Dewasa dan anak . : Awal 1 kaplet (500 mg) kemudian Vi kaplet (250 mg) tiap 6 Indikasi : Sebagai obat untuk meringankan rasa sakit seperti pada sakit gigi. Hati .anak dibawah 14 tahun belum diketahui dengan pasti. Digunakart tidak lebih dari 7 hari. Harus dengan resep dokter No.hati pada penderita yang mendapat bronkospasma. mengurangi kerja obat anti coagulant. Efek samping : Dapat timbul diare biasa hingga berat.anak diatas 14 tahun : - Anastan forte jam. Cara penyimpanan : Disimpan di tempat tertutup dan diluar pengaruh cahaya. Penderita asma. Reg. Kemasan : Anastan forte : Dos isi 10 strip @ 10 kaplet. Kontra indikasi : Obat kontra indikasi bagi penderita sakit tukak lambung atau inflamasi pada saluran cerna. Mempengaruhi test darah. Tiap kapsul mengandung Acidum Mefenamicum 250 mg. sehingga hemoiytic anemia coombs positif. albuminiea dan kencing darah. aiergik rinrtis atau urticaria karena obat non steroid anti inflamasi yang lain. nervous dan sakit kepala. Dapat timbul agranucytosis. berkhasiat analgesic dan anti inflamasi. sehingga billirubin urine positif dan protein uria positif. terjadi tukak lambung dan pendarahan. bila cfiare maka pengobatan dihentikan. anemia. nausea dezziness. Mempengaruhi test urine. thrombocytopenia. nyeri sesudah operasi dan dysmenorrhoea primer.Anastan adalah obat yang mengandung Acidum Mefenamicum. Keamanan penggunaan pada anak . Wanita mengandung atau sedang menyusui. : Anastan forte DKL 9207802304 A1 Antalgin CODE: C5 Harga Per Satuan Terkecil : Rp150. Juga pada penderita gangguan fungsi ginjal atau pernah menderita sakit ginjal atau hati. Dapat timbul asma. karena kemungkinan terjadi" cross sensitivity".

Peringatan dan Perhatian : Karena dapat menimbulkan agranulositosis yang berakibat fatal. Penderita yang hipersensitif. normal).:GKL9420906010A1 HARUS DENGAN RESEP DOKTER INDO FARMA BEKASI – INDONESIA Antrain CODE: C6 Harga Per Satuan Terkecil : Rp10. Kemasan dan Nomor Registrasi Antalgin 500 mg. Kasus porfiria hati (amat jarang) dan defisiensi bawaan glukosa-6-fosfat-dehidrogenase. Antalgin mudah larut dalam air dan mudah diabsorpsi ke dalam jaringan tubuh.: GKL9420906010A1 Antalgin 500 mg.30°C (kondisi penyimpanan. Penderita dengan tekanan darah <100 mmHg. WanitahamilteTutama^B bulan pertamanaTT6 minggu terakhir. Indikasi : Untuk menghilangkan rasa sakit. maka sebaiknya tidak digunakan terus-menerus dalam jangka panjang. botol 1000 tablet No.Reg. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.INJEKSI© . Pada penggunaan jangka panjang dapat menyebabkan agranulositosis.Komposisi Tiap tablet mengandung antalgin 500 mg.00 ANTRAIN TABLET . Cara Kerja Obat : Antalgin adalah derivat metansulfonat dan amidopirina yang bekerja terhadap susunan saraf pusat yaitu mengurangi sensitivitas reseptor rasa nyeri dan mempengaruhi pusat pengatur suhu tubuh. Kontra indikasi : Pada penderita yang alergi terhadap derivat pirazolon. Cara Penyimpanan : Simpan pada suhu 25° . Dosis dan Cara Penggunaan : Melalui mulut (per oral). terutama kolik dan sakit setelah operasi. Efek Samping : Gejala kepekaan yang manifestasinya kelainan pada kulit. Dewasa : sehari 3 kali 1 tablet.200. antipiretik danantiinflamasi. Reg. Bayi 3 bulan pertama atau dengan berat badandibawah 5 kg. Tiga efek utama adalah sebagai analgesik. kotak 10 blister @ 10 tablet No.

ANAK HARUS DENGAN RESEP DOKTER . Agranulositosis. Penderita dengan tekanan darah sistolik < 100 mmHg.KOMPOSISI : Tiap tablet mengandung : Metamizole Na 500 mg ANTRAINI Injeksi Tiap ml mengandung: Metamizole Na 500 mg CARA KERJA OBAT : Metamizole Na adalah derivat metansulfonat dari aminopirin yang mempunyai khasiat analgesik. atau I. Pada pemakaian jangka lama dapat menimbulkan sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan.sindroma bahu lengan. Karena dapat menimbulkan agranulositosis yang berakibat fatal. INTERAKSI OBAT : Bila Metamizole Na diberikan bersamaan dengan Chlorpromazine dapat mengakibatkan hipotermia.terutama nyeri kolik operasi.:DKL7617611210A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA ANTRAIN* Injeksi Kotak berisi 5 ampul @ 2 ml netto Reg. ATURAN PAKAI : Dewasa: Tablet : 1 tablet jika sakit timbul. INDIKASI : Untuk meringankan rasa sakit.M. gangguan fungsi hati atau ginjal. diberikan secara injeksi I. KONTRA INDIKASI : Penderita hipersensitif terhadap Metamizole Na. Bayi di bawah 3 buian atau dengan berat badan kurang dari 5 kg. EFEK SAMPING : Reaksi hipersensitivitas: reaksi pada kulitmisal kemerahan.lumbago. berikutnya 500 mg tiap 6-8 jam.sakit punggung. No. Metamizole Na bekerja sebagai analgesik.: DKL0117616843A1 JAUHKAN DARI JANGKAUAN ANAK . PERINGATAN / PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. maksimum 3 kali sehari. diabsorpsi dari saluran pencernaan mempunyai waktu paruh 1-4 jam. Wanita hamil dan menyusui.bursitis.V. Karena itu perlu dilakukan pemeriksaan fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah.No.maksimum 4 tablet sehari. maka sebaiknya tidak digunakan dalam jangka panjang. KEMASAN : ANTRAIN* Tablet Kotak berisi 10 strip @ 10 tablet Reg. berikutnya 1 tablet tiap 6-8 jam. Injeksi : 500 mg jika sakit timbul. Mekanisme kerjanya adalah menghambat transmisi rasa sakit ke susunan saraf pusat dan perifer.

Indikasi : untuk meredakan rasa sakit seperti sakit gigi. asetosal. nyeri saat melahirkan. sakit kepala. No. alergik rinitis. Interbat Jl. ruam makulo papular.SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA JANGAN DISIMPAN DALAM LEMARI PEMBEKU Diproduksi Oleh : PT.M. Indonesia Argesid 500mg Harga Per Satuan Terkecil : Rp1. usus. nyeri karena trauma. kecuali atas petunjuk dokter. Kontra indikasi : Tukak lambung. Hati-hati pemberian pada penderita bronkhospasme. Efek samping : Gangguan saluran cerna seperti iritasi lambung.100. Tidak boleh melebihi dosis yang dianjurkan dan lebih dari 7 hari. Box 10 Strip @10 Kapsul. diare. sakit kepala. vertigo. Interaksi Obat : Obat-obatan antikoagulan oral seperti warfarin. 1 Buduran. Dosis : Dewasa dan anak-anak di atas 14 tahun: Dosis awal 500mg kemudian dilanjutkan 250 mg tiap 6 jam. mual. hipersensitif usus. Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahui. muntah.00 ARGESID Asam Mefenamat KOMPOSISI : ARGESID 250 Tiap kapsul mengandung Asam Mefenamat 250 mg. Mangundiprojo no. Pada penggunaan terusmenerus dengan dosis 2000 mg atau lebih sehari dapat mengakibatkan agranulositosis dan hemolitik anemia. urtikaria atau mendapat pengobatan antiinflamasi non-steroid lainnya. karena dapat terjadi sensitivitas silang. meredakan rasa nyeri seperti nyeri otot. radang gangguan ginjal. kolik. dismenore.R. dispepsia. Peringatan dan Perhatian Tidak dianjurkan diberikan pada wanita hamil dan menyusui. ARGESID 500 Tiap Kaplet salut selaput mengandung Asam Mefenamat 500 mg Farmakologi : Asam Mefenamat merupakan anti inflamasi non-steroid. H. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase sehingga mempunyai efek analgetik dan antiinflamasi. pusing. Reg. nyeri sesudah operasi. Kemasan: ARGESID 250. Sidoarjo-61252 Jawa Timur.: DKL0033201I301A1 ARGESID 500 .

gangguan jumlah sel darah : lekosit.00 Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. PROMEDRAHARDJO FARMASIINDUSTRI Sukabumi – Indonesia Artrilox 15 CODE: C8 Harga Per Satuan Terkecil : Rp7. bersendawa. EFEK SAMPING : Saluran cerna : dispepsia. Anemia. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1. x Anakanak dan remaja yang berumur kurang dari 15 tahun. Insufisiensi hepar yang berat. Masa kehamilan dan menyusui. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). diare. esofagitis. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. jarang terjadi fotosensitisasi. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serumkreatinin dan/atau serum urea. rasa kembung. ulkus gastroduodenal. terutama . Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik). Penghambatan COX2 menentukan efek terapi NSAI. lekopenia dan trombosito penia. Pada kulit : pruritus. Reg.700.: DKL0033201109A1 ( Simpan di tempat sejuk (15-25)°C dan kering ) HARUS DENGAN RESEP DOKTER PROMED PT. Insufisiensi ginjal berat yang tidak didialisa.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. pendarahan gastro-intestinal makroskopik. jarang terjadi kolitis. polip dihidung. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin. rasa mual.konstipasi.5 mg mengandung Meloxicam 7. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. stomatitis. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut. muntah-muntah. urtikaria. Mekanisme kerja meloxicam sebagai efek anti-inflamasi. rasa sakit di perut. ruam kulit. analgesik. Pendarahan gastrointestinal.Box 10 Strip @10 Kaplet No. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma. Bila diberikan bersama-sama dengan obat mielotoksik yang potent. KONTRA INDIKASI : Ulkus lambung yang aktif.

palpitasi. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). Seperti pada obat-obat NSAI. dan pada umumnya orang tua menderita gangguan fungsi ginjal. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. sindrom nefrotik dan penyakit ginjal. nekrosis medularis ginjal. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. Pada pasien tersebut. akan menyebabkan terjadinya sitopenia. trombolitik dapat meningkatkan resiko pendarahan. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. sindrom nefrotik. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. Pemberian bersama ticlopidine (anti-koagulan oral). Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. dosis meloxicam tidak boleh melebihi 7. hati atau jantung. Pada pasien yang volume & aliran darah ke ginjal menurun. peningkatan tekanan darah. tinitus. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. Bila kondisi ini dalam waktu lama. sirosis hati. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. glomerulonefritis. NSAI jarang menimbulkan nefritis interstitial. heparin secara sistemik. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. maka harus dimonitor efek - . Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. Pasien yang beresiko tinggi adalah pasien yang dehidrasi. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. Bila pemberian bersama obat anti koagulan tidak dapat dihindari. INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. dianjurkan untuk menghentikan aktivitas. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. Kardiovaskuler: edema. pusing.methotrexate. Pernafasan : jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. Sistem susunan saraf pusat : kepala terasa ringan. hati ataupun jantung. pasien dengan gagal jantung kongestif. Seperti halnya obat-obat NSAI lainnya. vertigo. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. Seperti hal obat-obat NSAI. muka kemerahan. ngantuk.5 mg/hari.

DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium. Kontrasepsi : menurunkan efektivitas alat KB IUD. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2. 2 Strip @ 10 Tablet No.00 .5 mg per hari.Reg.5 mg/hari. Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7. Tablet harus ditelan dengan air/minuman pada waktu makan. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. Osteoartritis:7. dianjurkan untuk memonitor jumlah sel darah. Artritis reumatoid :15 mg/hari. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker. KEMASAN : Artrilox 7. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari. sehingga akan mempercepat eliminasi meloxicam. Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya.Reg. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi.5 mg/hari tergantung respon klinis.5 mg Tablet Box. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi.5 mg per hari.farmasiku.antikoagulan. Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak. Dosis terapeutik dapat dikurangi sampai 7. ACE inhibitor.com Artrilox 7.DKL9904125810A1 Artrilox 15 mg Tablet Box. vasodilator. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas. Pada pasien yang dehidrasi. sehingga perlu dimonitor fungsi ginjal.5 CODE: C7 Harga Per Satuan Terkecil : Rp4. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal. Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEPDOKTER Diproduksi oleh: COMBIPHAR BANDUNG-INDONESIA http://www.700. 2 Strip @ 10 Tablet No. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate.

rasa kembung. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma. Mekanisme kerja meloxicam sebagai efek anti-inflamasi. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya. x Anakanak dan remaja yang berumur kurang dari 15 tahun. Pendarahan gastrointestinal. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik).5 mg mengandung Meloxicam 7. esofagitis. analgesik. KONTRA INDIKASI : Ulkus lambung yang aktif. Insufisiensi ginjal berat yang tidak didialisa. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. rasa sakit di perut. diare. EFEK SAMPING : Saluran cerna : dispepsia. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. ulkus gastroduodenal. bersendawa. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1. Insufisiensi hepar yang berat. konstipasi. pendarahan gastro-intestinal makroskopik. rasa mual. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serum kreatinin . muntah-muntah.BELI Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. jarang terjadi kolitis.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. polip dihidung. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin. Penghambatan COX2 menentukan efek terapi NSAI. Masa kehamilan dan menyusui. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut.

penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. hati ataupun jantung. NSAI jarang menimbulkan nefritis interstitial. urtikaria. Pernafasan:jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. Seperti hal obat-obat NSAI. Anemia. vertigo. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. sindrom nefrotik. Pasien yang beresiko tinggi adalah pasien yang dehidrasi. Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal.5 mg/hari. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. glomerulonefritis. gangguan jumlah sel darah : lekosit. hati atau jantung.- dan/atau serum urea. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. Pada pasien yang volume & aliran darah ke ginjal menurun. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. ruam kulit. sirosis hati. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. terutama methotrexate. pasien dengan gagal jantung kongestif. tinitus. pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. Bila kondisi ini dalam waktu lama. diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. Sistem susunan saraf pusat : kepala terasa ringan. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. dosis meloxicam tidak boleh melebihi 7. peningkatan tekanan darah. Kardiovaskuler : edema. Pada pasien tersebut. Pada kulit : pruritus. lekopenia dan trombosito penia. muka kemerahan. dianjurkan untuk menghentikan aktivitas. stomatitis. Bila diberikan bersama-sama dengan obat mielotoksik yang potent. palpitasi. sindrom nefrotik dan penyakit ginjal. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. nekrosis medularis ginjal. dan pada umumnya orang tua menderita gangguan fungsi ginjal. ngantuk. jarang terjadi fotosensitisasi. Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. Seperti pada obat-obat NSAI. pusing. Seperti halnya obat-obat NSAI lainnya. - - - - . akan menyebabkan terjadinya sitopenia. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam.

Dosis terapeutik dapat dikurangi sampai 7. . pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut. Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak. Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7. Tablet harus ditelan dengan air/minuman pada waktu makan.5 mg per hari.INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. Kontrasepsi : menurunkan efektivitas alat KB IUD. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium. Artritis reumatoid :15 mg/hari. Osteoartritis:7. Pemberian bersama ticlopidine (anti-koagulan oral). Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi. sehingga akan mempercepat eliminasi meloxicam. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. vasodilator. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker. maka harus dimonitor efek antikoagulan. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas. dianjurkan untuk memonitor jumlah sel darah. ACE inhibitor.5 mg per hari. Bila pemberian bersama obat anti koagulan tidak dapat dihindari. heparin secara sistemik. - - - DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari. sehingga perlu dimonitor fungsi ginjal. trombolitik dapat meningkatkan resiko pendarahan.5 mg/hari. Pada pasien yang dehidrasi.5 mg/hari tergantung respon klinis.

Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN.Reg. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2. KEMASAN : Artrilox 7. 2 Strip @ 10 Tablet No. INDIKASI : . 2 Strip @ 10 Tablet No.Reg.5 mg Tablet Box. POSOLOGI : Dewasa dan anak diatas 14 tahun Dosis awal dianjurkan 500 mg kemudian dilanjutkan250 mg tiap jam sesudah makan. KOMPOSISI : Tiap kapsui mengandung 250 mg Asam mefenamat "Flap kaplet 500 mg salut selaput mengandung 500 mg Asam mefenamat. Kaplet 500 mg.DKL9904125810A1 Artrilox 15 mg Tablet Box. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEP DOKTER Di produksi oleh: COMBIPHAR BANDUNG-INDONESIA Asam Mefenamat Kapsul 250 mg.

No Reg GKL 9830010709 A1 CARA PENYIMPANAN : Simpan ditempat kering dansejuk. No. P. terhindar dari cahaya.T. KEMASAN : Kapsul 250mg : Dus 10 strip® 10 Kapsui . nyeri sendi. muntah.penderita ginjal dan penderita yang hipersensitif.00 BELI ASIMAT 500 . Jangan digunakan lebih dan dosis yang dianjurkan atau lebih dari 7 hari kecuali atas petunjuk dokter.Untuk menghitangkan segala macam nyeri dan ringan sampai sedang dalam kondisi akut dan kronis. diare. PERINGATAN DAN PERHATIAN : Jangan dibenkan pada penderita bronkospasme aliergik rhinitis. sakit kepala dan sakit gigi. urticaria atau mendapat obat non steroid anti-inflamasi yang lain karena kemungkinan terjadi sensitiyitas silang Jangan digunakan pada wanita hamil dan menyusui. pendenta asma. Reg : GKL9930011201 A1 Kaplet 500 mg : Dus 10 strip® 10 Kaplet . nyeri otot. Keamanan penggunaan pada anak-anak dibawah umur 14 tahun belum diketahui dengan pasti. Harus dengan resep dokter. nyeri sewaktu haid.Indonesia Asimat CODE: C10 Harga Per Satuan Terkecil : Rp800. EFEK SAMPING : Umumnya Asam Mefenamat dapat dibenkan dengan baik pada dosis yang dianjurkan. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. PHYTO KEMO AGUNG FARM A Jakarta . termasuk nyeri karena trauma. KONTRA INDIKASI : Pada penderita dengati tukak lambung / usus. sakit sehabis operasi dan melahirkan. pada penggunaan jangka panjang yang terus menerus dengan dosis 2000 mg atau lebih sehan dapat mengakibatkan agranulositosis dan hemolitik anemia.

KONTRA INDIKASI : Pada penderita dengan tukak lambung / usus. muntah dan diare. perdarahan lambung.KOMPOSISI : Tiap kaplet salut selaput ASIMAT500 mengandung Mefenamic Acid 500 mg CARA KERJA : Mefenamic Acid adalah suatu analgetik yang mempunyai daya anti-inflamasi. . sakit sehabis melahirkan. penderita ginjal dan penderita yang hipersensitif terhadap Mefenamic Acid. termasuk nyeri karena trauma. nyeri sewaktu haid. sakit kepala dan sakit gigi. penderita asma. nyeri otot. Agranulositosis dan hemolitik anemia mungkin dapat terjadi pada penggunaan dalam jangka waktu lama yang terus menerus dengan dosis 2000 mg atau lebih sehari. POSOLOGI / DOSIS : Dewasa dan anak-anak > 14 tahun : Dosis oral yang dianjurkan 500 mg kemudian dilanjutkan 250 mg setiap 6 jam jika diperiukan. EFEK SAMPING : Efek samping yang timbul umumnya dapat ditolerir dengan baik pada dosis yang dianjurkan. pusing. INDIKASI : Untuk mengurangi nyeri dari ringan sampai sedang dalam kondisi akut dan kronis. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual.

MERSIFARMATM Sukabumi . No.00 BELI AULIN TABLET 100 MG KOMPOSISI : Tiap tablet mengandung Nimesulide 100 mg URAIAN : . Jangan digunakan lebih dari dosis yang dianjurkan atau lebih dari 7 hah kecuali atas petunjukdokter.PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. terlindung dari cahaya matahari. Jauhkan obat dari jangkauan anak-anak. PENGEMASAN DAN NOMOR REGISTRASI Box. Jangan digunakan pada wanita hamil dan menyusui. Keamanan pengguhaan pada anak-anak di bawah 14 tahun belum diketahui dengan pasti.Indonesia BlI-24/02/05 AULIN TABLET 100 MG Harga Per Satuan Terkecil : Rp4. 10 strip @ 10 kaplet salut selaput ASIMAT 500. urticaria atau mendapat obat nonsteroid anti-inflamasi yang lain karena kemungkinan terjadi sensitivitas silang.550. INTERAKSI OBAT : Antikoagulan oral. Reg. CARA PENYIMPANAN : Simpan di tempat sejuk dan kering. allergic rhinitis. DKL9833300909A1 HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT.

Orang dewasa 1 tablet 2xsehari setelah makan (1 tablet 100 mg) . analgesika. DKI 0051900210A1 PABRIK : Helsinn Birex Pharmaceuticals HARUS DENGAN RESEP DOKTER Benostan 500 Harga Per Satuan Terkecil : Rp1.4-NITRO-2-phenoxymethane sulponanilide INDIKASI : Aulin merupakan suatu obat anti inflamasi non steroid untuk berbagai kondisi yang membutuhkan anti inflamasi. .Pasien dengan kelainan fungsi ginjal berat (CCT <30 ml/menit) . rasa nyeri dan inflamasi setelah intervensi bedah dan setelah trauma akut dan dismenoria. atau pendarahan aktif lainnya atau gangguan pendarahan .Aulin tidak dianjurkan digunakan pada anak-anak dibawah 12 tahun KONTRA INDIKASI : .00 BELI BENOSTAN tab KOMPOSISI Mefenamic acid/Asam mefenamat . atau pendarahan gastrointetinal.Pasien dengan tukak lambung atau usus. pendarahan serebrovaskular.Pasien dengan insufisiensi hepar sedang atau berat . Setiap box berisi 2 blister @ 10 tablet 100 mg Nimesulide.Pasien dengan riwayat reaksi hipersensitif (seperti bronkospasme.250.rhinitis.Penggunaan pada anak-anak KEMASAN & NO REG. DOSIS & CARA PEMAKAIAN : .ulserasi berulang. urticaria) terhadap OAINS dan acetosal .Pasien dengan gangguan koagulasi berat .Pasien yang diketahui hipersensitif terhadap Nimesulide . antipiretika seperti osteoarthritis penyakit rematikekstra-artikular.

asma. demam. ulkus peptikum. ruam kulit. migren. EFEK SAMPING Gangguan & perdarahan saluran pencernaan. PERHATIAN Kehamilan. gugup. sakit kepala. KONTRA INDIKASI Ulkus peptikum atau ulserasi usus. INDEKS KEAMANAN PADA WANITA HAMIL Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. Interaksi obat : antikoagulan oral.5 mg/kg berat badan/hari dalam 3-4 dosis terbagi. penyakit ginjal. mengantuk. diskrasia darah.INDIKASI Nyeri. KEMASAN Tablet 500 mg 10stp DOSIS • Dewasa Anak berusia 6 bulan atau • lebih Dismenore (nyeri saat • haid).gangguan penglihatan. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin. pusing. . epilepsi. 6. penyakit radang usus besar. nyeri rematik PENYAJIAN Dikonsumsi bersamaan dengan makanan : : : 3 kali sehari 250 -500 mg. dehidrasi. 3 kali sehari 500 mg. kerusakan hati atau ginjal.

muntah. termasuk nyeri karena trauma. Penderita yang dengan Asetosal mengalami bronkospasme. KONTRA INDIKASI : Pasien yang hipersensitif terhadap Mefenamie Acid. diare dan rasa sakit pada abdominal. . Bimastan CODE: C11 Harga Per Satuan Terkecil : Rp200.00 BELI BIMASTAN© KOMPOSISI : Tiap kapsul mengandung: MefenamicAcid Tiap kaptab salut selaput mengandung: MefenamicAcid Tiap kaptab mengandung: MefenamicAcid 500 mg.PABRIK Bernofarm. anti infiamasi dan antipiretik. Penderita dengan tukak lambung dan usus. CARA KERJA OBAT : Bimastan merupakan kelompok anti inflamasi non steroid. 500 mg. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik. alergi rhinitis dan urtikaria. 250 mg. EFEK SAMPING : Sistem pencernaan : mual. INDIKASI : Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala. dismenore primer. Penderita dengan gangguan ginjal yang berat. sakit gigi. nyeri otot dan nyeri sesudahoperasi. kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. TAKARAN PEMAKAIAN : Dewasa dan anak-anak > 14 tahun: Dosis awai: 500 mg.

