Analgesik, antiinflamasi http://www.farmasiku.com/index.php?

target=categories&category_id=171 Analgesik adalah obat yang dapat mengurangi atau menghilangkan rasa nyeri dan akhirnya akan memberikan rasa nyaman pada orang yang menderita. Anti inflamasi adalah obat yang dapat menghilangkan radang yang disebabkan bukan karena mikroorganisme (non infeksi). Gejala inflamasi Inflamasi dapat disertai dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Proses inflamasi meliputi kerusakan mikrovaskuler, meningkatnya permeabilitas vaskuler dan migrasi leukosit ke jaringan radang, dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Mediator yang dilepaskan antara lain histamin, bradikinin, leukotrin, Prostaglandin dan PAF. Penanganan inflamasi 1 2 3 4 5 6 7 Derivat Asam Salisilat à Aspirin, Benorilat, Diflunisal, Salsalat Derivat Asam Propionat à As.Tiaprofenat, Fenbufen, Flurbiprofen, Ibuprofen, Ketoprofen, Naproksen Derivat.As.Fenamat à As.Mefenamat, Meklofenamat Derivat As.Fenilasetat à Diklofenak, Fenklofenak Derivat Oksikam à Piroksikam, Tenoksikam Der.As.Asetat inden/indol à Indometasin, Sulindak, Tolmetin Deriva Pirazolon à Azapropazon, Fenilbutazon, Oksifenbutazon

ABDIFLAM CODE: C29 Harga Per Satuan Terkecil : Rp1,350.00 Abdiflam Natrium diklofenak 25 mg; 50 mg. Indikasi: sakit pasca traumatik inflamatori, inflamasi dan bentuk degeneratif rematik, rematik non artikular. Dosis: Dewasa: awal: sehari100-150 mg dalam dosis terbagi 2-3x; Anak 14th: 75-100 mg sehari dalam dosis bagi 2-3x. Kemasan: 5 x 10 tablet 50 mg.

AFI RHEUMA CODE: C1

Harga Per Satuan Terkecil : Rp2,300.00 BELI AFI RHEUMA KAPSUL KOMpOSISI : Tiap kapsul mengandung : 4 butil 1,2 difenilpirazolidina 3,5 dion ................... 100 mg CARA KERJA OBAT : Sebagai anti radang dan analgetik INDIKASI : Ankylosing spondylitis, acute gouty arthritis, active rheumatoid arthritis. CARA PEMAKAIAN: Dewasa 2-3 kali sehari 1 kapsul, sesudah makan atau diminum dengan susu, seyogyanya sesuai petunjuk dokter. EFEK SAMPING: - Iritasi gastrointestinal (mual, muntah, rasa terbakar pada lambung). - Retensi : Cairan, edema, rash. - Gangguan hematologi yang serius (leukopenia, agranulositopenia, aplastik-anemia). - Alergi INTERAKSI OBAT: Jangan diberikan bersama - sama dengan : Kumarinantikoagulan, insulin, fenitoin, oral hipoglikemik. KEMASAN : Box isi 10 blister @ 12 kapsul Reg. No. DKL 8901700901 A1 Simpanlah obat ini ditempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER Allogon 500 Harga Per Satuan Terkecil : Rp700.00 BELI ALLOGON 500 mg. Komposisi Mefenamic acid/Asam mefenamat INDIKASI Nyeri ringan, sedang sampai berat seperti sakit kepala, nyeri otot, artralgia (nyeri sendi), sakit gigi, osteoartitis rematoid, gout, nyeri saat haid, nyeri setelah operasi, nyeri setelah terjadi patah tulang, nyeri setelah melahirkan, neuralgia (nyeri pada saraf), dan nyeri pada organ-organ dalam perut. KONTRA INDIKASI Gastritis, ulkus lambung, dan anemia hemolitik. PERHATIAN Kehamilan, dehidrasi, epilepsi, asma. Interaksi obat : antikoagulan oral. EFEK SAMPING

Gangguan & perdarahan saluran pencernaan, ulkus peptikum, sakit kepala, gugup, insomnia (sulit tidur), biduran/kaligata, kemerahan pada kulit, pembengkakan wajah. INDEKS KEAMANAN PADA WANITA HAMIL C: Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin. KEMASAN Kaplet 500 mg x 2 x 10 butir. DOSIS Dewasa : 250-500 mg tiap 6 jam sekali. Anak-anak : 6,5 mg/kg berat badan tiap 6-8 jam sekali. Nyeri saat : diawali dengan 500 mg, kemudian 250 mg tiap 6 jam. haid PENYAJIAN Dikonsumsi bersamaan dengan makanan PABRIK Konimex. Analsik CODE: C2 Harga Per Satuan Terkecil : Rp1,150.00 ANALSIK Tiap kaptet mengandung : Metampiron 500 mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. Metampiron adalah suatu obat analgesik- antipiretik. Diazepam mempunyai kerja sebagai antiansietas, juga memiliki sifat relaksasi otot rangka. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral. INDIKASi : Untuk meringankan rasa nyeri sedang sampai berat, ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam. Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg, wanita hamil dan menyusui. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. Glaukoma sudut sempit, keadaan psikosis akut. EFEK SAMPING : Dapat menimbulkan agranulositosis. Reaksi hipersensitivitas, reaksi pada kulit,ngantuk,pusing,lelah yang berlebihan. Konstipasi, depresi, diplopia, hipotensi, jaundice, perubahan libido, mual, tremor, retensi urin, vertigo. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan

Metampiron adalah suatu obat analgesik. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri.00 ANALSIK Tiap kaptet mengandung : Metampiron 500mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. INDIKASI : Untuk meringankan rasa nyeri sedang sampai berat. DOSIS : 1 kaplet. Walaupun jarang menimbulkan agranulositosis. Dibuat oleh : PT SANBE FARMA Bandung . karena dapat berakibat fatal. wanita hamil dan menyusui. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral. ansietas.Indonesia Analspec CODE: C3 Harga Per Satuan Terkecil : Rp1. lumbago.antipiretik.- darah/kelainan darah.250. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut. Reg. maksimum 4 kaplet sehari. Diazepam mempunyai kerja sebagai antiansietas. sindroma bahu lengan. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. sebaik-nya tidak digunakan untuk jangka pahjang. No.bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam. sakit punggung. PENYIMPANAN Simpan pada suhu kamar (25°.halusinasi dan gangguan tidur. bursitis. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam. ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. . HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet. Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut.30°C). gangguan fungsi hati atau ginjal. Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg.: DPL8822208609A1. juga memiliki sifat relaksasi otot rangka.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam.sama dengan obat . Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik. INTERAKSI OBAT : Penggunaan bersama .

maksimum 4 kaplet sehari. keadaan psikosis akut. perubahan libido. Reaksi hipersensitivitas. No. gangguan fungsi hati atau ginjal.Glaukoma sudut sempit.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam. Walaupun jarang menimbulkan agranulositosis. HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet. PENYIMPANAN Simpan pada suhu kamar (25°. karena dapat berakibat fatal. depresi. Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik. Reg.halusinasi dan gangguan tidur. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. EFEK SAMPING : Dapat menimbulkan agranulositosis. diplopia.00 ANASTAN (Mefenamic Acid) 500 mg .ngantuk. Dibuat oleh : PT SANBE FARMA Bandung . vertigo. reaksi pada kulit.Indonesia Anastan CODE: C4 Harga Per Satuan Terkecil : Rp250. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri. ansietas. Konstipasi.pusing. retensi urin. sebaik-nya tidak digunakan untuk jangka pahjang.bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam. mual. tremor. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. jaundice. bursitis. sindroma bahu lengan. hipotensi.30°C). DOSIS : 1 kaplet.sama dengan obat . lumbago. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin.: DPL8822208609A1.lelah yang berlebihan. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut. sakit punggung. INTERAKSI OBAT : Penggunaan bersama . Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut.

: Awal 1 kaplet (500 mg) kemudian Vi kaplet (250 mg) tiap 6 Indikasi : Sebagai obat untuk meringankan rasa sakit seperti pada sakit gigi. Juga dapat timbul kantuk.hati pada penderita yang mendapat bronkospasma. Digunakart tidak lebih dari 7 hari. Hati . sakit kepaia. aiergik rinrtis atau urticaria karena obat non steroid anti inflamasi yang lain.anak diatas 14 tahun : - Anastan forte jam.00 Antalgin . sehingga billirubin urine positif dan protein uria positif. bila cfiare maka pengobatan dihentikan. Cara penyimpanan : Disimpan di tempat tertutup dan diluar pengaruh cahaya. Juga pada penderita gangguan fungsi ginjal atau pernah menderita sakit ginjal atau hati. Dapat timbul asma. mengurangi kerja obat anti coagulant. berkhasiat analgesic dan anti inflamasi. thrombocytopenia. Wanita mengandung atau sedang menyusui. Dapat timbul agranucytosis. Efek samping : Dapat timbul diare biasa hingga berat. anemia. Harus dengan resep dokter No. sehingga hemoiytic anemia coombs positif. Reg. nyeri sesudah operasi dan dysmenorrhoea primer. Komposisi : Tiap kaplet mengandung Acidum Mefenamicum 500 mg (Anastan Forte). Kontra indikasi : Obat kontra indikasi bagi penderita sakit tukak lambung atau inflamasi pada saluran cerna. Keamanan penggunaan pada anak . Peringatan dan Perhatian : Dalam pengooatan. Enteraksi obat : Dengan obat anti coagulant. karena kemungkinan terjadi" cross sensitivity". nervous dan sakit kepala. Kemasan : Anastan forte : Dos isi 10 strip @ 10 kaplet. nausea dezziness. Mempengaruhi test darah. Tiap kapsul mengandung Acidum Mefenamicum 250 mg.anak dibawah 14 tahun belum diketahui dengan pasti. : Anastan forte DKL 9207802304 A1 Antalgin CODE: C5 Harga Per Satuan Terkecil : Rp150. Posologi : Dewasa dan anak . Mempengaruhi test urine. Penderita asma.Anastan adalah obat yang mengandung Acidum Mefenamicum. albuminiea dan kencing darah. terjadi tukak lambung dan pendarahan.

Dosis dan Cara Penggunaan : Melalui mulut (per oral). kotak 10 blister @ 10 tablet No.Komposisi Tiap tablet mengandung antalgin 500 mg. botol 1000 tablet No. Pada penggunaan jangka panjang dapat menyebabkan agranulositosis. Indikasi : Untuk menghilangkan rasa sakit. Penderita dengan tekanan darah <100 mmHg. antipiretik danantiinflamasi. Bayi 3 bulan pertama atau dengan berat badandibawah 5 kg. WanitahamilteTutama^B bulan pertamanaTT6 minggu terakhir.00 ANTRAIN TABLET . Reg. terutama kolik dan sakit setelah operasi.Reg.30°C (kondisi penyimpanan. Tiga efek utama adalah sebagai analgesik.200. Kontra indikasi : Pada penderita yang alergi terhadap derivat pirazolon. Cara Penyimpanan : Simpan pada suhu 25° . Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.:GKL9420906010A1 HARUS DENGAN RESEP DOKTER INDO FARMA BEKASI – INDONESIA Antrain CODE: C6 Harga Per Satuan Terkecil : Rp10. Kasus porfiria hati (amat jarang) dan defisiensi bawaan glukosa-6-fosfat-dehidrogenase. Peringatan dan Perhatian : Karena dapat menimbulkan agranulositosis yang berakibat fatal. Penderita yang hipersensitif. Cara Kerja Obat : Antalgin adalah derivat metansulfonat dan amidopirina yang bekerja terhadap susunan saraf pusat yaitu mengurangi sensitivitas reseptor rasa nyeri dan mempengaruhi pusat pengatur suhu tubuh. Antalgin mudah larut dalam air dan mudah diabsorpsi ke dalam jaringan tubuh.: GKL9420906010A1 Antalgin 500 mg. Dewasa : sehari 3 kali 1 tablet. Efek Samping : Gejala kepekaan yang manifestasinya kelainan pada kulit. maka sebaiknya tidak digunakan terus-menerus dalam jangka panjang. normal).INJEKSI© . Kemasan dan Nomor Registrasi Antalgin 500 mg.

Agranulositosis. maka sebaiknya tidak digunakan dalam jangka panjang. atau I. Penderita dengan tekanan darah sistolik < 100 mmHg.maksimum 4 tablet sehari.: DKL0117616843A1 JAUHKAN DARI JANGKAUAN ANAK . Injeksi : 500 mg jika sakit timbul. Pada pemakaian jangka lama dapat menimbulkan sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan. diabsorpsi dari saluran pencernaan mempunyai waktu paruh 1-4 jam.lumbago. Bayi di bawah 3 buian atau dengan berat badan kurang dari 5 kg. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. berikutnya 500 mg tiap 6-8 jam. Wanita hamil dan menyusui. berikutnya 1 tablet tiap 6-8 jam. Mekanisme kerjanya adalah menghambat transmisi rasa sakit ke susunan saraf pusat dan perifer. maksimum 3 kali sehari.terutama nyeri kolik operasi.bursitis. Metamizole Na bekerja sebagai analgesik. No.sindroma bahu lengan.:DKL7617611210A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA ANTRAIN* Injeksi Kotak berisi 5 ampul @ 2 ml netto Reg. INTERAKSI OBAT : Bila Metamizole Na diberikan bersamaan dengan Chlorpromazine dapat mengakibatkan hipotermia. KONTRA INDIKASI : Penderita hipersensitif terhadap Metamizole Na. PERINGATAN / PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik.V. ATURAN PAKAI : Dewasa: Tablet : 1 tablet jika sakit timbul. diberikan secara injeksi I. EFEK SAMPING : Reaksi hipersensitivitas: reaksi pada kulitmisal kemerahan. KEMASAN : ANTRAIN* Tablet Kotak berisi 10 strip @ 10 tablet Reg.KOMPOSISI : Tiap tablet mengandung : Metamizole Na 500 mg ANTRAINI Injeksi Tiap ml mengandung: Metamizole Na 500 mg CARA KERJA OBAT : Metamizole Na adalah derivat metansulfonat dari aminopirin yang mempunyai khasiat analgesik.M.ANAK HARUS DENGAN RESEP DOKTER . Karena dapat menimbulkan agranulositosis yang berakibat fatal.No. gangguan fungsi hati atau ginjal.sakit punggung. Karena itu perlu dilakukan pemeriksaan fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. INDIKASI : Untuk meringankan rasa sakit.

Indikasi : untuk meredakan rasa sakit seperti sakit gigi. muntah. Peringatan dan Perhatian Tidak dianjurkan diberikan pada wanita hamil dan menyusui. Indonesia Argesid 500mg Harga Per Satuan Terkecil : Rp1. usus. Mangundiprojo no. sakit kepala. dispepsia. Efek samping : Gangguan saluran cerna seperti iritasi lambung. Kontra indikasi : Tukak lambung. Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahui. Kemasan: ARGESID 250. mual. meredakan rasa nyeri seperti nyeri otot. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase sehingga mempunyai efek analgetik dan antiinflamasi. Hati-hati pemberian pada penderita bronkhospasme. asetosal. Tidak boleh melebihi dosis yang dianjurkan dan lebih dari 7 hari. Box 10 Strip @10 Kapsul. karena dapat terjadi sensitivitas silang. pusing. nyeri sesudah operasi.100. Sidoarjo-61252 Jawa Timur. Interbat Jl. 1 Buduran.00 ARGESID Asam Mefenamat KOMPOSISI : ARGESID 250 Tiap kapsul mengandung Asam Mefenamat 250 mg. H. No. radang gangguan ginjal. ruam makulo papular. hipersensitif usus. sakit kepala. ARGESID 500 Tiap Kaplet salut selaput mengandung Asam Mefenamat 500 mg Farmakologi : Asam Mefenamat merupakan anti inflamasi non-steroid. kolik.R. nyeri saat melahirkan. vertigo.: DKL0033201I301A1 ARGESID 500 .SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA JANGAN DISIMPAN DALAM LEMARI PEMBEKU Diproduksi Oleh : PT. Reg. alergik rinitis. nyeri karena trauma.M. Interaksi Obat : Obat-obatan antikoagulan oral seperti warfarin. Dosis : Dewasa dan anak-anak di atas 14 tahun: Dosis awal 500mg kemudian dilanjutkan 250 mg tiap 6 jam. dismenore. urtikaria atau mendapat pengobatan antiinflamasi non-steroid lainnya. kecuali atas petunjuk dokter. diare. Pada penggunaan terusmenerus dengan dosis 2000 mg atau lebih sehari dapat mengakibatkan agranulositosis dan hemolitik anemia.

muntah-muntah. Pendarahan gastrointestinal. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut. esofagitis. jarang terjadi fotosensitisasi.700. pendarahan gastro-intestinal makroskopik. Pada kulit : pruritus. rasa mual. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik).00 Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7.5 mg mengandung Meloxicam 7. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. ulkus gastroduodenal. KONTRA INDIKASI : Ulkus lambung yang aktif.: DKL0033201109A1 ( Simpan di tempat sejuk (15-25)°C dan kering ) HARUS DENGAN RESEP DOKTER PROMED PT. Anemia. diare. x Anakanak dan remaja yang berumur kurang dari 15 tahun. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1. analgesik. rasa sakit di perut. stomatitis. terutama . gangguan jumlah sel darah : lekosit. Penghambatan COX2 menentukan efek terapi NSAI.konstipasi. Mekanisme kerja meloxicam sebagai efek anti-inflamasi. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serumkreatinin dan/atau serum urea. ruam kulit. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. PROMEDRAHARDJO FARMASIINDUSTRI Sukabumi – Indonesia Artrilox 15 CODE: C8 Harga Per Satuan Terkecil : Rp7. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. jarang terjadi kolitis. Insufisiensi ginjal berat yang tidak didialisa. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. lekopenia dan trombosito penia. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma. Insufisiensi hepar yang berat. bersendawa. urtikaria.Box 10 Strip @10 Kaplet No. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya. polip dihidung. rasa kembung. Masa kehamilan dan menyusui. Reg. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). EFEK SAMPING : Saluran cerna : dispepsia. Bila diberikan bersama-sama dengan obat mielotoksik yang potent. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan.

Kardiovaskuler: edema. Seperti hal obat-obat NSAI.5 mg/hari. Sistem susunan saraf pusat : kepala terasa ringan. vertigo. Pernafasan : jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. Bila pemberian bersama obat anti koagulan tidak dapat dihindari. maka harus dimonitor efek - . sindrom nefrotik. Seperti pada obat-obat NSAI. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis.methotrexate. dianjurkan untuk menghentikan aktivitas. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. sindrom nefrotik dan penyakit ginjal. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. pusing. sirosis hati. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. dan pada umumnya orang tua menderita gangguan fungsi ginjal. Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. nekrosis medularis ginjal. heparin secara sistemik. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. Seperti halnya obat-obat NSAI lainnya. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). muka kemerahan. trombolitik dapat meningkatkan resiko pendarahan. Pasien yang beresiko tinggi adalah pasien yang dehidrasi. glomerulonefritis. Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. dosis meloxicam tidak boleh melebihi 7. Pemberian bersama ticlopidine (anti-koagulan oral). diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. Pada pasien yang volume & aliran darah ke ginjal menurun. tinitus. akan menyebabkan terjadinya sitopenia. ngantuk. hati ataupun jantung. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. Pada pasien tersebut. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. NSAI jarang menimbulkan nefritis interstitial. palpitasi. hati atau jantung. Bila kondisi ini dalam waktu lama. peningkatan tekanan darah. pasien dengan gagal jantung kongestif.

Reg. Osteoartritis:7. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak. Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam. sehingga perlu dimonitor fungsi ginjal.5 mg/hari tergantung respon klinis. DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari. Artritis reumatoid :15 mg/hari. Kontrasepsi : menurunkan efektivitas alat KB IUD.Reg. KEMASAN : Artrilox 7. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. ACE inhibitor.5 mg per hari.00 . sehingga akan mempercepat eliminasi meloxicam. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEPDOKTER Diproduksi oleh: COMBIPHAR BANDUNG-INDONESIA http://www. vasodilator. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate. Tablet harus ditelan dengan air/minuman pada waktu makan. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas.farmasiku. Dosis terapeutik dapat dikurangi sampai 7. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium. Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari. Pada pasien yang dehidrasi.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2. dianjurkan untuk memonitor jumlah sel darah.5 mg Tablet Box.DKL9904125810A1 Artrilox 15 mg Tablet Box. 2 Strip @ 10 Tablet No.5 CODE: C7 Harga Per Satuan Terkecil : Rp4.5 mg/hari. Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal.antikoagulan. Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7.700.5 mg per hari. 2 Strip @ 10 Tablet No. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut.com Artrilox 7.

esofagitis. jarang terjadi kolitis. diare. Insufisiensi hepar yang berat. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. Penghambatan COX2 menentukan efek terapi NSAI. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya. pendarahan gastro-intestinal makroskopik. KONTRA INDIKASI : Ulkus lambung yang aktif. analgesik. rasa mual. Insufisiensi ginjal berat yang tidak didialisa.BELI Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. Pendarahan gastrointestinal. Masa kehamilan dan menyusui. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik). konstipasi. EFEK SAMPING : Saluran cerna : dispepsia. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. polip dihidung.5 mg mengandung Meloxicam 7. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut. bersendawa. rasa kembung. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin. x Anakanak dan remaja yang berumur kurang dari 15 tahun. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). Mekanisme kerja meloxicam sebagai efek anti-inflamasi. muntah-muntah. rasa sakit di perut. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serum kreatinin . Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan. ulkus gastroduodenal.

Pada pasien yang volume & aliran darah ke ginjal menurun. Kardiovaskuler : edema. dianjurkan untuk menghentikan aktivitas. Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. muka kemerahan. - - - - . ngantuk. Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. Seperti halnya obat-obat NSAI lainnya. hati atau jantung. stomatitis. glomerulonefritis. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. nekrosis medularis ginjal. jarang terjadi fotosensitisasi. peningkatan tekanan darah. Pasien yang beresiko tinggi adalah pasien yang dehidrasi. akan menyebabkan terjadinya sitopenia. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. palpitasi. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. Seperti pada obat-obat NSAI. sirosis hati.5 mg/hari. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. Pada kulit : pruritus. Sistem susunan saraf pusat : kepala terasa ringan. Anemia. pusing. hati ataupun jantung. Bila diberikan bersama-sama dengan obat mielotoksik yang potent. sindrom nefrotik. lekopenia dan trombosito penia. vertigo. terutama methotrexate. NSAI jarang menimbulkan nefritis interstitial. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. Pada pasien tersebut. sindrom nefrotik dan penyakit ginjal. gangguan jumlah sel darah : lekosit. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. pasien dengan gagal jantung kongestif. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. tinitus. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). dan pada umumnya orang tua menderita gangguan fungsi ginjal. Bila kondisi ini dalam waktu lama. ruam kulit. urtikaria. Seperti hal obat-obat NSAI.- dan/atau serum urea. diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. dosis meloxicam tidak boleh melebihi 7. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. Pernafasan:jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo.

Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi. sehingga perlu dimonitor fungsi ginjal. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium. Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7. Artritis reumatoid :15 mg/hari.5 mg per hari. Dosis terapeutik dapat dikurangi sampai 7. Osteoartritis:7. trombolitik dapat meningkatkan resiko pendarahan. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi. Bila pemberian bersama obat anti koagulan tidak dapat dihindari.5 mg/hari. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker. dianjurkan untuk memonitor jumlah sel darah. maka harus dimonitor efek antikoagulan. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari. ACE inhibitor. - - - DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari. vasodilator. Kontrasepsi : menurunkan efektivitas alat KB IUD. Pemberian bersama ticlopidine (anti-koagulan oral). sehingga akan mempercepat eliminasi meloxicam. Pada pasien yang dehidrasi. heparin secara sistemik. Tablet harus ditelan dengan air/minuman pada waktu makan. . Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal. Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7.5 mg per hari.INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut.5 mg/hari tergantung respon klinis.