-

Sistem hematopetik : leukopenia, eosinophilia, trombocytopenia dan agranulocytopenia. Sistem saraf : rasa mengantuk, pusing, penglihatan kabur dan insomnia.

PERINGATAN DAN PERHATIAN : Sebaiknya diminum sesudah makan. Hati-hati digunakan pada wanita hamil dan menyusui. Keamanan penggunaan pada anak - anak dibawah 14 tahun belum diketahui dengan pasti. KONTRA INDIKASI : Penggunaan bersama antikoagulan oral dapat memperpanjang "Prothrombin".

OVER DOSIS : Jika terjadi over dosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbon absorben) untuk menyerap obat. KEMASAN : Dus isi 10strip® "10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 10 strip @ 10 kaptab No. Reg. DKL 8931402104 A1 Dus isi 50 blister @ 10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 40 blister @ 10 kaptab salut selaput No. Reg. DKL 9731407209 A1 Dus isi 10 blister @ 10 kaptab salut selaput No. Reg. DKL 0431407209 A1 Botol isi 1.000 kapsul No. Reg. DKL 8931402001 A1

250mg 500 mg 250 mg 500 mg 500 mg 250 mg

SIMPAN DITEMPAT SEJUK (15 - 25)°C DAN KERINGTERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT. BIMA MITRA FARMA TANGERANG - INDONESIA Bio mega CODE: C12

Harga Per Satuan Terkecil : Rp300.00 BELI BIO MEGA

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiro Vitamin B1 Vitamin B6 Vitamin B12 INDIKASI :

500 mg 50 mg 50 mg 100 mcg

Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat. KONTRA INDIKASI : * * * * Penderita hipersensitif Bayi di bawah 3 bulan, atau dengan berat badan di bawah 5 kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg

EFEK SAMPING : Agranulositosis, reaksi kepekaan, mengantukdan pusing."

PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu, lengan. Karena dapat menimbulkan agranulositosis yang berakibat fatal, maka sebaiknya tidak digunakan dalam jangka panjang terusmenerus. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius.

DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput.

KEMASAN : Dus, isi 10 strip @ 10 tablet salut selaput NO. REG. DKL9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT. GRAHA FARMA SOLO - INDONESIA Biomega 10 Kaplet Harga Per Satuan Terkecil : Rp300.00 BELI Biomega

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiron Vitamin B1 Vitamin B6 Vitamin B12

INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat.

KONTRA INDIKASI :

Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.INDONESIA Biropyron Harga Per Satuan Terkecil : Rp300. PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik.- Penderita hipersensitif Bayi dibawah 3bulan. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius.00 BELI BIROPYRON Kaplet Salut Selaput . reaksi kepekaan. sakit punggung. REG. DKL 9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT. mengantuk dan pusing. sindroma bahu. gangguan fungsi hati atau ginjal. bursitis. GRAHA PARMA SOLO . isi 10 strip @ 10 tablet salut selaput NO. KEMASAN : Dus. lumbago. lengan. DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut.atau dengan berat badan dibawah 5kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg EFEK SAMPING : Agranulositosis.

KONTRA INDIKASI: . Reg. bursitis. KEMASAN: Dus isi 10 Strip® 10 Kaplet No.Pada pemakaian jangka lama dapat timbul sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan.KOMPOSISI: Tiap kaplet salut selaput mengandung: Methampyrone 500 mg Thiamine HCl 50 mg Pyridoxine HCl 100 mg Cyanocobalamine 100 mcg INDIKASI: Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia. karena itu perlu dilakukan pemeriksaan uji fungsi hati atau ginjal dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut.00 BELI BODREX . lumbago. DKL0231406809 A1 SIMPAN DITEMPAT SEJUK (15-25)°C DAN KERING TERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT.hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. Reg. gangguan fungsi hati. sakit punggung. .000 kaplet No. PERINGATAN DAN PERHATIAN: . BIMA MITRA FARMA TANGERANG . sindroma bahu lengan.Wanita hamil dan menyusui .Penderita dengan tekanan darah sistolik < 100 mm Hg EFEKSAMPING: Reaksi hipersensitif pada kulit.INDONESIA Bodrex CODE: C13 Harga Per Satuan Terkecil : Rp5.Karena dapat menimbulkan agranulositosis dan berakibat fatal.Hati. DOSIS: 1 kaplet 3x sehari .500. maka sebaiknya tidak digunakan dalam waktu panjang dan terus menerus. ginjal. DKL0231406809 A2 Botol isi 1. .Penderita hipersensitif . misalnya kemerahan dan agranulositosis. .

• Reaksi hipersensitifitas. • Penderita Hipersensitif. sakit gigi. dapat meningkatkan resiko kerusakan fungsi hati. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. INDIKASI : Meringankan SAKIT KEPALA. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. SAKIT GIGI dan menurunkan DEMAM. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. segera hubungi dokter/unit pelayanan kesehatan terdekat.Meringankan SAKIT KEPALA. . SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala.

antipiretik(demam) dan anti inflamasi(mengurangi proses peradangan)....... DBL 8522700810 A1 Dibuat oleh P.50 mg CARA KERJA OBAT paracetamol merupakan analgetik-antipiretik dan ibuprofen merupakan obat golongan analgetik-antipiretik dan anti inflamasi non steroid (AINS) yang memiliki efek analgetik(menghilangkan rasa nyeri). FABRIK / Rheinfelden / Germany P91108000 Bodrex Extra CODE: C111 Harga Per Satuan Terkecil : Rp3.....700....... FRITZ BODE GmbH/ CHEM....T............... PHARM.........SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg.............. Bekasi-lndonesia atas lisensi dari DR.00 BELI BODREX EXTRA KOMPOSISI tiap tablet mengandung : paracetamol... TEMPO SCAN PACIFIC Tbk............200 mg caffeine..efek analgesik dari paracetamol dan ibuprofen bejerja sinergis dengan caffeine dalam meredakan sakit kepala INDIKASI ..350 mg ibuprofen.. No.

3-4 kali sehari EFEK SAMPING gangguan saluran cerna seperti mual.DTL0622719204A1 PT. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : .muntah.No.kemerahan pada kulit dan gangguan darah INTERAKSI OBAT efek toksik dari paracetamol dapat meningkat pada pemberian bersam-sama dengan obat yang menyebabkan kerusakan hati SIMPAN PADA SUHU DI BAWAH 30'C Reg.200.nyeri ulu hati.Tempo Scan Pacific Tbk. Bekasi-Indonesia Bodrex Flu batuk CODE: C14 Harga Per Satuan Terkecil : Rp1.meredakan sakit kepala DOSIS dan ATURAN PAKAI dewasa dan anak-anak >12 tahun : 1-2 kaplet.00 BELI BODREX Meringankan SAKIT KEPALA. 3-4 kali sehari anak-anak 6-12 tahun : 1/2-1 kaplet.

DBL 8522700810 A1 Dibuat oleh . SAKIT GIGI dan menurunkan DEMAM. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. dapat meningkatkan resiko kerusakan fungsi hati. INDIKASI : Meringankan SAKIT KEPALA. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. segera hubungi dokter/unit pelayanan kesehatan terdekat. sakit gigi. SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. • Reaksi hipersensitifitas.Parasetamol Kofein CARA KERJA OBAT : 600 mg 50 mg bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. • Penderita Hipersensitif. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. No.

Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam.T. TEMPO SCAN PACIFIC Tbk. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. FRITZ BODE GmbH/ CHEM. • Reaksi hipersensitifitas.P. • Penderita Hipersensitif.00 BELI BODREX Meringankan SAKIT KEPALA.300. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. dapat . FABRIK / Rheinfelden / Germany P91108000 Bodrex migra CODE: C15 Harga Per Satuan Terkecil : Rp1. sakit gigi. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. segera hubungi dokter/unit pelayanan kesehatan terdekat. SAKIT GIGI dan menurunkan DEMAM. PHARM. Bekasi-lndonesia atas lisensi dari DR. INDIKASI : Meringankan SAKIT KEPALA. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter.

............ PHARM. trombocytopenia dan agranulocytopenia......... No.. . PERINGATAN DAN PERHATIAN : ...• meningkatkan resiko kerusakan fungsi hati....... penglihatan kabur dan insomnia... anti-inflamasi dan antipiretik.. eosinophilia.. . Hati-hati penggunaan obat ini pada penderita penyakit ginjal..... KONTRA INDIKASI: .Sistem saraf: rasa mengantuk.. ..Penderita dengan gangguan ginjal yang berat.. ..... 500 mg Tiap kapsul mengandung Asam Mefenamat.. FRITZ BODE GmbH/ CHEM... pusing.....Sistem hematopoetik : Leukopenia. alergi rhinitis dan urtikaria...... DBL 8522700810 A1 Dibuat oleh P....... nyeri otot dan nyeri sesudah operasi..Penderita yang hipersensitif terhadap asam mefenamat..T. INDIKASI Meredam nyeri ringan sampai sedang sehubungan dengan sakit kepala....Penderita dengan tultaK lambung dan usus... termasuk nyeri karena trauma...... TEMPO SCAN PACIFIC Tbk....... sakit gigi........ FABRIK / Rheinfelden / Germany P91108000 Cargesik 500 Kaplet CODE: C111 Harga Per Satuan Terkecil : Rp250. 500 mg Asam Mefenamat merupakan kelompok anti-inftamasi non steroid.. muntah. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik....Penderita yang dengan aspirin mengalami bronkospasme... dismenore primer........Sistem pencemaan : mual. ..... Bekasi-lndonesia atas lisensi dari DR....00 BELI Cargesik KOMPOSISI: Tiap kaplet mengandung Asam Mefenamat..Sebaiknya diminum sesudah makan............ diare dan rasa sakit pada abdominal..... .... EFEK SAMPING : ....... SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg.

encok pada pangkal paha. Atau menurut petunjuk dokter. KEMASAN & No.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik.Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahul dengan pasti. rheumatik atau sering buang air diwaktu malam. isi 10 blister @ 10 kaplet No. Dokter Carroll. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide.000. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan. Dengan ramuan yang berhasil itu.Indonesia Carroll Super Pills Botol CODE: C17 Harga Per Satuan Terkecil : Rp11.: DKL 9323402504 A2 HARUS DENGAN RESEP DOKTER SIMPAN PADA SUHU KAMAR (25 .Dus. dengan melalui percobaan selama bertahun .Dus. .: DKL 9323402504 Al .Botol plastik @ 500 kapsul No. Pill ini cocok untuk : Sakit pinggang. Reg. OVERDOSIS: Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktlf (karbo adsorben) untuk menyerap obat. Reg. . USA. Prof.. isl 10 strip @ 10 kaplet No. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. Reg. Reg. kemudian dianjurion 250 mg tiap 6 jam sesuai dengan kebutuhan. Pemakaian sebaiknya sesudah makan. DOSIS: Secara umum-dapat digunakan dosis pemakaian sebagai berikut: Dewasa dan anak-anak > 14 tahun : Dosis awal: 500 mg. : DKL 9123401701 Al . Cara pemakaian : Dewasa : . INTERAKSI OBAT : Penggunaan bersamaan antikoagulan oral dapat memperpanjang "prothrombln*.30)°C Semarang .Hati-hati jika digunakan pada wanita hamil dan menyusui.