KEMASAN : Artrilox 7. 2 Strip @ 10 Tablet No.Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya.Reg. 2 Strip @ 10 Tablet No.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2.5 mg Tablet Box.DKL9904125810A1 Artrilox 15 mg Tablet Box. POSOLOGI : Dewasa dan anak diatas 14 tahun Dosis awal dianjurkan 500 mg kemudian dilanjutkan250 mg tiap jam sesudah makan. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEP DOKTER Di produksi oleh: COMBIPHAR BANDUNG-INDONESIA Asam Mefenamat Kapsul 250 mg.Reg. INDIKASI : . KOMPOSISI : Tiap kapsui mengandung 250 mg Asam mefenamat "Flap kaplet 500 mg salut selaput mengandung 500 mg Asam mefenamat. Kaplet 500 mg.

terhindar dari cahaya. No Reg GKL 9830010709 A1 CARA PENYIMPANAN : Simpan ditempat kering dansejuk. P. diare.Indonesia Asimat CODE: C10 Harga Per Satuan Terkecil : Rp800. nyeri otot. pendenta asma. nyeri sewaktu haid. sakit sehabis operasi dan melahirkan.penderita ginjal dan penderita yang hipersensitif. PERINGATAN DAN PERHATIAN : Jangan dibenkan pada penderita bronkospasme aliergik rhinitis. Keamanan penggunaan pada anak-anak dibawah umur 14 tahun belum diketahui dengan pasti. EFEK SAMPING : Umumnya Asam Mefenamat dapat dibenkan dengan baik pada dosis yang dianjurkan. KEMASAN : Kapsul 250mg : Dus 10 strip® 10 Kapsui . KONTRA INDIKASI : Pada penderita dengati tukak lambung / usus. PHYTO KEMO AGUNG FARM A Jakarta . sakit kepala dan sakit gigi. urticaria atau mendapat obat non steroid anti-inflamasi yang lain karena kemungkinan terjadi sensitiyitas silang Jangan digunakan pada wanita hamil dan menyusui. Harus dengan resep dokter.T. Reg : GKL9930011201 A1 Kaplet 500 mg : Dus 10 strip® 10 Kaplet . nyeri sendi. termasuk nyeri karena trauma. muntah. Jangan digunakan lebih dan dosis yang dianjurkan atau lebih dari 7 hari kecuali atas petunjuk dokter. No.Untuk menghitangkan segala macam nyeri dan ringan sampai sedang dalam kondisi akut dan kronis.00 BELI ASIMAT 500 . Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. pada penggunaan jangka panjang yang terus menerus dengan dosis 2000 mg atau lebih sehan dapat mengakibatkan agranulositosis dan hemolitik anemia.

KONTRA INDIKASI : Pada penderita dengan tukak lambung / usus. pusing. INDIKASI : Untuk mengurangi nyeri dari ringan sampai sedang dalam kondisi akut dan kronis. penderita asma. EFEK SAMPING : Efek samping yang timbul umumnya dapat ditolerir dengan baik pada dosis yang dianjurkan.KOMPOSISI : Tiap kaplet salut selaput ASIMAT500 mengandung Mefenamic Acid 500 mg CARA KERJA : Mefenamic Acid adalah suatu analgetik yang mempunyai daya anti-inflamasi. nyeri sewaktu haid. termasuk nyeri karena trauma. perdarahan lambung. sakit sehabis melahirkan. sakit kepala dan sakit gigi. nyeri otot. muntah dan diare. penderita ginjal dan penderita yang hipersensitif terhadap Mefenamic Acid. POSOLOGI / DOSIS : Dewasa dan anak-anak > 14 tahun : Dosis oral yang dianjurkan 500 mg kemudian dilanjutkan 250 mg setiap 6 jam jika diperiukan. . Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. Agranulositosis dan hemolitik anemia mungkin dapat terjadi pada penggunaan dalam jangka waktu lama yang terus menerus dengan dosis 2000 mg atau lebih sehari.

CARA PENYIMPANAN : Simpan di tempat sejuk dan kering. DKL9833300909A1 HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT. urticaria atau mendapat obat nonsteroid anti-inflamasi yang lain karena kemungkinan terjadi sensitivitas silang.00 BELI AULIN TABLET 100 MG KOMPOSISI : Tiap tablet mengandung Nimesulide 100 mg URAIAN : . PENGEMASAN DAN NOMOR REGISTRASI Box. Jangan digunakan pada wanita hamil dan menyusui. allergic rhinitis. 10 strip @ 10 kaplet salut selaput ASIMAT 500. No.550. Reg. MERSIFARMATM Sukabumi .Indonesia BlI-24/02/05 AULIN TABLET 100 MG Harga Per Satuan Terkecil : Rp4. Jangan digunakan lebih dari dosis yang dianjurkan atau lebih dari 7 hah kecuali atas petunjukdokter.PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. terlindung dari cahaya matahari. Keamanan pengguhaan pada anak-anak di bawah 14 tahun belum diketahui dengan pasti. INTERAKSI OBAT : Antikoagulan oral. Jauhkan obat dari jangkauan anak-anak.

Pasien yang diketahui hipersensitif terhadap Nimesulide . atau pendarahan gastrointetinal.Pasien dengan tukak lambung atau usus.Penggunaan pada anak-anak KEMASAN & NO REG.4-NITRO-2-phenoxymethane sulponanilide INDIKASI : Aulin merupakan suatu obat anti inflamasi non steroid untuk berbagai kondisi yang membutuhkan anti inflamasi.Orang dewasa 1 tablet 2xsehari setelah makan (1 tablet 100 mg) . antipiretika seperti osteoarthritis penyakit rematikekstra-artikular. Setiap box berisi 2 blister @ 10 tablet 100 mg Nimesulide.ulserasi berulang.rhinitis.Pasien dengan insufisiensi hepar sedang atau berat . .Pasien dengan kelainan fungsi ginjal berat (CCT <30 ml/menit) .Pasien dengan gangguan koagulasi berat . pendarahan serebrovaskular. rasa nyeri dan inflamasi setelah intervensi bedah dan setelah trauma akut dan dismenoria.00 BELI BENOSTAN tab KOMPOSISI Mefenamic acid/Asam mefenamat .250. atau pendarahan aktif lainnya atau gangguan pendarahan . DOSIS & CARA PEMAKAIAN : .Aulin tidak dianjurkan digunakan pada anak-anak dibawah 12 tahun KONTRA INDIKASI : . urticaria) terhadap OAINS dan acetosal . DKI 0051900210A1 PABRIK : Helsinn Birex Pharmaceuticals HARUS DENGAN RESEP DOKTER Benostan 500 Harga Per Satuan Terkecil : Rp1. analgesika.Pasien dengan riwayat reaksi hipersensitif (seperti bronkospasme.

ulkus peptikum. asma. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin. penyakit ginjal. nyeri rematik PENYAJIAN Dikonsumsi bersamaan dengan makanan : : : 3 kali sehari 250 -500 mg. ruam kulit. epilepsi. mengantuk.5 mg/kg berat badan/hari dalam 3-4 dosis terbagi. PERHATIAN Kehamilan. KONTRA INDIKASI Ulkus peptikum atau ulserasi usus. migren. INDEKS KEAMANAN PADA WANITA HAMIL Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. Interaksi obat : antikoagulan oral. . diskrasia darah.INDIKASI Nyeri. 6. KEMASAN Tablet 500 mg 10stp DOSIS • Dewasa Anak berusia 6 bulan atau • lebih Dismenore (nyeri saat • haid). gugup. dehidrasi. EFEK SAMPING Gangguan & perdarahan saluran pencernaan. kerusakan hati atau ginjal.gangguan penglihatan. demam. pusing. 3 kali sehari 500 mg. penyakit radang usus besar. sakit kepala.

Penderita dengan tukak lambung dan usus. INDIKASI : Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala. muntah. Bimastan CODE: C11 Harga Per Satuan Terkecil : Rp200. Penderita dengan gangguan ginjal yang berat. KONTRA INDIKASI : Pasien yang hipersensitif terhadap Mefenamie Acid. sakit gigi. . nyeri otot dan nyeri sesudahoperasi. alergi rhinitis dan urtikaria. TAKARAN PEMAKAIAN : Dewasa dan anak-anak > 14 tahun: Dosis awai: 500 mg. 250 mg. diare dan rasa sakit pada abdominal. anti infiamasi dan antipiretik.00 BELI BIMASTAN© KOMPOSISI : Tiap kapsul mengandung: MefenamicAcid Tiap kaptab salut selaput mengandung: MefenamicAcid Tiap kaptab mengandung: MefenamicAcid 500 mg. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik. CARA KERJA OBAT : Bimastan merupakan kelompok anti inflamasi non steroid. kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. termasuk nyeri karena trauma.PABRIK Bernofarm. Penderita yang dengan Asetosal mengalami bronkospasme. EFEK SAMPING : Sistem pencernaan : mual. 500 mg. dismenore primer.

-

Sistem hematopetik : leukopenia, eosinophilia, trombocytopenia dan agranulocytopenia. Sistem saraf : rasa mengantuk, pusing, penglihatan kabur dan insomnia.

PERINGATAN DAN PERHATIAN : Sebaiknya diminum sesudah makan. Hati-hati digunakan pada wanita hamil dan menyusui. Keamanan penggunaan pada anak - anak dibawah 14 tahun belum diketahui dengan pasti. KONTRA INDIKASI : Penggunaan bersama antikoagulan oral dapat memperpanjang "Prothrombin".

OVER DOSIS : Jika terjadi over dosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbon absorben) untuk menyerap obat. KEMASAN : Dus isi 10strip® "10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 10 strip @ 10 kaptab No. Reg. DKL 8931402104 A1 Dus isi 50 blister @ 10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 40 blister @ 10 kaptab salut selaput No. Reg. DKL 9731407209 A1 Dus isi 10 blister @ 10 kaptab salut selaput No. Reg. DKL 0431407209 A1 Botol isi 1.000 kapsul No. Reg. DKL 8931402001 A1

250mg 500 mg 250 mg 500 mg 500 mg 250 mg

SIMPAN DITEMPAT SEJUK (15 - 25)°C DAN KERINGTERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT. BIMA MITRA FARMA TANGERANG - INDONESIA Bio mega CODE: C12

Harga Per Satuan Terkecil : Rp300.00 BELI BIO MEGA

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiro Vitamin B1 Vitamin B6 Vitamin B12 INDIKASI :

500 mg 50 mg 50 mg 100 mcg

Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat. KONTRA INDIKASI : * * * * Penderita hipersensitif Bayi di bawah 3 bulan, atau dengan berat badan di bawah 5 kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg

EFEK SAMPING : Agranulositosis, reaksi kepekaan, mengantukdan pusing."

PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu, lengan. Karena dapat menimbulkan agranulositosis yang berakibat fatal, maka sebaiknya tidak digunakan dalam jangka panjang terusmenerus. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius.

DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput.

KEMASAN : Dus, isi 10 strip @ 10 tablet salut selaput NO. REG. DKL9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT. GRAHA FARMA SOLO - INDONESIA Biomega 10 Kaplet Harga Per Satuan Terkecil : Rp300.00 BELI Biomega

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiron Vitamin B1 Vitamin B6 Vitamin B12

INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat.

KONTRA INDIKASI :

- Penderita hipersensitif Bayi dibawah 3bulan. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. GRAHA PARMA SOLO . gangguan fungsi hati atau ginjal. sakit punggung. PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. mengantuk dan pusing. reaksi kepekaan. bursitis. DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput.00 BELI BIROPYRON Kaplet Salut Selaput . REG. KEMASAN : Dus. DKL 9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT. sindroma bahu. lengan. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.INDONESIA Biropyron Harga Per Satuan Terkecil : Rp300. isi 10 strip @ 10 tablet salut selaput NO.atau dengan berat badan dibawah 5kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg EFEK SAMPING : Agranulositosis. lumbago.

DKL0231406809 A2 Botol isi 1. PERINGATAN DAN PERHATIAN: .500. karena itu perlu dilakukan pemeriksaan uji fungsi hati atau ginjal dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. Reg. . DKL0231406809 A1 SIMPAN DITEMPAT SEJUK (15-25)°C DAN KERING TERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT.000 kaplet No. BIMA MITRA FARMA TANGERANG .Pada pemakaian jangka lama dapat timbul sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan. . KEMASAN: Dus isi 10 Strip® 10 Kaplet No.Penderita dengan tekanan darah sistolik < 100 mm Hg EFEKSAMPING: Reaksi hipersensitif pada kulit. . gangguan fungsi hati. Reg. DOSIS: 1 kaplet 3x sehari .KOMPOSISI: Tiap kaplet salut selaput mengandung: Methampyrone 500 mg Thiamine HCl 50 mg Pyridoxine HCl 100 mg Cyanocobalamine 100 mcg INDIKASI: Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia.hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. sindroma bahu lengan. KONTRA INDIKASI: .Hati. sakit punggung. maka sebaiknya tidak digunakan dalam waktu panjang dan terus menerus. lumbago.00 BELI BODREX .Karena dapat menimbulkan agranulositosis dan berakibat fatal.Wanita hamil dan menyusui . misalnya kemerahan dan agranulositosis. bursitis. ginjal.INDONESIA Bodrex CODE: C13 Harga Per Satuan Terkecil : Rp5.Penderita hipersensitif .

• Reaksi hipersensitifitas. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. INDIKASI : Meringankan SAKIT KEPALA. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala.Meringankan SAKIT KEPALA. SAKIT GIGI dan menurunkan DEMAM. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. . Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. • Penderita Hipersensitif. segera hubungi dokter/unit pelayanan kesehatan terdekat. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. dapat meningkatkan resiko kerusakan fungsi hati. sakit gigi.

...........SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg....00 BELI BODREX EXTRA KOMPOSISI tiap tablet mengandung : paracetamol. TEMPO SCAN PACIFIC Tbk.. FABRIK / Rheinfelden / Germany P91108000 Bodrex Extra CODE: C111 Harga Per Satuan Terkecil : Rp3.......... PHARM.......... Bekasi-lndonesia atas lisensi dari DR..efek analgesik dari paracetamol dan ibuprofen bejerja sinergis dengan caffeine dalam meredakan sakit kepala INDIKASI ... DBL 8522700810 A1 Dibuat oleh P.antipiretik(demam) dan anti inflamasi(mengurangi proses peradangan)...............700... FRITZ BODE GmbH/ CHEM...50 mg CARA KERJA OBAT paracetamol merupakan analgetik-antipiretik dan ibuprofen merupakan obat golongan analgetik-antipiretik dan anti inflamasi non steroid (AINS) yang memiliki efek analgetik(menghilangkan rasa nyeri).... No.T....350 mg ibuprofen.200 mg caffeine...........

Tempo Scan Pacific Tbk. 3-4 kali sehari anak-anak 6-12 tahun : 1/2-1 kaplet.kemerahan pada kulit dan gangguan darah INTERAKSI OBAT efek toksik dari paracetamol dapat meningkat pada pemberian bersam-sama dengan obat yang menyebabkan kerusakan hati SIMPAN PADA SUHU DI BAWAH 30'C Reg.meredakan sakit kepala DOSIS dan ATURAN PAKAI dewasa dan anak-anak >12 tahun : 1-2 kaplet. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : . Bekasi-Indonesia Bodrex Flu batuk CODE: C14 Harga Per Satuan Terkecil : Rp1.DTL0622719204A1 PT.nyeri ulu hati.00 BELI BODREX Meringankan SAKIT KEPALA.muntah. 3-4 kali sehari EFEK SAMPING gangguan saluran cerna seperti mual.200.No.

DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter.Parasetamol Kofein CARA KERJA OBAT : 600 mg 50 mg bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. No. sakit gigi. segera hubungi dokter/unit pelayanan kesehatan terdekat. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. • Reaksi hipersensitifitas. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. SAKIT GIGI dan menurunkan DEMAM. DBL 8522700810 A1 Dibuat oleh . SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg. • Penderita Hipersensitif. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. dapat meningkatkan resiko kerusakan fungsi hati. INDIKASI : Meringankan SAKIT KEPALA. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal.

SAKIT GIGI dan menurunkan DEMAM. TEMPO SCAN PACIFIC Tbk. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter.T.00 BELI BODREX Meringankan SAKIT KEPALA. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. • Penderita Hipersensitif. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati.P. INDIKASI : Meringankan SAKIT KEPALA. PHARM. segera hubungi dokter/unit pelayanan kesehatan terdekat. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol.300. dapat . FABRIK / Rheinfelden / Germany P91108000 Bodrex migra CODE: C15 Harga Per Satuan Terkecil : Rp1. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. sakit gigi. Bekasi-lndonesia atas lisensi dari DR. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. • Reaksi hipersensitifitas. FRITZ BODE GmbH/ CHEM.

..Penderita yang dengan aspirin mengalami bronkospasme.... nyeri otot dan nyeri sesudah operasi..... FABRIK / Rheinfelden / Germany P91108000 Cargesik 500 Kaplet CODE: C111 Harga Per Satuan Terkecil : Rp250.........Penderita dengan tultaK lambung dan usus..T... No.....• meningkatkan resiko kerusakan fungsi hati....... pusing.00 BELI Cargesik KOMPOSISI: Tiap kaplet mengandung Asam Mefenamat... eosinophilia.. dismenore primer........ Hati-hati penggunaan obat ini pada penderita penyakit ginjal.. FRITZ BODE GmbH/ CHEM.. PERINGATAN DAN PERHATIAN : ....... SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg........ ..... termasuk nyeri karena trauma.Sebaiknya diminum sesudah makan.. ..... trombocytopenia dan agranulocytopenia... ... sakit gigi...... TEMPO SCAN PACIFIC Tbk... EFEK SAMPING : .Penderita dengan gangguan ginjal yang berat........ anti-inflamasi dan antipiretik.......Penderita yang hipersensitif terhadap asam mefenamat... . alergi rhinitis dan urtikaria... 500 mg Asam Mefenamat merupakan kelompok anti-inftamasi non steroid... 500 mg Tiap kapsul mengandung Asam Mefenamat. . muntah.. diare dan rasa sakit pada abdominal........ Bekasi-lndonesia atas lisensi dari DR. ... PHARM.Sistem pencemaan : mual.. penglihatan kabur dan insomnia..........Sistem hematopoetik : Leukopenia. KONTRA INDIKASI: . bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik.... DBL 8522700810 A1 Dibuat oleh P......Sistem saraf: rasa mengantuk.... INDIKASI Meredam nyeri ringan sampai sedang sehubungan dengan sakit kepala........

000. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan. Dengan ramuan yang berhasil itu..Botol plastik @ 500 kapsul No. . encok pada pangkal paha.Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahul dengan pasti. : DKL 9123401701 Al . isl 10 strip @ 10 kaplet No. isi 10 blister @ 10 kaplet No.: DKL 9323402504 A2 HARUS DENGAN RESEP DOKTER SIMPAN PADA SUHU KAMAR (25 . OVERDOSIS: Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktlf (karbo adsorben) untuk menyerap obat.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. Reg. Reg.Indonesia Carroll Super Pills Botol CODE: C17 Harga Per Satuan Terkecil : Rp11. Dokter Carroll.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik.Dus. Cara pemakaian : Dewasa : . INTERAKSI OBAT : Penggunaan bersamaan antikoagulan oral dapat memperpanjang "prothrombln*.Hati-hati jika digunakan pada wanita hamil dan menyusui. KEMASAN & No. Reg. dengan melalui percobaan selama bertahun . . DOSIS: Secara umum-dapat digunakan dosis pemakaian sebagai berikut: Dewasa dan anak-anak > 14 tahun : Dosis awal: 500 mg. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan.: DKL 9323402504 Al .30)°C Semarang . Atau menurut petunjuk dokter. Pemakaian sebaiknya sesudah makan. Prof. rheumatik atau sering buang air diwaktu malam. Pill ini cocok untuk : Sakit pinggang. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide. USA. kemudian dianjurion 250 mg tiap 6 jam sesuai dengan kebutuhan. Reg.Dus.

3 kali sehari. Dengan ramuan yang berhasil itu. dengan melalui percobaan selama bertahun . 2 kali sehari. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan. Dokter Carroll. Perubahan warna ini adalah reaksi normal.1 pill sebelum makan. diminum dengan air hangat. warna kencing menjadi biru atau hijau.INDONESIA Carroll Super Pills Sachet CODE: C16 Harga Per Satuan Terkecil : Rp1. Pill ini cocok untuk : Sakit pinggang.250. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik. D 7811980 DIPRODUKSI OLEH : ARTOIS FARMA TANGERANG . Reg.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. Keadaan yang sedikit berat boleh makan : 2 pill sebelum makan. rheumatik atau sering buang air diwaktu malam. 1 pill sebelum tidur. 2 pill sebelum tidur. diminum 2 dengan kali air sehari. Prof. Cara Dewasa 1 1 pill pill sebelum sebelum tidur. Dianjurkan minum banyak air. PERHATIAN : Setelah menelan pill ini. diminum dengan air hangat. : . dan tidak menguatirkan. encok pada pangkal paha. hangat. No. pemakaian : makan. USA. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan.

hangat. Kemasan : Dos 5x10 tablet 25 m. Tidak boleh untuk anak. Reg. dan tidak menguatirkan. Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi Efek samping : kadang-kadang nyeri epigastrium. air.Keadaan 2 pill 2 pill Dianjurkan PERHATIAN yang sedikit berat makan.INDONESIA CATAFLAM 25 CODE: C30 Harga Per Satuan Terkecil : Rp2. Perubahan warna ini adalah reaksi normal. warna kencing menjadi biru atau hijau. Dosis : Dewasa : awal :100-150 mg sehari. sakit kepala. No. D 7811980 DIPRODUKSI ARTOIS TANGERANG . pusing atau vertigo.00 BELI Cataflam Kalium diklofenak 25 mg. OLEH : FARMA . ruam kulit. 50 mg/tablet. : sebelum sebelum tidur. diminum boleh 3 dengan banyak makan kali air : sehari.300. minum Setelah menelan pill ini.

Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi. Dosis: Dewasa : awal : 100-150 mg sehari. Tidak boleh untuk anak. osteoartritis (penyakit sendi degeneratif yang disertai dengan kelainan tulang . INDIKASI : Pengobatan jangka pendek pada peradangan & nyeri sesudah operasi. keadaan meradang setelah trauma (terpukul/terbentur/teririrs) yang disertai rasa sakit/nyeri. pusing atau vertigo. 50 mg/tablet. ruam kulit.00 BELI CATAFLAM D KANDUNGAN : Diclofenac / Diklofenak. Kemasan : Dos 5x10 tablet 50 m.CATAFLAM 50 CODE: C31 Harga Per Satuan Terkecil : Rp4.350. Cataflam D 50 Harga Per Satuan Terkecil : Rp4.00 BELI Cataflam Kalium diklofenak 25 mg. sakit kepala.200. Efek samping : kadang-kadang nyeri epigastrium.

Interaksi obat : Lithium. DOSIS : • Dewasa: dosis awal 2-3 tablet. sindroma Lyell. PERHATIAN : • Gejala/riwayat penyakit lambung-usus. • Asma. KEMASAN : Tablet 50 mg x 50 biji. INDEKS KEAMANAN PADA WANITA HAMIL : Baik penelitian reproduksi hewan tidak menunjukkan risiko pada janin maupun penelitian terkendali pada wanita hamil atau hewan coba tidak memperlihatkan efek merugikan (kecuali penurunan kesuburan) dimana tidak ada penelitian terkendali yang mengkonfirmasi risiko pada wanita hamil semester pertama (dan tidak ada bukti risiko pada trisemester selanjutnya). menyusui. • Hamil. diskrasia darah. • Anak berusia lebih dari 14 tahun : 2 tablet. jantung. antidiabetes oral. perdarahan lambung-usus. reumatisme non artikular & sindroma nyeri pada tulang belakang. purpura (keadaan yang ditandai dengan bercak-bercak perdarahan dalam kulit atau selaput lendir). • Jarang : ulkus peptikum. sakit kepala. penyakit Crohn. gangguan sistem kardiovaskular (jantung dan pembuluh darah).berdekatan). abnormalitas fungsi ginjal. Digoksin. Metotreksat. Siklosporin. hepatitis. meningitis aseptik. antikoagulan. ruamkulit. reaksi hipersensitifitas. • Kasus-kasus tertentu : gangguan perasaan atau penglihatan. • Kehilangan volume ekstraseluler. • Usia lanjut. Dianjurkan untuk memonitor secara teratur fungsi hati & hitung darah selama • penggunaan jangka panjang. atau ginjal. sindroma Stevens-Johnson. vertigo. pusing. • Porfiria. pankreatitis. diuretika. • Kemampuan mengendarai & menggunakan mesin mungkin terpengaruh. pneumonitis. gout akut. EFEK SAMPING : • Kadang-kadang : gangguan saluran pencernaan. KONTRA INDIKASI : Ulkus lambung atau usus. eritema multiform. eritroderma. peningkatan serum transaminase. • Gangguan fungsi hati. .