No. dengan melalui percobaan selama bertahun . Perubahan warna ini adalah reaksi normal.INDONESIA Carroll Super Pills Sachet CODE: C16 Harga Per Satuan Terkecil : Rp1. pemakaian : makan. Keadaan yang sedikit berat boleh makan : 2 pill sebelum makan. 2 pill sebelum tidur. 1 pill sebelum tidur. hangat. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik. Pill ini cocok untuk : Sakit pinggang. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan. 2 kali sehari. Cara Dewasa 1 1 pill pill sebelum sebelum tidur.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. Dianjurkan minum banyak air. Dengan ramuan yang berhasil itu. PERHATIAN : Setelah menelan pill ini.1 pill sebelum makan. diminum dengan air hangat. Prof.250. Reg. rheumatik atau sering buang air diwaktu malam. 3 kali sehari. dan tidak menguatirkan. diminum 2 dengan kali air sehari. encok pada pangkal paha. : . D 7811980 DIPRODUKSI OLEH : ARTOIS FARMA TANGERANG . Dokter Carroll. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide. warna kencing menjadi biru atau hijau. diminum dengan air hangat. USA.

: sebelum sebelum tidur. ruam kulit. Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi Efek samping : kadang-kadang nyeri epigastrium. diminum boleh 3 dengan banyak makan kali air : sehari.Keadaan 2 pill 2 pill Dianjurkan PERHATIAN yang sedikit berat makan. D 7811980 DIPRODUKSI ARTOIS TANGERANG . warna kencing menjadi biru atau hijau. dan tidak menguatirkan.300. Perubahan warna ini adalah reaksi normal.INDONESIA CATAFLAM 25 CODE: C30 Harga Per Satuan Terkecil : Rp2. Dosis : Dewasa : awal :100-150 mg sehari. No. OLEH : FARMA . sakit kepala. 50 mg/tablet. Tidak boleh untuk anak. hangat. Kemasan : Dos 5x10 tablet 25 m. minum Setelah menelan pill ini.00 BELI Cataflam Kalium diklofenak 25 mg. Reg. air. pusing atau vertigo.

Efek samping : kadang-kadang nyeri epigastrium.350.00 BELI Cataflam Kalium diklofenak 25 mg. keadaan meradang setelah trauma (terpukul/terbentur/teririrs) yang disertai rasa sakit/nyeri. pusing atau vertigo. Cataflam D 50 Harga Per Satuan Terkecil : Rp4. 50 mg/tablet. Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi. Dosis: Dewasa : awal : 100-150 mg sehari. INDIKASI : Pengobatan jangka pendek pada peradangan & nyeri sesudah operasi. sakit kepala.00 BELI CATAFLAM D KANDUNGAN : Diclofenac / Diklofenak.200.CATAFLAM 50 CODE: C31 Harga Per Satuan Terkecil : Rp4. ruam kulit. Kemasan : Dos 5x10 tablet 50 m. Tidak boleh untuk anak. osteoartritis (penyakit sendi degeneratif yang disertai dengan kelainan tulang .

EFEK SAMPING : • Kadang-kadang : gangguan saluran pencernaan. antikoagulan. perdarahan lambung-usus. • Hamil. vertigo. purpura (keadaan yang ditandai dengan bercak-bercak perdarahan dalam kulit atau selaput lendir). pneumonitis. PERHATIAN : • Gejala/riwayat penyakit lambung-usus.berdekatan). diuretika. gout akut. penyakit Crohn. reaksi hipersensitifitas. atau ginjal. menyusui. KEMASAN : Tablet 50 mg x 50 biji. • Anak berusia lebih dari 14 tahun : 2 tablet. • Jarang : ulkus peptikum. ruamkulit. • Kehilangan volume ekstraseluler. • Porfiria. DOSIS : • Dewasa: dosis awal 2-3 tablet. • Kemampuan mengendarai & menggunakan mesin mungkin terpengaruh. • Usia lanjut. INDEKS KEAMANAN PADA WANITA HAMIL : Baik penelitian reproduksi hewan tidak menunjukkan risiko pada janin maupun penelitian terkendali pada wanita hamil atau hewan coba tidak memperlihatkan efek merugikan (kecuali penurunan kesuburan) dimana tidak ada penelitian terkendali yang mengkonfirmasi risiko pada wanita hamil semester pertama (dan tidak ada bukti risiko pada trisemester selanjutnya). diskrasia darah. Dianjurkan untuk memonitor secara teratur fungsi hati & hitung darah selama • penggunaan jangka panjang. sindroma Stevens-Johnson. jantung. reumatisme non artikular & sindroma nyeri pada tulang belakang. eritroderma. gangguan sistem kardiovaskular (jantung dan pembuluh darah). peningkatan serum transaminase. abnormalitas fungsi ginjal. antidiabetes oral. sindroma Lyell. hepatitis. Interaksi obat : Lithium. Metotreksat. • Gangguan fungsi hati. KONTRA INDIKASI : Ulkus lambung atau usus. pusing. meningitis aseptik. sakit kepala. Digoksin. . • Kasus-kasus tertentu : gangguan perasaan atau penglihatan. eritema multiform. Siklosporin. • Asma. pankreatitis.

Diberikan dalam 2-3 dosis terbagi. KONTRA INDIKASI : Hipersensitif terhadap diclofenac. seperti terkilir. Bekerja menghambat biosintesa pros-taglandin yang merupakan faktor terbesar penyebab inflamasi. PABRIK Novartis. vertigo.400.00 BELI CATANAC KOMPOSISI : Tablet CATANAC 25 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac1 Tablet CATANAC 50 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac FARMAKOLOGI : Kalium Diclofenac merupakan anti inflamasi yang bukan golongan steroid. Sebagai ajuvan pada nyeri inflamasi yang berat dari infeksi telinga. Catanac 50mg CODE: C18 Harga Per Satuan Terkecil : Rp2. pruritus dan depresi. peptic ulcer. INDIKASI : Sebagai pengobatan jangka pendek untuk kondisi-kondisi akut seperti: Nyeri inflamasi setelah trauma. Kadang-kadang peningkatan enzim SGOT. PERINGATAN DAN PERHATIAN : . juga menunjukkan efek analgesik pada nyeri sedang dan berat. Selain anti inflamasi. Nyeri dan inflamasi setelah operasi. hidung atau tenggorokan. sakit kepala. EFEK SAMPING : Gangguan pada saluran pencernaan. Peptic ulcer. seperti operasi gigi atau tulang. nyeri dan demam. SGPT.

Methotrexate. . sebaiknya dilakukan pemeriksaan fungsi hati dan darah secara periodik. Reg. Reg. Pada pemakaian jangka panjang. SOHO INDUSTRI PHARMASI Jakarta .T. diclo-fenac akan mempertinggi konsentrasi obat-obat tersebut dalam plasma.00 BELI Celebrex Selekoksib 100 mg.T. KEMASAN : Dus 30 tablet CATANAC 25 mg (3 strip @ 10 tablet salut enterik) No. Cholestiramin dan liquid parafin. gangguan fungsi jantung dan ginjal.950. Kasus ringan dan anak lebih dari 14 th : 75-100 mg dibagi atas 2-3 kali sehari. Tidak dianjurkan untuk wanita hamil dan menyusui. ETHICA Jakarta . DKL 9806707515B1 HARUS DENGAN RESEP DOKTER SIMPAN Dl TEMPAT SEJUK DAN KERING Dibuat oleh : P. akan berkurang absorbsinya. TAKARAN PEMAKAIAN : Dewasa : 100-150 mg dibagi atas 2-3 kali sehari. tukak lambung.Indonesia Untuk: P.Indonesia CELEBREX 100 CODE: C32 Harga Per Satuan Terkecil : Rp7. Bila diberikan bersama diuretik dan B Bloker. Bila diberikan bersama Neomycin.Penderita dengan riwayat gangguan saluran cerna. 200mg. Cyclosporin atau Digoxin. INTERAKSI OBAT : Bila diberikan bersama produk lain yang mengandung Lithium. DKL 9806707515A1 Dus 30 tablet CATANAC 50 mg (3 strip @ 10 tablet salut enterik) No. dapat mempengaruhi/mengurangi efek kedua obat ini.

intoksikasi kardovaskuler. Cetalgin Harga Per Satuan Terkecil : Rp850. pasien penderita asma. intoksikasi sistem saraf periferal. Efek samping : Intoksikasi saluran cerna. jangan diberikan pada wanita hamil karena dapat menyebabkan kelahiran prematur. Kemasan : Dos 3x10 kapsul 100 mg.00 BELI CETALGIN-T KOMPOSISI : Na Metamizol 500 mg . Perihal : Dapat menyebakan intoksikasi saluran cerna. artritis reumatoid 2x sehari 100200 mg.Indikasi: penobatan ostoeartritis dan artritis rematoid. urtikaria. Kontra Indikasi : Hipersensivitas. Dosis : Osteoartritis:1x sehari 200 mg atau 2z sehari 100 mg. reaksi anafilaktik..

EFEK SAMPING : Reaksi alergi.Vitamin B1 Vitamin B6 Vitamin B12 Kafein INDIKASI : 60 mg 15 mg 15 mg 50mg Sakit kepala. PERHATIAN : Hipersensitif terhadap Aspirin. porfiria. perdarahan lambung-usus. Interaksi obat : Klorpromazin. sakit pinggang. 1-2 kali sehari &frac12-1 kaplet.00 BELI CETALMICT . PENYAJIAN : Dikonsumsi bersamaan dengan makanan PABRIK: Soho Cetalmic 500 mg CODE: C19 Harga Per Satuan Terkecil : Rp1. agranulositosis. neuralgia. rasa sakit/nyeri yang berkaitan dengan penyakit lainnya. DOSIS • Dewasa • Anak berusia 8-12 tahun 3 kali sehari 1 kaplet.100. KONTRA INDIKASI : Kelainan perdarahan. KEMASAN : Kaplet 10 x 10 biji.

rhinitis alergi atau mendapat obat non steroid anti inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. Sebagai analgesik. perdarahan lambung. nyeri setelah operasi dan melahirkan. Jangan digunakan pada wanita hamil/menyusui. anti inflamasi dan antipiretik. sakit gigi.kira 50% diekskresi dalam urine dan 20% ditemukan dalam faeces. penderita ginjal. agranulasitosis. pusing. penderita asma. Kira . KONTRA INDIKASI : Penderita tukak lambung/usus. nyeri trauma.KOMPOSISI : • CETALMIC® 250 kapsul Tiap kapsul mengandung asam mefenamat 250 mg • CETALMIC® 500 kaplet salut selaput Tiap kaplet mengandung asam mefenamat 500 mg FARMAKOLOGI : CETALMIC® mengandung asam mefenamat yang mempunyai khasiat analgesik. muntah. EFEK SAMPING : Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. nyeri otot. hemolotik anemia. Asam mefenamat terikat sangat kuat pada protein plasma. kadar puncak tercapai setelah 2 jam. Keamanan pada anak-anak dibawah 14 tahun . nyeri haid. penderita yang hipersensitif. waktu paruh dalam plasma adalah 3-4 jam. Asam mefenamat cepat diabsorpsi. asam mefenamat merupakan satu-satunya derivat fenamat yang memiliki daya kerja baik central maupun perifer. INDIKASI : Untuk menghilangkan berbagai rasa sakit dan nyeri dari ringan sampai sedang termasuk sakit kepala. PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. diare. Juga sebagai antipiretik pada keadaan demam.

TAKARAN PEMAKAIAN : Dewasa dan anak di atas 14 tahun : Dosis awal 500 mg. 10 strip @ 10 kapsul DKL9224209401A1 • CETALMIC8 500 mg kaplet salut selaput Box. CYBUFEN should not be given to patients in whom aspirin or other nonsteroidal anti-inflammatory drugs have induced an asthmatic syndrome.00 BELI Danalgin Metampiron Diazepam . Sebaiknya diberikan pada waktu makan. Due to the possibility of cross sensitivity. urticaria. 10 strip @ 10 kaplet salut selaput DKL 9224209509A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH SUHU 30°C TERLINDUNG DARI CAHAYA PT SOHO INDUSTRI PHARMASI JAKARTA-INDONESIA Cybufen 300mg Harga Per Satuan Terkecil : Rp5. rhinitis.350. dilanjutkan 250 mg tiap 6 jam.050. KEMASAN : • CETALMIC® 250 mg kapsul Box.00 BELI INDICATIONS CYBUFEN is indicated for acute and long-term use in the relief of signs and symptoms of osteoarthritis and rheumatoid arthritis. CYBUFEN is also contraindicated in patients with active peptic ulcer. angioedema or exacerbation of nasal polyps. Danalgin CODE: C20 Harga Per Satuan Terkecil : Rp1.belum diketahui dengan pasti. CYBUFEN may also be used for other painful inflammatory conditions CONTRAINDICATIONS CYBUFEN should not be used in patients who have exhibited hypersensitivity during previous administration. Jangan digunakan lebih dari 7 hari kecuali atas petunjuk dokter.