SGPT. nyeri dan demam. PERINGATAN DAN PERHATIAN : . seperti operasi gigi atau tulang. Peptic ulcer. Sebagai ajuvan pada nyeri inflamasi yang berat dari infeksi telinga. PABRIK Novartis. KONTRA INDIKASI : Hipersensitif terhadap diclofenac. INDIKASI : Sebagai pengobatan jangka pendek untuk kondisi-kondisi akut seperti: Nyeri inflamasi setelah trauma. seperti terkilir.00 BELI CATANAC KOMPOSISI : Tablet CATANAC 25 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac1 Tablet CATANAC 50 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac FARMAKOLOGI : Kalium Diclofenac merupakan anti inflamasi yang bukan golongan steroid. Nyeri dan inflamasi setelah operasi. Kadang-kadang peningkatan enzim SGOT. peptic ulcer. Catanac 50mg CODE: C18 Harga Per Satuan Terkecil : Rp2. Selain anti inflamasi. EFEK SAMPING : Gangguan pada saluran pencernaan.Diberikan dalam 2-3 dosis terbagi. pruritus dan depresi. juga menunjukkan efek analgesik pada nyeri sedang dan berat. hidung atau tenggorokan. vertigo. Bekerja menghambat biosintesa pros-taglandin yang merupakan faktor terbesar penyebab inflamasi. sakit kepala.400.

dapat mempengaruhi/mengurangi efek kedua obat ini.00 BELI Celebrex Selekoksib 100 mg.T. ETHICA Jakarta . Bila diberikan bersama Neomycin. 200mg. Pada pemakaian jangka panjang. .Indonesia Untuk: P. Cholestiramin dan liquid parafin.Indonesia CELEBREX 100 CODE: C32 Harga Per Satuan Terkecil : Rp7. akan berkurang absorbsinya. SOHO INDUSTRI PHARMASI Jakarta . gangguan fungsi jantung dan ginjal. Bila diberikan bersama diuretik dan B Bloker.Penderita dengan riwayat gangguan saluran cerna. Methotrexate. Reg.950. Kasus ringan dan anak lebih dari 14 th : 75-100 mg dibagi atas 2-3 kali sehari. Tidak dianjurkan untuk wanita hamil dan menyusui.T. diclo-fenac akan mempertinggi konsentrasi obat-obat tersebut dalam plasma. DKL 9806707515B1 HARUS DENGAN RESEP DOKTER SIMPAN Dl TEMPAT SEJUK DAN KERING Dibuat oleh : P. Cyclosporin atau Digoxin. DKL 9806707515A1 Dus 30 tablet CATANAC 50 mg (3 strip @ 10 tablet salut enterik) No. tukak lambung. sebaiknya dilakukan pemeriksaan fungsi hati dan darah secara periodik. Reg. INTERAKSI OBAT : Bila diberikan bersama produk lain yang mengandung Lithium. TAKARAN PEMAKAIAN : Dewasa : 100-150 mg dibagi atas 2-3 kali sehari. KEMASAN : Dus 30 tablet CATANAC 25 mg (3 strip @ 10 tablet salut enterik) No.

Dosis : Osteoartritis:1x sehari 200 mg atau 2z sehari 100 mg. Kontra Indikasi : Hipersensivitas. Cetalgin Harga Per Satuan Terkecil : Rp850. intoksikasi sistem saraf periferal.00 BELI CETALGIN-T KOMPOSISI : Na Metamizol 500 mg . artritis reumatoid 2x sehari 100200 mg. pasien penderita asma. Perihal : Dapat menyebakan intoksikasi saluran cerna.. jangan diberikan pada wanita hamil karena dapat menyebabkan kelahiran prematur. Efek samping : Intoksikasi saluran cerna.Indikasi: penobatan ostoeartritis dan artritis rematoid. Kemasan : Dos 3x10 kapsul 100 mg. urtikaria. intoksikasi kardovaskuler. reaksi anafilaktik.

PERHATIAN : Hipersensitif terhadap Aspirin. EFEK SAMPING : Reaksi alergi. KEMASAN : Kaplet 10 x 10 biji. PENYAJIAN : Dikonsumsi bersamaan dengan makanan PABRIK: Soho Cetalmic 500 mg CODE: C19 Harga Per Satuan Terkecil : Rp1. KONTRA INDIKASI : Kelainan perdarahan. porfiria. rasa sakit/nyeri yang berkaitan dengan penyakit lainnya. DOSIS • Dewasa • Anak berusia 8-12 tahun 3 kali sehari 1 kaplet.100. agranulositosis. 1-2 kali sehari &frac12-1 kaplet.Vitamin B1 Vitamin B6 Vitamin B12 Kafein INDIKASI : 60 mg 15 mg 15 mg 50mg Sakit kepala. sakit pinggang.00 BELI CETALMICT . neuralgia. perdarahan lambung-usus. Interaksi obat : Klorpromazin.

anti inflamasi dan antipiretik. penderita yang hipersensitif. Kira . diare. nyeri setelah operasi dan melahirkan. Juga sebagai antipiretik pada keadaan demam. kadar puncak tercapai setelah 2 jam. waktu paruh dalam plasma adalah 3-4 jam. Asam mefenamat cepat diabsorpsi. Asam mefenamat terikat sangat kuat pada protein plasma. INDIKASI : Untuk menghilangkan berbagai rasa sakit dan nyeri dari ringan sampai sedang termasuk sakit kepala. KONTRA INDIKASI : Penderita tukak lambung/usus. rhinitis alergi atau mendapat obat non steroid anti inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. nyeri otot. nyeri haid. EFEK SAMPING : Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. nyeri trauma. penderita ginjal. asam mefenamat merupakan satu-satunya derivat fenamat yang memiliki daya kerja baik central maupun perifer.kira 50% diekskresi dalam urine dan 20% ditemukan dalam faeces. Jangan digunakan pada wanita hamil/menyusui. sakit gigi. hemolotik anemia. penderita asma. agranulasitosis. Sebagai analgesik. Keamanan pada anak-anak dibawah 14 tahun . muntah.KOMPOSISI : • CETALMIC® 250 kapsul Tiap kapsul mengandung asam mefenamat 250 mg • CETALMIC® 500 kaplet salut selaput Tiap kaplet mengandung asam mefenamat 500 mg FARMAKOLOGI : CETALMIC® mengandung asam mefenamat yang mempunyai khasiat analgesik. perdarahan lambung. pusing.

050. urticaria. rhinitis. CYBUFEN may also be used for other painful inflammatory conditions CONTRAINDICATIONS CYBUFEN should not be used in patients who have exhibited hypersensitivity during previous administration. dilanjutkan 250 mg tiap 6 jam. KEMASAN : • CETALMIC® 250 mg kapsul Box. Due to the possibility of cross sensitivity. 10 strip @ 10 kaplet salut selaput DKL 9224209509A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH SUHU 30°C TERLINDUNG DARI CAHAYA PT SOHO INDUSTRI PHARMASI JAKARTA-INDONESIA Cybufen 300mg Harga Per Satuan Terkecil : Rp5. Sebaiknya diberikan pada waktu makan. Danalgin CODE: C20 Harga Per Satuan Terkecil : Rp1.00 BELI Danalgin Metampiron Diazepam . TAKARAN PEMAKAIAN : Dewasa dan anak di atas 14 tahun : Dosis awal 500 mg. Jangan digunakan lebih dari 7 hari kecuali atas petunjuk dokter. CYBUFEN is also contraindicated in patients with active peptic ulcer.belum diketahui dengan pasti. angioedema or exacerbation of nasal polyps. 10 strip @ 10 kapsul DKL9224209401A1 • CETALMIC8 500 mg kaplet salut selaput Box.00 BELI INDICATIONS CYBUFEN is indicated for acute and long-term use in the relief of signs and symptoms of osteoarthritis and rheumatoid arthritis. CYBUFEN should not be given to patients in whom aspirin or other nonsteroidal anti-inflammatory drugs have induced an asthmatic syndrome.350.

serebelum.Komposisi : Tiap kaplet mengandung : Metampiron 500 mg Diazepam 2 mg Farmakologi : DANALGIN bekerja sebagai anatgetik dan tranquillizer. sistem limbik dan korteks serebral. Diazepam dimetabolisme terutama di hati dan terikat pada reseptor di daerah spinal cort. Gangguan pulmoner akut. usia lanjut dan penderita dengan gangguan hati yang berat. Waktu paruh diazepam dan desmetil diazepam biasanya meningkat pada neonatus. sindroma bahu-lengan. Penderita dengan tekanan darah sistolik < 100 mmHg. Glaukoma sudut sempit. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/ kelainan darah. Mempunyai aktivitas sebagai ansiolitik dan hipnotik. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada . Depresi pernapasan. Karena dapat menimbulkan agranulositosis yang berakibat fatal. Peringatan dan perhatian : Jangan mengemudikan kendaraan atau menjalankan mesin selama minum obat ini. lumbago. Ttdak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. sakit punggung. Indikasi : Untuk meringankan rasa sakit sedang sampai berat terutama nyeri kolik dan sakit setelah operasi dimana dipehukan kombinasi dengan tranquillizer. gangguan fungsi hati atau ginjal. maka sebaiknya tidak digunakan dalam jangka panjang terus menerus. tetapi metabolit aktif yang dominan yaitu desmetil diazepam mempunyai waktu paruh 30 -100 jam. diabsorpsi dari saluran pencernaan dan mempunyai waktu paruh 1 .19 menit. Keadaan psikosis akut. Konsentrasi plasma puncak diazepam dicapai setelah 15 . Waktu paruh bervariasi antara 20-70 jam. Kontra indikasi : Penderita hipersensitif. bursitis. Wanita hamil dan menyusui. Metampiron bekerja sebagai analgetik. Bayi dibawah 6 buian.4 jam.

HARUS DENGAN RESEP DOKTER DANKOS PT DANKOS FARMA. dipiopia. No. : DPL8804405304A1 Simpan pada suhu kamar (maks.00 BELI DATAN®KapIet ASAM MEFENAMAT . : DPL8804405304A1 Kotak berisi 50 strip x 10 kaplet. : DPL8804405304A1 Botol berisi 75 kaplet. perubahan libido. No. ansietas. 30°C). : DPL8804405304A1 Kaleng berisi 500 kaplet. ataksia. berikutnya 1 kaplet tiap 6-8 jam. Efek samping : Reaksi hipersensitivitas : reaksi pada kulit misal kemerahan. Reg. Reg. Dosis : Jika sakit 1 kaplet. halusinasi dan gangguan tidur. maksimum 4 kaplet sehari.250. Obat ini dapat menyebabkan kelemahan otot dan ketergantungan secara fisik dan psikologis. Agranulositosis. Interaksi obat: Penggunaan bersama obat-obat depresan SSP atau alkoho! dapat meningkatkan efek depresan. Reg. retensi urin. Mengantuk. keleiahan. jaundice. vertigo. konstipasi.- penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. depresi. mual. No. tremor. Hati-hati penggunaan pada penderita depresi berat atau yang mempunyai kecen-derungan melakukan bunuh diri. Kemasan: Kotak berisi 10 strip x 10 kaplet. No. JAKARTA-INDONESIA Datan forte CODE: C21 Harga Per Satuan Terkecil : Rp1. hipotensi. Hentikan pengobatan jika terjadi reaksi-reaksi paradoksikal seperti keadaankeadaan hipereksitasi akut. Reg.

Kadar maksimal dalam darah akan tercapai dalam waktu 2 jam setelah pemberian. sakit kepala dan sakit gigi.diare.Efek samping adalah minimal pada dosis yang dianjurkan. DATAN dapat diabsorbsi dengan baik oleh saluran pencernaan. nyeri sehabis operasi dan melaliirkan. nyeri sendi.Keamanan penggunaan DATAN pada wanita hamil belum diketahui. Indikasi : Menghilangkan segala macam rasa nyeri baik akut maupun kronis. DOSIS : . .mual dan sakit kepala. renal disease.seperti : nyeri karena trauma. Peringatan dan perhatian : . EFEK SAMPING : Pada beberapa orang dapat menyebabkan iritasi lambung.Komposisi : Tiap kaplet DATAN mengandung 250 mg Asam Mefenamat. . Kontraindikasi : Penderita tukak lambung dan usus.nyeri otot. keseleo.Keamanan pada anak di bawah usia 14 tahun belum terbukti.kolik usus. Tiap kaplet DATAN forte mengandung 500 mg Asam Mefenamat. Sekitar 50 % dari dosis yang diberikan akan diekskresikan melalui urine dalam bentuk inetabolit terkonyugasi dalam waktu 48 jam. mempunyai daya kerja sebagai analgetik yang kuat dengan disertai efek anti inflamasi dan antipiretik. Farmakologi : DATAN dengan zat aktif Asam Mefenamat. . liipersensitif.Diare dapat terjadi pada penggunaan jangka panjang yang terus menerus dengan dosis 2. nyeri sewaktu haid. .000 mg atau lebih perhari dan merupakan indikasi untuk menghentikan pengobatan.Iritasi lambung jarang terjadi dan dapat dikiirangi dengan menelannya bersama makanan.

00 BELI DENTACID™ Komposisi Tiap kaplet mengandung Asam mefenamat .100. Cianjur-lndonesia Dentacid 500 Harga Per Satuan Terkecil : Rp1... No. DKL8921004I04A1.. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase .. Reg. Reg.... 500 mg Cara kerja obat Asam mefenamat merupakan kelompok antiinflamasi non steroid.Dewasa: Dosis awal yang dianjurkan adalah 500 mg. HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT PYRIDAM FARMATbk.kemudian dilanjutkan dengan 250 500 mg setiap 6 jam. No. Kaplet DATAN forte: Dus berisi 10 strip @ 10 kaplet.... DKL8921004104B1 Penyimpanan: Simpanlah di tempat yang sejuk (15-25 * C) dan kering.. Kemasan : Kaplet DATAN : Dus berisi 10 strip @ 10 kaplet..

penglihatan kabur dan insomnia. Sistem saraf: rasa mengantuk. nyeri ototdan nyeri sesudah operasi. sakit gigi. Kontraindikasi .Hati-hati jika digunakan pada wanita hamil dan menyusui. Peringatan dan perhatian . Sistem hematopoetik: leukopenia.sehingga mempunyai efek analgesik.Keamanan penggunaan pada anak . muntah. antiinflamasi dan antipiretik. .anak dibawah 14 tahun belum diketahui dengan . .Penderita dengan gangguan ginjal yang berat. trombocytopenia dan agranulocytopenia.Penderita dengan tukak lambung dan usus. termasuk nyeri karena trauma. . Efek samping Sistem pencernaan: mual. kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. alergi rhinitis dan urtikaria. eosinophilia. pusing.Pasien yang hipersensitif terhadap asam mefenamat. .Penderita yang dengan asetosal mengalami bronkospasme. . Dosis Dewasa dan anak-anak ± 14 tahun: Dosis awal 50 mg. diare dan rasa sakit pada abdominal.Sebaiknya diminum sesudah makan. dismenore primer. Indikasi Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala.

Overdosis Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbo absorben) untuk menyerap obat. Kemasan Dus isi 10 strip x 10 kaplet HARUS DENGAN RESEP DOKTER. Penyimpanan Simpan pada suhu kamar (di bawah 30°C).pasti. Reg. No.Indonesia .: DKL0704426004A1 Diproduksi oleh: PT. Interaksi obat Penggunaan bersamaan dengan antikoagulan oral dapat memperpanjang "prothrombin". HEXPHARM JAYA Cipanas . Lindungi dari cahaya.

iritasi lambung dikurangi. Diklofenakdimetabolisme hampir sempurna dalam hati: ekskresi obat yang utuh melalui ginjal kurang dari 1%. DANKOS FARMA Jakarta . tendinitis. Penyakit reumatik inflamatoar dan degeneratif: artritis reumatoid. Kelainan muskulo-skeletal akut: periatritis. 2. Obat ini mempunyai sifat antiinflamasi. Kadar puncak dalam plasma dicapai setelah 1 . Dengan demikian. 3.00 BELI DIVOLTAR® Diklofenak natrium tablet salut enterik Komposisi : Tiap tablet salut enterik mengandung : Diklofenak natrium 25 mg atau 50 mg Farmakologi : DIVOLTAR® adalah obat antiinflamasi nonsteroid dengan struktur kimia yang baru (suatu derivat asam asetat).500. Diklofenak mengalami metabolisme lintasan pertama dalam hati.2 jam. dan dislokasi. . bursitis. Menghilangkan/mengurangi rasa nyeri dan inflamasi nonreumatik. DIVOLTAR® merupakan penghambat prostaglandin sintetase.Untuk: PT. DIVOLTAR" hancur dan melarut langsung dalam usus halus.Indonesia Dipasarkan oleh: PT KALBE FARMA Tbk. dan penyakit pirai akut. analgesik dan antipiretik yang kuat. dimana diklofenak diabsorpsi dengan oepat. Sebagai tablet salut enterik. osteoartritis.Indonesia Divoltar 50mg CODE: C22 Harga Per Satuan Terkecil : Rp1. Seperti obat-obat antiinflamasi nonsteroid lainnya. tenosinovitis.4 jam. ankilosing spondilitis. Indikasi : 1. Bekasi . Obat ini 99. salah urat.7% terikat pada protein plasma dan waktu paruh eliminasinya 1 . termasuk bentuk juvenil.

DKL8811606917A1 Dos isi 5 strip x 10 tablet salut enterik. Reaksi kulir. hati dan hitung darah). jantung atau ginjal yang parah. seperti halnya dengan obat-obat antiiflamasi nonsteroid lainnya. No. Hipersensitivitas terhadap diklofenak. dibagi dalam 2 . Tablet harus ditelan seluruhnya sewaktu makan atau setelah makan. Userasi dan perdarahan saluran cerna. 2. urtikaria. ikterus. Penderita asma yang mengalami serangan asma. hepatitis. Ulkus peptikum atau perdarahan saluran cerna. gagal ginjal dan sindroma nefrotik juga terjadi. Reg. DIVOLTAR® tidak boleh diberikan selama kehamilan kecuali bila mutlak diperlukan. penderita usia lanjut (lebih mudah mengalami efek samping obat-obat antiinflamasi nonsteroid).Kontra indikasi : 1. 3. Efek samping: Pada awal pengobatan.3 dosis. DIVOLTAR® dapat meningkatkan kadar plasma lithium atau digoksin. Peringatan dan perhatian : 1.3 dosis. Gunakan dengan hati . retensi cairan dan peningkatan serum transaminase kadang-kadang terjadi. tetapi sangat jarang. Reg. DIVOLTAR® harus dihentikan. . Bila ini terjadi. dosis biasanya 75 -100 mg sehari. penderita dengan insufisiensi hati. 4.3 mg/kg sehari. nausea dan diare. harus dimonitor sebagai tindakan berjaga-jaga (mis. Leukopenia. Penderita yang mendapat pengobatan jangka panjang dengan DIVOLTAR®. fungsi ginjal. Untuk terapi jangka panjang. atau rinitis akut bila mendapat asetosal atau obat-obat antiinflamasi nonsteroid lainnya.hati pada: penderita dengan gangguan saluran cerna atau dengan riwayat ulkus peptikum. dapat terjadi nyeri epigastrium. No. dan anemia aplastik dapat juga terjadi. Kemasan : Tablet 25 mg : Tablet 50 mg : Dosisi 5 strip x 10 tablet salut enterik. Dosis dan cara pemberian Dewasa : Dosis awal 75 -150 mg sehari. DKL8811606917B1 PT KALBE FARMA Tbk. 2. trombositopenia. Anak 1 tahun atau lebih :1 . dibagi dalam 2 . nyeri kepala atau pusing. sendawa. Efek samping ini biasanya ringan. 3.

Efek samping: Efek samping yang biasa timbul adalah gangguan saluran cerna. serta reaktivitas bronkospastik terhadap asam asetilsalisilat atau antiinflamasi non steroid lainnya. . Untuk anak yang bobot badannya kurang dari 30 kg. maksimum diberikan sebanyak 500 mg sehari.9 . Kontra indikasi: Jangan diberikan kepada penderita yang hipersensitif terhadap ibuprofen atau penderita dengan sindroma polip hidung.2 gram sehari. Atau menurut petunjuk dokter. Simpan pada suhu kamar (di bawah 30°C). Komposisi: DOFEN® 200 Tiap tablet salut selaput mengandung: Ibuprofen DOFEN® FORTE Tiap tablet salut selaput mengandung: Ibuprofen Indikasi: Reumatik artritis. osteoartritis dan gout artritis. HARUS DENGAN RESEP DOKTER. angiodema.4 gram sehari. Dosis penunjang 0.Indonesia Lindungi dari cahaya. 20 mg/kg bobot badan sehari. Dosis : Dewasa : Anak-anak : 200 mg 400 mg 0. dibagi dalam beberapa dosis.1.Bekasi .00 BELI DOFEN® 200 DOFEN® FORTE Tablet salut selaput DOFEN adalah tablet bersalut selaput (film coat) yang mempunyai khasiat sebagai analgetika-antipiretika dan antiinflamasi. Rasa nyeri ringan sampai sedang dan rasa nyeri pada waktu haid.2. dibagi dalam beberapa dosis. Dofen Forte 400mg CODE: 121 Harga Per Satuan Terkecil : Rp400.6 . sakit kepala atau vertigo.

Pada dosis yang berlebihan dapat terjadi gejala saluran cerna dan gejala susunan saraf pusat. 10 strip @ 10 tablet.3 ampul/hari selama 1 . SIMPAN PADA SUHU DI BAWAH 30°C. Hati-hati bila digunakan pada penderita dengan gangguan fungsi ginial dan perlu dilakukan monitor yang ketat. Terapi penunjang : 3 kapsul @ 50 mg/hari selama 3 minggu. Pada penderita dengan riwayat penyakit saluran cerna bagian atas perlu dilakukan pengawasan yang ketat. 10 strip @ 10 tablet. . gangguan fungsi ginjal tetapi ini jarang terjadi. Tidak boleh digunakan pada penderita yang diketahui hipersensitif terhadap aspirin atau antiinflamasi non steroid lainnya Hati-hati bila digunakan pada penderita dengan kelainan faktor intrinsik untuk pembekuan darah. TERLINDUNG DARI CAHAYA. BAMBANG UTOYO 138 PALEMBANG-INDONESIA Dogmatil CODE: C23 Harga Per Satuan Terkecil : Rp3. pruritus.2 minggu.00 BELI DOGMATIL SULPIRIDE 3 bidang pengobatan utama : ITUKAK SALURAN PENCERNAAN PSIKIATRI VERTIGO ■ Tukak saluran pencernaan Pengobatan pada waktu serangan : 2 . DKL8505001617B1 HARUS DENGAN RESEP DOKTER. DKL8505001617A1 DOFEN FORTE: Kotak.650. Dibuat oleh: DEXAMEDICA JL.Juga dapat menimbulkan ruam kulit. Kemasan dan Nomor Registrasi: DOFEN 200 : Kotak. Peringatan dan perhatian: Hati-hati bila digunakan pada penderita dengan riwayat dekompensasi jantung atau hipertensi.