Konsentrasi plasma puncak diazepam dicapai setelah 15 . Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/ kelainan darah. Gangguan pulmoner akut. sindroma bahu-lengan. Waktu paruh diazepam dan desmetil diazepam biasanya meningkat pada neonatus.4 jam. lumbago. Diazepam dimetabolisme terutama di hati dan terikat pada reseptor di daerah spinal cort. Waktu paruh bervariasi antara 20-70 jam. sakit punggung.19 menit. Ttdak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. Wanita hamil dan menyusui. Karena dapat menimbulkan agranulositosis yang berakibat fatal. Bayi dibawah 6 buian. Metampiron bekerja sebagai analgetik. diabsorpsi dari saluran pencernaan dan mempunyai waktu paruh 1 . Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada . sistem limbik dan korteks serebral. Depresi pernapasan. Glaukoma sudut sempit. Penderita dengan tekanan darah sistolik < 100 mmHg. usia lanjut dan penderita dengan gangguan hati yang berat. Keadaan psikosis akut. Kontra indikasi : Penderita hipersensitif. Mempunyai aktivitas sebagai ansiolitik dan hipnotik. serebelum.Komposisi : Tiap kaplet mengandung : Metampiron 500 mg Diazepam 2 mg Farmakologi : DANALGIN bekerja sebagai anatgetik dan tranquillizer. gangguan fungsi hati atau ginjal. tetapi metabolit aktif yang dominan yaitu desmetil diazepam mempunyai waktu paruh 30 -100 jam. Peringatan dan perhatian : Jangan mengemudikan kendaraan atau menjalankan mesin selama minum obat ini. Indikasi : Untuk meringankan rasa sakit sedang sampai berat terutama nyeri kolik dan sakit setelah operasi dimana dipehukan kombinasi dengan tranquillizer. maka sebaiknya tidak digunakan dalam jangka panjang terus menerus. bursitis.

Agranulositosis. : DPL8804405304A1 Botol berisi 75 kaplet. vertigo. hipotensi. Interaksi obat: Penggunaan bersama obat-obat depresan SSP atau alkoho! dapat meningkatkan efek depresan. : DPL8804405304A1 Simpan pada suhu kamar (maks. retensi urin. depresi. keleiahan. No. Kemasan: Kotak berisi 10 strip x 10 kaplet. ataksia. No. halusinasi dan gangguan tidur. perubahan libido. 30°C). No. Efek samping : Reaksi hipersensitivitas : reaksi pada kulit misal kemerahan.- penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. konstipasi. HARUS DENGAN RESEP DOKTER DANKOS PT DANKOS FARMA. JAKARTA-INDONESIA Datan forte CODE: C21 Harga Per Satuan Terkecil : Rp1. dipiopia. Hati-hati penggunaan pada penderita depresi berat atau yang mempunyai kecen-derungan melakukan bunuh diri. Reg. jaundice. Hentikan pengobatan jika terjadi reaksi-reaksi paradoksikal seperti keadaankeadaan hipereksitasi akut. Reg. maksimum 4 kaplet sehari. Dosis : Jika sakit 1 kaplet. berikutnya 1 kaplet tiap 6-8 jam. Reg. Mengantuk. ansietas. : DPL8804405304A1 Kaleng berisi 500 kaplet. : DPL8804405304A1 Kotak berisi 50 strip x 10 kaplet. tremor.250. mual. No.00 BELI DATAN®KapIet ASAM MEFENAMAT . Reg. Obat ini dapat menyebabkan kelemahan otot dan ketergantungan secara fisik dan psikologis.

DOSIS : . nyeri sehabis operasi dan melaliirkan.000 mg atau lebih perhari dan merupakan indikasi untuk menghentikan pengobatan.kolik usus. keseleo.Komposisi : Tiap kaplet DATAN mengandung 250 mg Asam Mefenamat.nyeri otot. sakit kepala dan sakit gigi. .diare. Farmakologi : DATAN dengan zat aktif Asam Mefenamat. .Keamanan pada anak di bawah usia 14 tahun belum terbukti. mempunyai daya kerja sebagai analgetik yang kuat dengan disertai efek anti inflamasi dan antipiretik. EFEK SAMPING : Pada beberapa orang dapat menyebabkan iritasi lambung. liipersensitif.seperti : nyeri karena trauma. .mual dan sakit kepala.Keamanan penggunaan DATAN pada wanita hamil belum diketahui.Diare dapat terjadi pada penggunaan jangka panjang yang terus menerus dengan dosis 2. Sekitar 50 % dari dosis yang diberikan akan diekskresikan melalui urine dalam bentuk inetabolit terkonyugasi dalam waktu 48 jam. nyeri sewaktu haid.Efek samping adalah minimal pada dosis yang dianjurkan. Tiap kaplet DATAN forte mengandung 500 mg Asam Mefenamat. renal disease.Iritasi lambung jarang terjadi dan dapat dikiirangi dengan menelannya bersama makanan. . Kontraindikasi : Penderita tukak lambung dan usus. nyeri sendi. Kadar maksimal dalam darah akan tercapai dalam waktu 2 jam setelah pemberian. DATAN dapat diabsorbsi dengan baik oleh saluran pencernaan. Indikasi : Menghilangkan segala macam rasa nyeri baik akut maupun kronis. Peringatan dan perhatian : .

. Kemasan : Kaplet DATAN : Dus berisi 10 strip @ 10 kaplet... Reg.100.. Reg.. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase ... DKL8921004I04A1.. DKL8921004104B1 Penyimpanan: Simpanlah di tempat yang sejuk (15-25 * C) dan kering. HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT PYRIDAM FARMATbk.kemudian dilanjutkan dengan 250 500 mg setiap 6 jam. 500 mg Cara kerja obat Asam mefenamat merupakan kelompok antiinflamasi non steroid.... No. Kaplet DATAN forte: Dus berisi 10 strip @ 10 kaplet. No. Cianjur-lndonesia Dentacid 500 Harga Per Satuan Terkecil : Rp1..00 BELI DENTACID™ Komposisi Tiap kaplet mengandung Asam mefenamat .Dewasa: Dosis awal yang dianjurkan adalah 500 mg.

alergi rhinitis dan urtikaria.sehingga mempunyai efek analgesik.Penderita yang dengan asetosal mengalami bronkospasme. muntah. . Efek samping Sistem pencernaan: mual. .Penderita dengan tukak lambung dan usus. sakit gigi. Peringatan dan perhatian . kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. antiinflamasi dan antipiretik. pusing. eosinophilia.Penderita dengan gangguan ginjal yang berat. Dosis Dewasa dan anak-anak ± 14 tahun: Dosis awal 50 mg. dismenore primer.Keamanan penggunaan pada anak . termasuk nyeri karena trauma.Sebaiknya diminum sesudah makan. diare dan rasa sakit pada abdominal. Kontraindikasi .Hati-hati jika digunakan pada wanita hamil dan menyusui. trombocytopenia dan agranulocytopenia. Indikasi Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala.anak dibawah 14 tahun belum diketahui dengan . penglihatan kabur dan insomnia. . . Sistem saraf: rasa mengantuk. nyeri ototdan nyeri sesudah operasi. . Sistem hematopoetik: leukopenia.Pasien yang hipersensitif terhadap asam mefenamat.

No.: DKL0704426004A1 Diproduksi oleh: PT. Penyimpanan Simpan pada suhu kamar (di bawah 30°C). Overdosis Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbo absorben) untuk menyerap obat.Indonesia . Reg. HEXPHARM JAYA Cipanas .pasti. Lindungi dari cahaya. Kemasan Dus isi 10 strip x 10 kaplet HARUS DENGAN RESEP DOKTER. Interaksi obat Penggunaan bersamaan dengan antikoagulan oral dapat memperpanjang "prothrombin".

Kelainan muskulo-skeletal akut: periatritis. Penyakit reumatik inflamatoar dan degeneratif: artritis reumatoid. dimana diklofenak diabsorpsi dengan oepat. iritasi lambung dikurangi. Obat ini 99. ankilosing spondilitis.Indonesia Divoltar 50mg CODE: C22 Harga Per Satuan Terkecil : Rp1. DIVOLTAR® merupakan penghambat prostaglandin sintetase. analgesik dan antipiretik yang kuat. dan dislokasi. Sebagai tablet salut enterik. Menghilangkan/mengurangi rasa nyeri dan inflamasi nonreumatik. termasuk bentuk juvenil. . tendinitis. DANKOS FARMA Jakarta . Dengan demikian.500. Obat ini mempunyai sifat antiinflamasi.7% terikat pada protein plasma dan waktu paruh eliminasinya 1 . Kadar puncak dalam plasma dicapai setelah 1 . Seperti obat-obat antiinflamasi nonsteroid lainnya. Diklofenakdimetabolisme hampir sempurna dalam hati: ekskresi obat yang utuh melalui ginjal kurang dari 1%. 2. salah urat. dan penyakit pirai akut. 3.4 jam. Indikasi : 1. Diklofenak mengalami metabolisme lintasan pertama dalam hati.00 BELI DIVOLTAR® Diklofenak natrium tablet salut enterik Komposisi : Tiap tablet salut enterik mengandung : Diklofenak natrium 25 mg atau 50 mg Farmakologi : DIVOLTAR® adalah obat antiinflamasi nonsteroid dengan struktur kimia yang baru (suatu derivat asam asetat). DIVOLTAR" hancur dan melarut langsung dalam usus halus.2 jam. osteoartritis. bursitis.Indonesia Dipasarkan oleh: PT KALBE FARMA Tbk. Bekasi . tenosinovitis.Untuk: PT.

atau rinitis akut bila mendapat asetosal atau obat-obat antiinflamasi nonsteroid lainnya. dibagi dalam 2 . Bila ini terjadi. Reg. penderita dengan insufisiensi hati. Ulkus peptikum atau perdarahan saluran cerna. gagal ginjal dan sindroma nefrotik juga terjadi. Hipersensitivitas terhadap diklofenak. Peringatan dan perhatian : 1. dan anemia aplastik dapat juga terjadi. Anak 1 tahun atau lebih :1 . DKL8811606917B1 PT KALBE FARMA Tbk.Kontra indikasi : 1. dapat terjadi nyeri epigastrium. Reg. dibagi dalam 2 . 2.3 dosis. tetapi sangat jarang. 2. Kemasan : Tablet 25 mg : Tablet 50 mg : Dosisi 5 strip x 10 tablet salut enterik. DIVOLTAR® harus dihentikan. DKL8811606917A1 Dos isi 5 strip x 10 tablet salut enterik. Efek samping ini biasanya ringan. Untuk terapi jangka panjang. Dosis dan cara pemberian Dewasa : Dosis awal 75 -150 mg sehari. hati dan hitung darah). No. Penderita yang mendapat pengobatan jangka panjang dengan DIVOLTAR®. nyeri kepala atau pusing. Penderita asma yang mengalami serangan asma. 4. seperti halnya dengan obat-obat antiiflamasi nonsteroid lainnya. dosis biasanya 75 -100 mg sehari. harus dimonitor sebagai tindakan berjaga-jaga (mis. Gunakan dengan hati . fungsi ginjal. penderita usia lanjut (lebih mudah mengalami efek samping obat-obat antiinflamasi nonsteroid). Userasi dan perdarahan saluran cerna. sendawa. Tablet harus ditelan seluruhnya sewaktu makan atau setelah makan.3 mg/kg sehari. retensi cairan dan peningkatan serum transaminase kadang-kadang terjadi. nausea dan diare. 3. trombositopenia. DIVOLTAR® tidak boleh diberikan selama kehamilan kecuali bila mutlak diperlukan. DIVOLTAR® dapat meningkatkan kadar plasma lithium atau digoksin. Reaksi kulir.3 dosis. hepatitis.hati pada: penderita dengan gangguan saluran cerna atau dengan riwayat ulkus peptikum. jantung atau ginjal yang parah. ikterus. No. Leukopenia. 3. Efek samping: Pada awal pengobatan. urtikaria. .

Atau menurut petunjuk dokter. Simpan pada suhu kamar (di bawah 30°C). Kontra indikasi: Jangan diberikan kepada penderita yang hipersensitif terhadap ibuprofen atau penderita dengan sindroma polip hidung. Dosis penunjang 0.6 . . maksimum diberikan sebanyak 500 mg sehari. HARUS DENGAN RESEP DOKTER.Bekasi .1. dibagi dalam beberapa dosis. Rasa nyeri ringan sampai sedang dan rasa nyeri pada waktu haid. Komposisi: DOFEN® 200 Tiap tablet salut selaput mengandung: Ibuprofen DOFEN® FORTE Tiap tablet salut selaput mengandung: Ibuprofen Indikasi: Reumatik artritis. 20 mg/kg bobot badan sehari. Untuk anak yang bobot badannya kurang dari 30 kg.00 BELI DOFEN® 200 DOFEN® FORTE Tablet salut selaput DOFEN adalah tablet bersalut selaput (film coat) yang mempunyai khasiat sebagai analgetika-antipiretika dan antiinflamasi. sakit kepala atau vertigo. dibagi dalam beberapa dosis.2.9 .Indonesia Lindungi dari cahaya. Dofen Forte 400mg CODE: 121 Harga Per Satuan Terkecil : Rp400.2 gram sehari. Efek samping: Efek samping yang biasa timbul adalah gangguan saluran cerna. osteoartritis dan gout artritis. Dosis : Dewasa : Anak-anak : 200 mg 400 mg 0. serta reaktivitas bronkospastik terhadap asam asetilsalisilat atau antiinflamasi non steroid lainnya.4 gram sehari. angiodema.

Hati-hati bila digunakan pada penderita dengan gangguan fungsi ginial dan perlu dilakukan monitor yang ketat. .00 BELI DOGMATIL SULPIRIDE 3 bidang pengobatan utama : ITUKAK SALURAN PENCERNAAN PSIKIATRI VERTIGO ■ Tukak saluran pencernaan Pengobatan pada waktu serangan : 2 . DKL8505001617A1 DOFEN FORTE: Kotak. SIMPAN PADA SUHU DI BAWAH 30°C.650. 10 strip @ 10 tablet. Peringatan dan perhatian: Hati-hati bila digunakan pada penderita dengan riwayat dekompensasi jantung atau hipertensi. DKL8505001617B1 HARUS DENGAN RESEP DOKTER. pruritus. Dibuat oleh: DEXAMEDICA JL. 10 strip @ 10 tablet. gangguan fungsi ginjal tetapi ini jarang terjadi. TERLINDUNG DARI CAHAYA. Pada penderita dengan riwayat penyakit saluran cerna bagian atas perlu dilakukan pengawasan yang ketat. BAMBANG UTOYO 138 PALEMBANG-INDONESIA Dogmatil CODE: C23 Harga Per Satuan Terkecil : Rp3. Pada dosis yang berlebihan dapat terjadi gejala saluran cerna dan gejala susunan saraf pusat. Tidak boleh digunakan pada penderita yang diketahui hipersensitif terhadap aspirin atau antiinflamasi non steroid lainnya Hati-hati bila digunakan pada penderita dengan kelainan faktor intrinsik untuk pembekuan darah. Kemasan dan Nomor Registrasi: DOFEN 200 : Kotak.3 ampul/hari selama 1 . Terapi penunjang : 3 kapsul @ 50 mg/hari selama 3 minggu.Juga dapat menimbulkan ruam kulit.2 minggu.

delusi.6 kapsul/hari. ■ Vertigo karena berbagai sebab 3. dibagi dalam beberapa dosis. dibagi dalam beberapa dosis. • Depresi karena berbagai sebab. • Depresi pada geriatrik.4 kapsul @ 50 mg/hari. No.3 kapsul/hari selama 3 . halusinasi.4 tablet @ 200 mg/hari.4 minggu. Reg. • Sindroma post gegar-otak.6 ampul/hari. Reg. kebingungan. keadaan delusi 2 . EFEK SAMPING : Kadang-kadang dapat menyebabkan gangguan siklus menstmasi atau efek extra pyramidal ringan yang mudah hilang.b. • Keadaan depresi yang reaktif. D 7811131 -Ampul 6 @ 100 mg/2 ml No. dibagi daTam beberapa dosis.b. • Kelainan tingkah laku yang berat. KEMASAN: Tablet dalam strip berisi 20 @ 200 mg (khusus pemakaian psikiatri) No. dibagi dalam beberapa dosis. Kewaspadaan tetap terpelihara bahkan sering kali meninggi. • Psikosa pada masa anak-anak./hari. • Neurosa dengan harnbatan psikomotor. (waham) kronis. dan keadaan pra-psikosa. • Kelainan psikofungsionil • Kelainan tingkah laku yang ringan. Anak-anak : 5 -10 mg/kg b. Tidak mempengaruhi sistim neurovegetative. TOLERANSI : Pada terapi jangka panjang atau pada pengobatan ulangan tidak menimbulkan adiksi.Terapi lanjutan : 1 . ■ Kelainan psikiatri utama Pengobatan pada waktu serangan : • Psikosa akut dengan gejala-gejala 3 . Dewasa : 2 . Terapi penunjang per oral: • Skizofrenia akut. D 6015425 -Kapsul dalam strip berisi 20 dan 100 @ 50 mg./hari. remaja Anak-anak : 10 mg/kg b. D 6015158 . Tanpa kontraindikasi maupun incompatibility. Reg.

JAKARTA. KONTRA INDIKASI : Intoksikasi akut bila digunakan bersama dengan alkohol.SIMPAN Dl BAWAH SUHU 30°C. memperkuat efek analgesik Tramadol HCl namun dengan efek samping opioid yang minimal. . dengan sifatnya sebagai agonis partial pada reseptor opioid (reseptor U) yang berperan pada efek analgesik. Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg INDIKASI : Untuk mengatasi nyeri berat. TERLINDUNG DARI CAHAYA Tablet dan Kapsul di produksi oleh : PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Injeksi diproduksi oleh : PT ETHICA. noradrenaline pasca sinaptik dan memblok reseptor serotonergik. Disamping itu juga bekerja pada reseptor monoaminergik di susunan saraf pusat. baik akut maupun kronik serta nyeri setelah operasi. SESIF . Dengan menghambat "reuptake".FRANCE DELAGRANGE Dolana Kapsul CODE: C122 Harga Per Satuan Terkecil : Rp3.00 BELI Dolana KOMPOSISI : Setiap Kapsul mengandung : Setiap Suppositoria mengandung : Setiap 1 mL Larutan injeksi DOLANA 50 mg mengandung : Setiap 2 mL Larutan injeksi DOLANA 100 mg mengandung : CARA KERJA OBAT : Tramadol HCl adalah analgesik yang bekerja sentral.450. preparat hipnotik.PARIS . untuk PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Dengan lisensi dari DELAGRANGE.

Tramadol HCl tidak boleh diberikan pada pasien yang menerima MAO Inhibitors. muntah. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi tramadol dengan cepat.00 BELI Dolfenal . INTERAKSI OBAT : Dengan obat-obat yang bekerja pada susunan saraf pusat seperti Trankuilizer. Penderita yang hipersensitif terhadap tramadol atau opiat. DOLFENAL CODE: C33 Harga Per Satuan Terkecil : Rp1. PERINGATAN DAN PERHATIAN : Tramadol tidak boleh digunakan pada penderita ketergantungan obat. Hati-hati bila digunakan pada penderita trauma kepala. Hendaknya tidak diberikan selama serangan asma bronkial atau kegagalan jantung sekunder sampai penyakit. Penderita dengan depresi pernapasan terutama jika ada cyanosis dan sekresi bronkial yang berlebihan.000. sakit kepala. mual. pusing. Pada penderita dengan gangguan fungsi ginjal / hati perlu dilakukan penyesuaian dosis.- analgesik atau obat-obat lain yang bekerja pada susunan saraf pusat. Meskipun termasuk antagonis opiat.1 % tramadol diekskresikan melalui ASI. paru-paru kronik EFEK SAMPING Berkeringat. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. Dispepsia obstipasi. sedasi. gangguan fungsi ginjal dan hati yang berat atau hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok (renjatan ) Dapat terjadi penurunan fungsi paru-paru apabila penggunaan tramadol dikombinasi dengan obat depresi SSP lainnya atau bila melebihi dosis yang dianjurkan. peningkatan tekanao intrakranial. pruritus. Penderita yang mendapat pengobatan penghambat MAO. tramadol tidak dapat menekan gejala "withdrawal" akibat pemberian morfin. hipnotik maka efek sedasi/kelelahan kemungkinan meningkat. mulut kering dan lelah. Pertimbangkan manfaat dan resiko yang mungkin terjadi bila digunakan pada wanita hamil dan menyusui karena 0. kemerahan.

hipersensivitas.pusing.Asam mefenamat 500 mg. peradangan.nefropati. Kontra indikasi : Tukak/inflamasi saluran cerna. kerusakan hati dan ginjal. asma. Efek samping : Gangguan saluran cerna. . Dolika Kapsul CODE: C123 Harga Per Satuan Terkecil : Rp2. Indikasi : nyeri.reaksi kulit. Perihal : tukak lambung.00 BELI DOLIKA INJEKSI / KAPSUL KOMPOSISI Tiap ml Dolika 50 Injeksi mengandung : Tiap ml Dolika 100 Injeksi mengandung : Tiap kapsul mengandung : Tramadol HCI Tramadol HCI Tramadol HCI 25 mg 5 mg 50 mg Dewasa dan anak >14 tahun : kemudian 250 mg.mengantuk.perdarahan saluran cerna. Dosis : 4x sehari : Kemasan : Dos 100 tablet.diskrasia darah.gangguan penglihaan.700.sakit kepala. de3hidrasi.

dosis Dolika yang diberikan adalah sebagai berikut : Dosis untuk orang dewasa dan anak umur di atas 14 tahun : DOLIKA KAPSUL : Dosis tunggal : 1 kapsul Dosis harian : sampai 8 kapsul Dosis tersebut biasanya cukup untuk meredakan nyeri. EFEK SAMPING . Lama pengobatan : Pada pengobatan Dolika jangka panjang.60 menit. kemungkinan terjadinya ketergantungan tidak dapat disingkirkan. INDIKASI Nyeri akut dan kronik berat. Nyeri pasca operasi. Apabila masih terasa nyeri. atau bila pengobatan perlu dihentikan sementara. biasanya diberikan dalam bentuk injeksi DOSIS PEMAKAIAN Dosis yang diberikan sebaiknya disesuaikan dengan intensitas nyeri Bila tidak ada petunjuk lain dari dokter. Dosis harian sebesar 400 mg/hari jangan dilampaui. Karenanya dokter harus menetapkan lamanya pengobatan.CARA KERJA OBAT Tramadol HCI merupakan Non-Opioid Analgetika yang bekerja pada reseptor opioid. Nyeri akibat tindakan diagnostik. Pada penderita dengan gangguan fungsi ginjal atau hati. Dolika tidak boleh diberikan lebih lama daripada yang diperlukan. perlu dilakukan penyesuaian dosis. dapat ditambahkan injeksi 1 ml Dolika atau 1 kapsul Dolika setelah selang waktu 30 .