Kewaspadaan tetap terpelihara bahkan sering kali meninggi.4 kapsul @ 50 mg/hari. dibagi dalam beberapa dosis.b. ■ Vertigo karena berbagai sebab 3. KEMASAN: Tablet dalam strip berisi 20 @ 200 mg (khusus pemakaian psikiatri) No. TOLERANSI : Pada terapi jangka panjang atau pada pengobatan ulangan tidak menimbulkan adiksi. kebingungan. Dewasa : 2 . (waham) kronis./hari. dibagi dalam beberapa dosis.6 kapsul/hari.3 kapsul/hari selama 3 . Tanpa kontraindikasi maupun incompatibility. • Psikosa pada masa anak-anak. D 7811131 -Ampul 6 @ 100 mg/2 ml No.4 minggu. • Kelainan psikofungsionil • Kelainan tingkah laku yang ringan.6 ampul/hari. dan keadaan pra-psikosa. dibagi dalam beberapa dosis. dibagi daTam beberapa dosis. • Kelainan tingkah laku yang berat. • Depresi pada geriatrik. ■ Kelainan psikiatri utama Pengobatan pada waktu serangan : • Psikosa akut dengan gejala-gejala 3 . halusinasi. • Neurosa dengan harnbatan psikomotor. keadaan delusi 2 . Reg. No. Anak-anak : 5 -10 mg/kg b. Reg. D 6015425 -Kapsul dalam strip berisi 20 dan 100 @ 50 mg. • Depresi karena berbagai sebab.4 tablet @ 200 mg/hari. • Sindroma post gegar-otak. EFEK SAMPING : Kadang-kadang dapat menyebabkan gangguan siklus menstmasi atau efek extra pyramidal ringan yang mudah hilang. Tidak mempengaruhi sistim neurovegetative. • Keadaan depresi yang reaktif. Reg.b. Terapi penunjang per oral: • Skizofrenia akut.Terapi lanjutan : 1 ./hari. delusi. remaja Anak-anak : 10 mg/kg b. D 6015158 .

baik akut maupun kronik serta nyeri setelah operasi. KONTRA INDIKASI : Intoksikasi akut bila digunakan bersama dengan alkohol.PARIS . Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg INDIKASI : Untuk mengatasi nyeri berat.00 BELI Dolana KOMPOSISI : Setiap Kapsul mengandung : Setiap Suppositoria mengandung : Setiap 1 mL Larutan injeksi DOLANA 50 mg mengandung : Setiap 2 mL Larutan injeksi DOLANA 100 mg mengandung : CARA KERJA OBAT : Tramadol HCl adalah analgesik yang bekerja sentral. Dengan menghambat "reuptake".FRANCE DELAGRANGE Dolana Kapsul CODE: C122 Harga Per Satuan Terkecil : Rp3. Disamping itu juga bekerja pada reseptor monoaminergik di susunan saraf pusat.SIMPAN Dl BAWAH SUHU 30°C.JAKARTA. noradrenaline pasca sinaptik dan memblok reseptor serotonergik. TERLINDUNG DARI CAHAYA Tablet dan Kapsul di produksi oleh : PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Injeksi diproduksi oleh : PT ETHICA. SESIF . preparat hipnotik.450. untuk PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Dengan lisensi dari DELAGRANGE. dengan sifatnya sebagai agonis partial pada reseptor opioid (reseptor U) yang berperan pada efek analgesik. memperkuat efek analgesik Tramadol HCl namun dengan efek samping opioid yang minimal. .

tramadol tidak dapat menekan gejala "withdrawal" akibat pemberian morfin. Penderita yang mendapat pengobatan penghambat MAO. Hati-hati bila digunakan pada penderita trauma kepala. paru-paru kronik EFEK SAMPING Berkeringat. mulut kering dan lelah. Meskipun termasuk antagonis opiat. DOLFENAL CODE: C33 Harga Per Satuan Terkecil : Rp1. Pertimbangkan manfaat dan resiko yang mungkin terjadi bila digunakan pada wanita hamil dan menyusui karena 0. PERINGATAN DAN PERHATIAN : Tramadol tidak boleh digunakan pada penderita ketergantungan obat. Tramadol HCl tidak boleh diberikan pada pasien yang menerima MAO Inhibitors.00 BELI Dolfenal . peningkatan tekanao intrakranial. pruritus. hipnotik maka efek sedasi/kelelahan kemungkinan meningkat. muntah.- analgesik atau obat-obat lain yang bekerja pada susunan saraf pusat. Penderita dengan depresi pernapasan terutama jika ada cyanosis dan sekresi bronkial yang berlebihan.000. gangguan fungsi ginjal dan hati yang berat atau hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok (renjatan ) Dapat terjadi penurunan fungsi paru-paru apabila penggunaan tramadol dikombinasi dengan obat depresi SSP lainnya atau bila melebihi dosis yang dianjurkan. INTERAKSI OBAT : Dengan obat-obat yang bekerja pada susunan saraf pusat seperti Trankuilizer. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. sedasi. kemerahan. sakit kepala. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi tramadol dengan cepat. Penderita yang hipersensitif terhadap tramadol atau opiat. Hendaknya tidak diberikan selama serangan asma bronkial atau kegagalan jantung sekunder sampai penyakit. Dispepsia obstipasi.1 % tramadol diekskresikan melalui ASI. Pada penderita dengan gangguan fungsi ginjal / hati perlu dilakukan penyesuaian dosis. pusing. mual.

700.00 BELI DOLIKA INJEKSI / KAPSUL KOMPOSISI Tiap ml Dolika 50 Injeksi mengandung : Tiap ml Dolika 100 Injeksi mengandung : Tiap kapsul mengandung : Tramadol HCI Tramadol HCI Tramadol HCI 25 mg 5 mg 50 mg Dewasa dan anak >14 tahun : kemudian 250 mg. de3hidrasi. peradangan.pusing.diskrasia darah.gangguan penglihaan. kerusakan hati dan ginjal.nefropati. Dosis : 4x sehari : Kemasan : Dos 100 tablet. . Perihal : tukak lambung.perdarahan saluran cerna.sakit kepala. Efek samping : Gangguan saluran cerna.Asam mefenamat 500 mg.mengantuk. Dolika Kapsul CODE: C123 Harga Per Satuan Terkecil : Rp2. Indikasi : nyeri. Kontra indikasi : Tukak/inflamasi saluran cerna. asma.reaksi kulit. hipersensivitas.

dapat ditambahkan injeksi 1 ml Dolika atau 1 kapsul Dolika setelah selang waktu 30 . EFEK SAMPING . dosis Dolika yang diberikan adalah sebagai berikut : Dosis untuk orang dewasa dan anak umur di atas 14 tahun : DOLIKA KAPSUL : Dosis tunggal : 1 kapsul Dosis harian : sampai 8 kapsul Dosis tersebut biasanya cukup untuk meredakan nyeri. kemungkinan terjadinya ketergantungan tidak dapat disingkirkan. biasanya diberikan dalam bentuk injeksi DOSIS PEMAKAIAN Dosis yang diberikan sebaiknya disesuaikan dengan intensitas nyeri Bila tidak ada petunjuk lain dari dokter. INDIKASI Nyeri akut dan kronik berat. Nyeri akibat tindakan diagnostik. Apabila masih terasa nyeri.CARA KERJA OBAT Tramadol HCI merupakan Non-Opioid Analgetika yang bekerja pada reseptor opioid. Dolika tidak boleh diberikan lebih lama daripada yang diperlukan. Dosis harian sebesar 400 mg/hari jangan dilampaui. Pada penderita dengan gangguan fungsi ginjal atau hati. Nyeri pasca operasi.60 menit. atau bila pengobatan perlu dihentikan sementara. Karenanya dokter harus menetapkan lamanya pengobatan. Lama pengobatan : Pada pengobatan Dolika jangka panjang. perlu dilakukan penyesuaian dosis.

Simpan di tempat kering dan sejuk. Dolo fenac CODE: C24 Harga Per Satuan Terkecil : Rp3. hipnotika) dapat meningkatkan efek sedasinya. mulut kering dan sakit kepala. Meskipun tramadol berinteraksi dengan reseptor opiat. terhindar dari cahaya. KONTRA INDIKASI Intoksikasi akut dengan alkohol.- Sama seperti analgesik sentral lainnya. INTERAKSI OBAT Penggunaan injeksi Dolika bersama dengan obat-obat yang bekerja pada SSP (seperti tranquiliser. dispepsia. Penderita yang hipersensitif terhadap tramadol atau opiat.100. pruritus. berkeringat. CARA PENYIMPANAN Jauhkan dari jangkauan anak-anak. sampai sekarang terbukti insidens ketergantungan setelah penggunaan Dolika jarang dijumpai. Sebaliknya penggunaan tramadol bersama dengan tranquiliser juga dapat meningkatkan efek analgesiknya. obstipasi. kulit kemerahan. hipnotika. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi Tramadol dengan cepat.00 BELI DOLO FENAC iniamme Monomtrate + Lyanocobalamin Vitamin Neurotropik + NSAID Komposisi : Setiap tablet salut enterik mengandung: . sedasi. pusing. efek samping berikut dapat terjadi pada pengobatan Dolika : mual. analgesik atau obat-obat yang mempengaruhi SSP lainnya. muntah. Penderita yang mendapat pengobatan penghambat MAO. lelah.

edema. efektivitas dan banannya belum diketahui. Thiamin penting untuk metabolisme karbohidrat. Indikasi : Meringankan rasa sakitsedangsampai beratyangdisertai neuritisdan/atau neuralgia. Efek anti inflamasi serta efek farmakologis lainnya berhubungan dengan efek penghambatan sintesa prostaglandin. Pyridoxol HCI di dalam tubuh diubah menjadi pyridoxol fosfat. lebih baik setelah makan.pada pasien dengan dehidrasi.Penderita dengan luka atau pendarahan pada saluran cerna. Dosis dan Pemberian Tiga tablet per hari. Perhatian : Diclofenac dapat menyebabkan retensi cairan. Obat ini harus diberikan dengan hati-hati pada pasien dengan gangguan ginjal. anti inflamasi analgesik. Vitamin B. Perhatian atau larangan penggunaan selama hamil dan menyusui : . akan meningkatkan resiko toksisitas ginjal.s diperiukan dalam sintesis asam nukleat dan mielin. mempunyai efek sebagai anti rematik. pemberian Diclofenac bersama NSAID lainnya tidak direkomendasikan. yang merupakan koenzim reaksi karboksilasi dan transaminasi. Pada anak. Pasien dapat diobati dalam waktu lama iika diperiukan sesuai anjurandokter. dan gangguan koagulasi pada pasien dengan penyakit kardiovaskular atau hipertensi. dengan demikian mempengaruhi pematangan sel dan memelihara keutuhan jaringan syaraf. hati dan jantung penderita usia lanjut. Untun oengobatan inflamasi dan penyakit-penyakit rematik degeneratif. dalam tubuh dikonversi menjadi bentuk aktifnya thiamin pirofosfat yang merupakan koenzim pada reaksi dekarboksilasi asam aketo.OiclofenacSodium Pyridoxol HCI Thiamine Mononitrate Vitamin B12 Mekanisme Kerja : 50 mg 50 mg 50 mg 1 mg Diclofenac merupaKan obat anti inflamasi non steroid. berfungsi terutama dalam metabolisme protein dan asam amino.

ada perbaikan bertahap pada disfungsi neuronal dan pemulihan secara menyeluruh pada pasien-pasienini. mual. perdarahan usus. hematemesis ulkus perforasi. retensi urin.sakit kepala. dispepsia.kelelahan. hal ini dihubungkan dengan hipersensitifas yang jarang terjadi. gangguan rasa. Perhatian dan kemungkinan efek karsinogenik. proteinuria. . diare. kondisi sistim pencernaan. eczema. diare berdarah. hati dan ginjal harus diteliti terlebih dahulu.TJhnifus. lesi esophagus. glositis. flatulence. Sebelum meresepkan obat ini. sindroma Stevens-Johnson toxic epidermal necrolysis. alopecia. erythroderma (exfoliative dermatitis). Polycythemia vera.jarang terjadi : gastroduodenal hemoragik (perdarahan gastro-duodenal). Efek samping : Ada laporan tersendiri mengenai reaksi pada pemberian parenteral thiamin dan vitamin B12 untuk jangka panjang. Sistem saraf pusat : dizziness. Pemberian pyridoxol dosis tinggi dapat menyebabkan smdroma neuropati sensoris tertentu. Ginjal (kasusjarang): hematuria. konstipasi. Kulit (kasus tersendiri) : vesicular eruptions. anoreksia. muntah.gangguan sensoris dan visuat. insufisiensi renal akut.Obat tidak boleh digunakan selama kehamilan dan menyusui. Pada penghentian pyridoxol.Kadang-kadang terjadi: colitis ulserativa atau Crohn's procto'colitis' gingivostomatitis. Sistem pencernaan : sakit perut. disorienteasi. gangguan ingatan. Erupsi kulit dan reaksi hipersensitifitas lain yang diketahui disebabkan oleh formulas! ini. reaksi fotosensitif. insomma. erythema multiforme.Tfitasi psikotik.Kasus yang jarang:parestesia. meskipun studi histopatologik tidak menunjukkan adanya hubungan smdroma tersebut dengan semua tingkatan degenerasi neuronal.pusing. purpura. mutagenik dan teratogenik dan efek pada fertilitas: Tidak ada bukti efek karsinogenik. mutagenik dan teratogenik atau efek fertilitas pada studi manusia atau hewan.