00 BELI DOLO FENAC iniamme Monomtrate + Lyanocobalamin Vitamin Neurotropik + NSAID Komposisi : Setiap tablet salut enterik mengandung: . hipnotika. obstipasi. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi Tramadol dengan cepat. Sebaliknya penggunaan tramadol bersama dengan tranquiliser juga dapat meningkatkan efek analgesiknya. Penderita yang hipersensitif terhadap tramadol atau opiat. hipnotika) dapat meningkatkan efek sedasinya. Dolo fenac CODE: C24 Harga Per Satuan Terkecil : Rp3. sedasi. kulit kemerahan. lelah. Penderita yang mendapat pengobatan penghambat MAO.100. Simpan di tempat kering dan sejuk. mulut kering dan sakit kepala. dispepsia. berkeringat. CARA PENYIMPANAN Jauhkan dari jangkauan anak-anak. efek samping berikut dapat terjadi pada pengobatan Dolika : mual.- Sama seperti analgesik sentral lainnya. INTERAKSI OBAT Penggunaan injeksi Dolika bersama dengan obat-obat yang bekerja pada SSP (seperti tranquiliser. KONTRA INDIKASI Intoksikasi akut dengan alkohol. sampai sekarang terbukti insidens ketergantungan setelah penggunaan Dolika jarang dijumpai. pruritus. terhindar dari cahaya. Meskipun tramadol berinteraksi dengan reseptor opiat. muntah. analgesik atau obat-obat yang mempengaruhi SSP lainnya. pusing.

edema. yang merupakan koenzim reaksi karboksilasi dan transaminasi. Obat ini harus diberikan dengan hati-hati pada pasien dengan gangguan ginjal. anti inflamasi analgesik. lebih baik setelah makan. Thiamin penting untuk metabolisme karbohidrat. dengan demikian mempengaruhi pematangan sel dan memelihara keutuhan jaringan syaraf. dan gangguan koagulasi pada pasien dengan penyakit kardiovaskular atau hipertensi. Pada anak. mempunyai efek sebagai anti rematik.pada pasien dengan dehidrasi. Efek anti inflamasi serta efek farmakologis lainnya berhubungan dengan efek penghambatan sintesa prostaglandin. dalam tubuh dikonversi menjadi bentuk aktifnya thiamin pirofosfat yang merupakan koenzim pada reaksi dekarboksilasi asam aketo. berfungsi terutama dalam metabolisme protein dan asam amino. Perhatian : Diclofenac dapat menyebabkan retensi cairan. Perhatian atau larangan penggunaan selama hamil dan menyusui : . akan meningkatkan resiko toksisitas ginjal. efektivitas dan banannya belum diketahui. Pyridoxol HCI di dalam tubuh diubah menjadi pyridoxol fosfat. hati dan jantung penderita usia lanjut.OiclofenacSodium Pyridoxol HCI Thiamine Mononitrate Vitamin B12 Mekanisme Kerja : 50 mg 50 mg 50 mg 1 mg Diclofenac merupaKan obat anti inflamasi non steroid.s diperiukan dalam sintesis asam nukleat dan mielin. pemberian Diclofenac bersama NSAID lainnya tidak direkomendasikan. Pasien dapat diobati dalam waktu lama iika diperiukan sesuai anjurandokter. Indikasi : Meringankan rasa sakitsedangsampai beratyangdisertai neuritisdan/atau neuralgia. Dosis dan Pemberian Tiga tablet per hari.Penderita dengan luka atau pendarahan pada saluran cerna. Vitamin B. Untun oengobatan inflamasi dan penyakit-penyakit rematik degeneratif.

diare berdarah.Kadang-kadang terjadi: colitis ulserativa atau Crohn's procto'colitis' gingivostomatitis. hati dan ginjal harus diteliti terlebih dahulu. Efek samping : Ada laporan tersendiri mengenai reaksi pada pemberian parenteral thiamin dan vitamin B12 untuk jangka panjang. konstipasi. reaksi fotosensitif. lesi esophagus. hematemesis ulkus perforasi. gangguan ingatan. Kulit (kasus tersendiri) : vesicular eruptions.gangguan sensoris dan visuat. perdarahan usus. insufisiensi renal akut. Sebelum meresepkan obat ini. Polycythemia vera. purpura. alopecia.Tfitasi psikotik.Kasus yang jarang:parestesia. erythroderma (exfoliative dermatitis). kondisi sistim pencernaan.Obat tidak boleh digunakan selama kehamilan dan menyusui. dispepsia. glositis. . Sistem saraf pusat : dizziness.sakit kepala. sindroma Stevens-Johnson toxic epidermal necrolysis.kelelahan. eczema. flatulence. muntah. Ginjal (kasusjarang): hematuria. mutagenik dan teratogenik dan efek pada fertilitas: Tidak ada bukti efek karsinogenik. Sistem pencernaan : sakit perut. insomma. Pada penghentian pyridoxol. disorienteasi. Erupsi kulit dan reaksi hipersensitifitas lain yang diketahui disebabkan oleh formulas! ini. retensi urin. erythema multiforme. hal ini dihubungkan dengan hipersensitifas yang jarang terjadi. mual. Perhatian dan kemungkinan efek karsinogenik. Pemberian pyridoxol dosis tinggi dapat menyebabkan smdroma neuropati sensoris tertentu. ada perbaikan bertahap pada disfungsi neuronal dan pemulihan secara menyeluruh pada pasien-pasienini. anoreksia. diare. mutagenik dan teratogenik atau efek fertilitas pada studi manusia atau hewan.pusing. proteinuria. gangguan rasa.jarang terjadi : gastroduodenal hemoragik (perdarahan gastro-duodenal).TJhnifus. meskipun studi histopatologik tidak menunjukkan adanya hubungan smdroma tersebut dengan semua tingkatan degenerasi neuronal.

Penggunaan penicillamine yang diperpanjang dapat menyebabkan kekurangan vitamin B. Jika pyridoxol diberikan bersama cyclosporine.leucopenia. meskipun signifikansinya tidakjelas. Interaksi : Thiamin dilaporkan berpotensi terjadinya penghambatan neuromuscular. hepatitis. edema. .s dan pemberian pyridoxine menurunkan efek samping neuronal dengan penggunaan obat-obat ini. reaksi anafilaksis. Cycloserine dan hydralazine adalah vitamin B. urticaria atau rhinitis yang dipicu oleh asam asetilsalisilik atau derifatnya. kadar plasma ada kemungkinan menurun. Hipersensitifitas (kasus jarang) : arterial hypotension. Polycythemia vera. Pengobatan dengan pyridoxol HCI 200 mg per hari selama satu bulan menurunkan sampai 50% konsentrasi serum phenobarbital dan phenytoin. Vitamin B12 tidak boleh diberikan pada tingkat awal penyakit Leber (atrophl hereditari dari saraf optik).agranulocytosis.aplastic anemia. Pemberian carbidopa dengan levodopa secara bersamaan menghambat efek pyridoxol Pyridoxol HCI tidak boleh diberikan pada dosis lebih tinggi daripada 5 mg per hari pada pasien yang sedanq diobati dengan levodopa saja. Qastroduodenal/peptic ulcer.hemolyticanemia. Pasien yang mengalami bronchial. Darah ( kasus tersendiri) : thrombocytopenia. dengan atau tanpa penyakit kuning.. antagon. Kontraindikasi : Hipersensitifitas terhadap obat ini. Pyridoxol fosfat menyebabkan dekarboksilasi perifer levodopa sehingga menurunkan efikasi pada pengobatan penyakit Parkinson.Hati (kasus jarang) : peningkatan aktifitas aminotransferase (glutamic-pyruvic dan glutamic-oxaloacetic transaminases).

Tindakan berikut ini harus dilakukan: bilas lambung dan pemberian charcoal aktif. Pemberian kloramfenikol dan vitamin B„ secara simultan dapat memperburuk responhemopoietic terhadap vitamin. asam aminosalisilik dan garamnya.. Prednisone dilaporkan meningkatkan absorpsi vitamin B12 dan sekresi faktor intrinsik pada beberapa pasien dengan anemia pernicious. Neuropathy sensoris dan sindroma neuropati sensoris lainnya yang disebabkan pemberian pyridoxol megadoses akan sembuh dan pulih kembali dengan penghentian pengobatan. golongan potasium lepas lambat. Pemberian neomycin dan colchicine secara simultan memperburuk absorbs! vitamin B secara oral. Pasien diobati dengan antikoagulan harus dimonitor dengan ketat Obat-obat antnnflamasi nonsteroid harus dihentikan 24 jam sebelum memulai pengobatan dengan metotreksat untuk mencegah peningkatan plasma cytostatic dan kejadian efektoksik. iritasi pada usus halus oleh kobalt. tetapi tidak pada pasien dengan gastrectomy parsial atau total Kepentingan klinis dan observas* ini tidak diketahui. iritasi gastrointestinal. harus diperhatikan kemungkinan ini pada saat meresepkan dosis tinggi asam askorbat dengan vitamin B12.00 BELI DOLO MEGANEURON Kaplet Salut Selaput KOMPOSISI : . Diclofenac menurunkan aktivitas obat-obat diuretik. primidone). Pemberian diclofenac dengan obat-obat lithium-based atau digoxin atau siklosporin atau metotreksat secara simultan dapat menyebabkan peningkatan plasma obat-obat ini. Kemasan : Boks lO blister® lO tablet salut enterik Dolo Meganeuron Harga Per Satuan Terkecil : Rp750. dan oleh asupan aikohol yang berlebihan selama lebih dan 2 minggu. Overdosisatau ingestion taksengaja:Gejala dan Penanganan (Antidot) Tidak ada kasus yang dilaporkan tentang overdosis dengan thiamin atau vitamin B. Pengukuran pendukung harus dilakukan untuk mengobati hipotensi. insufisiensi qinial konvulsi. pengobatan pennnjang dan simptomatik harus dilakukan Tidak ada gambaran spesifik mengenai hal itu.Absorpsi vitamin B„ di sistim gastrointestinal dapatditurunkan dengan pemberian berikut ini aminoglikosida colchicme. Asam askorbat dapat menghancurkan jumlah vitamin B12 secara signifikan dan faktor intrinsik dalam kondisi in vitro. antikonvulsan (phenytoin' phenobarbital. Penggunaan antiinflamasi nonsteroid lain secara bersamaan dapat meningkatkan resikoefeksampingvangtidakdiinginkan. dan supresi pernafasan. Monitoring yang cukup direkomendasikan untuk kasus-kasus ml. Pada kasus intoksikasi akut dengan diclofenac.

bursitis. INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia. mempunyai waktu paruh 1 -4 jam. sakit punggung. sindroma bahu-lengan. Pyrldoxine HCl dan Cyanocobalamine dalam dosis besar dapat membantu memelihara fungsi sel-sel saraf. terutama pada keadaan sakit yang berat. Thiamine HCl. lumbago. gangguan fungsi hati atau ginjal. Diabsorpsl dan saluran pencemaan. Hati-hati dengan penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah.Tiap Kaplet Salul Selaput mengandung: Methampyrane TniamineHCI Pyridoxine HCl Cyanooobalamine 500 mg 50 mg 100 mg 100 mg FARMAKOLOGI : Methampyrone bekerja sebagai analgesia. Karena dapat menimbulkarragranulositosis yang berakibat fatal. PERINGATAN DAN PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lama untuk mengatasi rasa sakit akut. . KONTRA INDIKASI : Penderita hipersensitif. Bayi dibawah 6 bulan. Penderita dengan tekanan darah sistolik < 100 mmHg. maka sebaiknya tidak digunakan dalam jangka waktu terus menerus. Wanita hamil dan menyusui.

10 strip @ 10 kaplet salut selaput No.1 Dolocap Harga Per Satuan Terkecil : Rp1.EFEK SAMPING : Reaksi hipersensitifitas: reaksi pada kulit misal kemerahan. Agranulositosis.00 BELI DOLOCAP capsul KOMPOSISI : Tiap kapsul mengandung: Tramadol HCI 50 mg FARMAKOLOGI : Tramadol HCI merupakan suatu analgetik opioid. EMBA MEGAFARMA SEMARANG . .Reg.900.032.: DKL 9815706509 A1 SIMPAN DITEMPAT YANG SEJUK DAN KERING HARUS DENGAN RESEP DOKTER Produksi: PT. DOSIS : 1 Kaplet salut selaput 3 kali sehari KEMASAN : Dus.INDONESIA R.

seperti pada golongan analgesik opiat (analgesik sentral) dapat terjadi: mual. vertigo. hypotermia. confusion. kelelahan dan miosis. dispepsia. Pada anak-anak dan bayi dapat terjadi kejang-kejang. muntah. koma. Nyeri pasca bedah. kulit kemerahan. OVER DOSIS : • • Pada pemberian over dosis dapat terjadi miosis. EFEK SAMPING : • • • • Pada dosis normal. berkeringat. kolaps kardiovaskular. sembelit. Penderita yang mendapat pengobatan MAO inhibitor. KONTRA INDIKASI: • • • • Penderita yang hipersensitif terhadap Tramadol atau opiat. DOSIS : Dosis yang diberikan disesuaikan dengan intensitas nyeri lazimnya : • 1 kapsul sehari (maksimum 8 kapsul per hari). drowsiness. hypotension. muntah. kejang dan depressi pernapasan. Pada dosis lebih besar dapat menyebabkan depressi pernapasan dan hipotensi dengan kegagalan sirkulasi dan koma. hipnotika. apabila masih terasa nyeri dapat ditambahkan 1 kapsul setelah selang 30 . palpitasi. mungkin juga dapat terjadi spasme uterik atau biliary. terutama dengan adanya cyanosis. . Intoksikasi akut dengan alkohol. Dosis tersebut di atas biasanya cukup untuk meredakan nyeri. atau obat-obat analgetik opiat atau obat-obatyang mempengaruhi SSP lainnya.60 menit. Mulut kering.INDIKASI : • • Digunakan untuk: Nyeri akut dan kronik yang berat. Penderita dengan depressi pernapasan. brandikardia orthostatic. Untuk mengatasi depressi pernapasan dan syok dengan Naloxone HCI. sodasi.

dapat menyebabkan ketergantungan. INTERAKSI OBAT : • Efek depressi / sedasi diperkuat dengan adanya obat-obat yang bekerja pada SSP seperti : alkohol.1% Tramadol diekskresikan melalui ASI. KEMASAN : Dos berisi 5 blister® 10 kapsul PENYIMPANAN : Simpanlah di tempat yang sejuk. obat-obat hipnotika. Pada pengobatan jangka panjang. Oleh karena itu dokter harus menentukan dengan jelas lama pengobatan. Hati -hati pemberian pada ibu menyusui karena 0. Keracunan akut lewat mulut dapat diatasi dengan pengosongan lambung. Pemberian pada wanita hamil harus dipertimbangkan manfaat dan resiko yang mungkin terjadi. PERHATIAN : • • • • • • • • Tramadol tidak boleh digunakan pada penderita ketergantungan obat. peningkatan tekanan intra kranial. HARUS DENGAN RESEP DOKTER. Tramadol tidak dapat menekan gejala "witdrawal" akibat pemberian morfin. Tidak boleh diberikan lebih lama dari petunjuk dokter. gangguan fungsi ginjal dan hati yang berat. hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok.• Nalorphine HBr. . tranquillizer. Levallorphan tartrat. • Sebaliknya penggunaan Tramadol bersama dengan tranquillizer juga dapat meningkatkan efekanalgesiknya. kering dan terlindung dari cahaya. Hati-hati bila digunakan pada penderita trauma kepala. Meskipun termasuk antagonis opiat. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. sedangkan kejang dapat ditekan dengan pemberian Benzodiazepin. antidepressan trisiklik dan anestetika. Dapat terjadi penurunan fungsi paru bila Tramadol digunakan bersama dengan obat-obat penekan SSP lainnya atau bila penggunaan melebihi dosis yang dianjurkan.

terutama dalam bentuk metabolitnya. Asam Mefenamat diserap dari traktus gastro intestinal dan kadar dalam sirkulasi mencapai puncaknya dalam waktu 2 jam setelah pemberian obat. sakit gigi. Dibandingkan dengan aspirin. nyeri waktu haid. INDIKASI : Untuk menghilangkan rasa nyeri pada sakit kepaia. demam pada anak-anak dan dewasa. DOLODON Suspensi dengan rasa pisang yang enak dan manis disiapkan untuk anakanak dan penderita yang mengalami kesulitan menelan kapsul atau captab. FARMAKOLOGI : DOLODON berisi Asam Mefenamat yang merupakan derivat asam antrani-lat. Dalam waktu 48 jam.Dolodon CODE: C25 Harga Per Satuan Terkecil : Rp250. yaitu analog amin asam salisilat. nyeri pasca bedah dan persalinan.00 BELI DOLODON kapsul * captab * suspensi capsule * captab * suspension KOMPOS1SI : DOLODON 250 Kapsul : DOLODON 500 Captab : DOLODON Suspensi : Tiap kapsul berisi 250 mg Asam Mefenamat Tiap captab mengandung 500 mg Asam Mefenamat Tiap sendok takar (5ml) suspensi mengandung 50 mg Asam Mefenamat. KONTRA INDIKASI : Penderita tukak lambung . ± 50 % dari dosis yang diberikan ditemukan kembaii dalam urine. nyeri rematik. yang mempunyai daya antipiretik dan anatgesik dengan potensi yang sama dengan aspirin dan dengan sedikit daya anti inflamasi. Asam Mefenamat ku-rang menyebabkan terjadinya pendarahan gastrointestinal.

dosis koumarin hams dikurangi. No. EFEK SAMPING : * * Dapat menyebabkan iritasi tractus gastro intestinal Skin rash dan diare dapat terjadi dan akan hiiang jika pengobatan dihentikan. SEDIAAN dan KEMASAN : * DOLODON 250 Kapsul : * DOLODON 500 Captab : * DOLODON Suspensi : Dus berisi 10 strip x 10 kapsul Reg. No. Atau menurut petunjuk dokter. Pemberian harap dihentikan setelah 7 hari tidak memberikan hasil. DKL 8714504104 A1 Botoi isi 60 ml netto Reg.Botol plastik isi 500 kapsul Reg. D 7812379-1 Dus berisi 10 strip x 10 captab Reg. paling lama 7 hari. D 7812379 . DOSIS : Dewasa : Anak-anak : Mula-mula 500 mg. Hati-hati pada penderita asma karena akan memperburuk keadaan. kemudian 250 mg setiap 6 jam 6.PERINGATAN & PERHATIAN : * * * * * Dapat mengurangi jumiah trombosit. No. 3 kali se-hari dengan interval 6 sampai 8 jam.5 mg Asam Mefenamat per kilogram berat badan. No. Hati-hati pada penderita gangguan fungsi hati dan ginjal. DKL 8714504033 A1 HARUS DENGAN RESEP DOKTER . Sebaiknya tidak diberikan pada wanita hamil dan wanita menyusui. PENYIMPANAN : Simpan pada suhu dibawah 30°C. terutama bila digunakan bersama-an antikoagulan koumarin.

500.Produksi : PT MECOSIN INDONESIA JAKARTA Dolofen-F CODE: C26 Harga Per Satuan Terkecil : Rp500. INDIKASI : Menghilangkan rasa nyeri dan gejala arthritis reumetoid dan osteoarthritis. DOSIS : 3 x sehari 1 kaplet / kapsul . KEMASAN : ( HNA + ) Dos 10 x 10 kapsul Duplopyrin Strip CODE: C111 Harga Per Satuan Terkecil : Rp2.00 BELI DOLOFEN – F Ibu profen 400 mg.00 BELI Duplopyrin KOMPOSISI : Tiap tablet DUPLOPYRIN mengandung : Fenilbutazon 125 mg Etoksibensamid 125 mg Aluminium Hidroksida Gel kering 100 mg Magnesium Trisilikat 5H2O 150 mg .

hati atau kardiovaskuler. KONTRA INDIKASI Hipertensi. gangguan fungsi ginjal. Disesuaikan dengan usia dan berat badan. juga pada penyakit tiroid dapat terjadi penahanan fungsi sumsum tulang.INDIKASI Penyakit Rheumatik termasuk rheumatoid arthritis. CARA PENYIMPANAN : Simpan di tempat kering. Dapat menghambat absorpsi tetrasiklin dan vitamin-vitamin serta memperlambat absorpsi quinidin. Harus berhati-hati pemberiannya pada penderita dengan gastritis. 2815773-1 . No. 2815773 Dus isi 24 blister @10 tablet . pada suhu kamar (25-30°C) dan terlindung dan bahaya KEMASAN : Kaleng plastik isi 1000 tablet . Reg. : D. Reg. gouty arthritis. ankylosing spondylitis. tukak lambung. PERINGATAN & PERHATIAN : Hati-hati penggunaan pada penderita ulkus peptikum. Magnesium Trisilikat dalam bentuk garam magnesium mudah diserap dan bila terjadi gangguan fungsi ginjal dapat menyebabkan keracunan magnesium. INTERAKSI OBAT : Dapat meningkatkan etek tolbutamide dan kumarin. : D. osteo arthritis. No. Atau menurut petunjuk Anak-anak : dokter. hipersensitivitas serta gangguan fungsi jantung. ATURAN PAKAI : Dewasa : 1 tablet 3 kali sehari. ginjal dan hati.

......INDONESIA Eflagen 25 CODE: C112 Harga Per Satuan Terkecil : Rp1...250. seperti operasi gigi dan tulang. INDIKASI EFLAGEN diindikasikan : Sebagai pengobatan jangka pendek untuk kondisi akut sebagai berikut: Sebagai adjuvant pada nyeri Inflamasi berat dari Infeksi telinga. * nyeri Inflamasi setelah trauma..25 mg/ 50 mg FARMAKOLOGI EFILAGEN mengandung Kalium Diklofenak yaitu suatu anti-inflamasi nonsteroidal CAINS. akan tetapi penghambatannya terhadap sintesa prostaglandin (siklo-oksigenase) dapat dikaitkan dengan aktivitas anti-inflamasi.. Secara farmakologi Diklofenak menunjukkan aktivitas anti-inflamasi.. Coronet Crown PHARMACEUTICAL INDUSTRIES SURABAYA . analgesik dan antipiretik.. - KONTRA-INDIKASI Hipersensitivitas terhadap Kalium Diklofenak...00 BELI EFLAGEN Tiap tablet mengandung : Kalium Diklofenak......... seperti terkilir..... hidung atau tenggorokan... Seperti obat-obat AINS yang lain mekanisme kerja belum diketahui....... * nyeri dan inflamasi setelah operasi..HARUS DENGAN RESEP DOKTER PT.

edema (Jarang). agra-nulositosis Darah: (sangat jarang). Pada kasus-kasus sedang dan untuk 75 . Sistem saraf pusat: pusing. trombositopenia. impoten. palpitasi. eritema multiformis. kram perut. HARUS DENGAN RESEP DOKTER KEMASAN EFLAGEN 35: No. telinga berdenging. Kulit: urtikaria. urtikarta atau rinitis akut yang ditimbulkan oleh asam asetil salisllat atau obat-obat lain yang menghambat sintesa prostaglandin. sakit kepala. Hati: peningkatan enzim SGOT. mual. INTERAKSI OBAT Pemberian bersamaan dengan litium atau digoksin dapat meningkatkan konsentrasi litium atau digosin dalam plasma. DOSIS Dewasa : dosis awal 100 -150 mg/hari dalam 2 .- Tukak lambung. muntah.3 dosis terbagi.100 mg / hari. Reg. Pemberian bersamaan dengan diuretik hemat kalium dapat disertai dengan kenaikan kadar kalium dalam darah. eksim. nyeri dada. EFEK SAMPING Efek samping yang mungkin terjadi pada : nyeri lambung. Ginjal: gangguan fungsi ginjal. anemia. SGPT dan hepatitis (Jarang). leukopenia. Pemberian bersamaan dengan antikoagulan perinah dilaporkan dapat meningkatkan resiko perdarahan. penderita dalam serangan asma.: Dus Isi 5 strip @ 10 tablet DKLV722222015A1 . Pemberian bersamaan dengan metotreksat dapat meningkatkan toksisitas metotreksat. Lain-lain: hipertensi. Pemberian bersamaan dengan AINS sistemik dapat meningkatkan terjadinya efek samping. vertigo. diare. anak-anak usia > 14 tahun: tidak boleh diberikan pada anak-anak usia Anak-anak : < 14 tahun. Saluran pencernaan: dispepsia.

: Dus isi 5 strip @ 10 tablet DKL9722222015B1 .EFLAGEN 50: No. Reg.

Sign up to vote on this title
UsefulNot useful