Hipersensitifitas (kasus jarang) : arterial hypotension. . dengan atau tanpa penyakit kuning.agranulocytosis. Jika pyridoxol diberikan bersama cyclosporine.leucopenia.aplastic anemia. Cycloserine dan hydralazine adalah vitamin B. Vitamin B12 tidak boleh diberikan pada tingkat awal penyakit Leber (atrophl hereditari dari saraf optik).Hati (kasus jarang) : peningkatan aktifitas aminotransferase (glutamic-pyruvic dan glutamic-oxaloacetic transaminases). urticaria atau rhinitis yang dipicu oleh asam asetilsalisilik atau derifatnya. reaksi anafilaksis. Penggunaan penicillamine yang diperpanjang dapat menyebabkan kekurangan vitamin B. Pemberian carbidopa dengan levodopa secara bersamaan menghambat efek pyridoxol Pyridoxol HCI tidak boleh diberikan pada dosis lebih tinggi daripada 5 mg per hari pada pasien yang sedanq diobati dengan levodopa saja.hemolyticanemia. Darah ( kasus tersendiri) : thrombocytopenia. Pyridoxol fosfat menyebabkan dekarboksilasi perifer levodopa sehingga menurunkan efikasi pada pengobatan penyakit Parkinson. Kontraindikasi : Hipersensitifitas terhadap obat ini. Pengobatan dengan pyridoxol HCI 200 mg per hari selama satu bulan menurunkan sampai 50% konsentrasi serum phenobarbital dan phenytoin. antagon. Qastroduodenal/peptic ulcer.s dan pemberian pyridoxine menurunkan efek samping neuronal dengan penggunaan obat-obat ini. Polycythemia vera. meskipun signifikansinya tidakjelas. edema. Pasien yang mengalami bronchial. Interaksi : Thiamin dilaporkan berpotensi terjadinya penghambatan neuromuscular. hepatitis. kadar plasma ada kemungkinan menurun..

insufisiensi qinial konvulsi. harus diperhatikan kemungkinan ini pada saat meresepkan dosis tinggi asam askorbat dengan vitamin B12. Pada kasus intoksikasi akut dengan diclofenac. Overdosisatau ingestion taksengaja:Gejala dan Penanganan (Antidot) Tidak ada kasus yang dilaporkan tentang overdosis dengan thiamin atau vitamin B. Prednisone dilaporkan meningkatkan absorpsi vitamin B12 dan sekresi faktor intrinsik pada beberapa pasien dengan anemia pernicious.. Pemberian kloramfenikol dan vitamin B„ secara simultan dapat memperburuk responhemopoietic terhadap vitamin. primidone). iritasi gastrointestinal. Tindakan berikut ini harus dilakukan: bilas lambung dan pemberian charcoal aktif. asam aminosalisilik dan garamnya. iritasi pada usus halus oleh kobalt. Pasien diobati dengan antikoagulan harus dimonitor dengan ketat Obat-obat antnnflamasi nonsteroid harus dihentikan 24 jam sebelum memulai pengobatan dengan metotreksat untuk mencegah peningkatan plasma cytostatic dan kejadian efektoksik. Kemasan : Boks lO blister® lO tablet salut enterik Dolo Meganeuron Harga Per Satuan Terkecil : Rp750. Neuropathy sensoris dan sindroma neuropati sensoris lainnya yang disebabkan pemberian pyridoxol megadoses akan sembuh dan pulih kembali dengan penghentian pengobatan. Pemberian neomycin dan colchicine secara simultan memperburuk absorbs! vitamin B secara oral. pengobatan pennnjang dan simptomatik harus dilakukan Tidak ada gambaran spesifik mengenai hal itu. Pengukuran pendukung harus dilakukan untuk mengobati hipotensi. dan oleh asupan aikohol yang berlebihan selama lebih dan 2 minggu. dan supresi pernafasan. tetapi tidak pada pasien dengan gastrectomy parsial atau total Kepentingan klinis dan observas* ini tidak diketahui. golongan potasium lepas lambat. Asam askorbat dapat menghancurkan jumlah vitamin B12 secara signifikan dan faktor intrinsik dalam kondisi in vitro. Monitoring yang cukup direkomendasikan untuk kasus-kasus ml.00 BELI DOLO MEGANEURON Kaplet Salut Selaput KOMPOSISI : . Diclofenac menurunkan aktivitas obat-obat diuretik. antikonvulsan (phenytoin' phenobarbital. Pemberian diclofenac dengan obat-obat lithium-based atau digoxin atau siklosporin atau metotreksat secara simultan dapat menyebabkan peningkatan plasma obat-obat ini.Absorpsi vitamin B„ di sistim gastrointestinal dapatditurunkan dengan pemberian berikut ini aminoglikosida colchicme. Penggunaan antiinflamasi nonsteroid lain secara bersamaan dapat meningkatkan resikoefeksampingvangtidakdiinginkan.

Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lama untuk mengatasi rasa sakit akut. Diabsorpsl dan saluran pencemaan. mempunyai waktu paruh 1 -4 jam.Tiap Kaplet Salul Selaput mengandung: Methampyrane TniamineHCI Pyridoxine HCl Cyanooobalamine 500 mg 50 mg 100 mg 100 mg FARMAKOLOGI : Methampyrone bekerja sebagai analgesia. INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia. Pyrldoxine HCl dan Cyanocobalamine dalam dosis besar dapat membantu memelihara fungsi sel-sel saraf. KONTRA INDIKASI : Penderita hipersensitif. Karena dapat menimbulkarragranulositosis yang berakibat fatal. . Wanita hamil dan menyusui. lumbago. Penderita dengan tekanan darah sistolik < 100 mmHg. gangguan fungsi hati atau ginjal. sindroma bahu-lengan. terutama pada keadaan sakit yang berat. Hati-hati dengan penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. Bayi dibawah 6 bulan. bursitis. Thiamine HCl. PERINGATAN DAN PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. sakit punggung. maka sebaiknya tidak digunakan dalam jangka waktu terus menerus.

900. EMBA MEGAFARMA SEMARANG . .: DKL 9815706509 A1 SIMPAN DITEMPAT YANG SEJUK DAN KERING HARUS DENGAN RESEP DOKTER Produksi: PT. DOSIS : 1 Kaplet salut selaput 3 kali sehari KEMASAN : Dus.032.EFEK SAMPING : Reaksi hipersensitifitas: reaksi pada kulit misal kemerahan.1 Dolocap Harga Per Satuan Terkecil : Rp1.INDONESIA R.00 BELI DOLOCAP capsul KOMPOSISI : Tiap kapsul mengandung: Tramadol HCI 50 mg FARMAKOLOGI : Tramadol HCI merupakan suatu analgetik opioid. Agranulositosis. 10 strip @ 10 kaplet salut selaput No.Reg.

muntah. koma. Dosis tersebut di atas biasanya cukup untuk meredakan nyeri. terutama dengan adanya cyanosis. atau obat-obat analgetik opiat atau obat-obatyang mempengaruhi SSP lainnya. Penderita yang mendapat pengobatan MAO inhibitor. . vertigo. brandikardia orthostatic. sodasi.60 menit. Mulut kering. Pada anak-anak dan bayi dapat terjadi kejang-kejang. KONTRA INDIKASI: • • • • Penderita yang hipersensitif terhadap Tramadol atau opiat.INDIKASI : • • Digunakan untuk: Nyeri akut dan kronik yang berat. mungkin juga dapat terjadi spasme uterik atau biliary. seperti pada golongan analgesik opiat (analgesik sentral) dapat terjadi: mual. Intoksikasi akut dengan alkohol. kulit kemerahan. confusion. sembelit. Pada dosis lebih besar dapat menyebabkan depressi pernapasan dan hipotensi dengan kegagalan sirkulasi dan koma. hypotension. apabila masih terasa nyeri dapat ditambahkan 1 kapsul setelah selang 30 . OVER DOSIS : • • Pada pemberian over dosis dapat terjadi miosis. hipnotika. EFEK SAMPING : • • • • Pada dosis normal. kejang dan depressi pernapasan. drowsiness. kolaps kardiovaskular. Untuk mengatasi depressi pernapasan dan syok dengan Naloxone HCI. muntah. DOSIS : Dosis yang diberikan disesuaikan dengan intensitas nyeri lazimnya : • 1 kapsul sehari (maksimum 8 kapsul per hari). kelelahan dan miosis. dispepsia. berkeringat. hypotermia. palpitasi. Nyeri pasca bedah. Penderita dengan depressi pernapasan.

peningkatan tekanan intra kranial.• Nalorphine HBr. Meskipun termasuk antagonis opiat. • Sebaliknya penggunaan Tramadol bersama dengan tranquillizer juga dapat meningkatkan efekanalgesiknya. kering dan terlindung dari cahaya. antidepressan trisiklik dan anestetika. tranquillizer. INTERAKSI OBAT : • Efek depressi / sedasi diperkuat dengan adanya obat-obat yang bekerja pada SSP seperti : alkohol. Pemberian pada wanita hamil harus dipertimbangkan manfaat dan resiko yang mungkin terjadi. . sedangkan kejang dapat ditekan dengan pemberian Benzodiazepin. Levallorphan tartrat.1% Tramadol diekskresikan melalui ASI. obat-obat hipnotika. Hati-hati bila digunakan pada penderita trauma kepala. Oleh karena itu dokter harus menentukan dengan jelas lama pengobatan. Tidak boleh diberikan lebih lama dari petunjuk dokter. HARUS DENGAN RESEP DOKTER. PERHATIAN : • • • • • • • • Tramadol tidak boleh digunakan pada penderita ketergantungan obat. dapat menyebabkan ketergantungan. Dapat terjadi penurunan fungsi paru bila Tramadol digunakan bersama dengan obat-obat penekan SSP lainnya atau bila penggunaan melebihi dosis yang dianjurkan. Tramadol tidak dapat menekan gejala "witdrawal" akibat pemberian morfin. gangguan fungsi ginjal dan hati yang berat. Pada pengobatan jangka panjang. hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok. Hati -hati pemberian pada ibu menyusui karena 0. KEMASAN : Dos berisi 5 blister® 10 kapsul PENYIMPANAN : Simpanlah di tempat yang sejuk. Keracunan akut lewat mulut dapat diatasi dengan pengosongan lambung. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin.

Asam Mefenamat diserap dari traktus gastro intestinal dan kadar dalam sirkulasi mencapai puncaknya dalam waktu 2 jam setelah pemberian obat. nyeri waktu haid. ± 50 % dari dosis yang diberikan ditemukan kembaii dalam urine. yaitu analog amin asam salisilat. Asam Mefenamat ku-rang menyebabkan terjadinya pendarahan gastrointestinal. FARMAKOLOGI : DOLODON berisi Asam Mefenamat yang merupakan derivat asam antrani-lat. KONTRA INDIKASI : Penderita tukak lambung .00 BELI DOLODON kapsul * captab * suspensi capsule * captab * suspension KOMPOS1SI : DOLODON 250 Kapsul : DOLODON 500 Captab : DOLODON Suspensi : Tiap kapsul berisi 250 mg Asam Mefenamat Tiap captab mengandung 500 mg Asam Mefenamat Tiap sendok takar (5ml) suspensi mengandung 50 mg Asam Mefenamat. nyeri pasca bedah dan persalinan. terutama dalam bentuk metabolitnya.Dolodon CODE: C25 Harga Per Satuan Terkecil : Rp250. Dalam waktu 48 jam. demam pada anak-anak dan dewasa. yang mempunyai daya antipiretik dan anatgesik dengan potensi yang sama dengan aspirin dan dengan sedikit daya anti inflamasi. INDIKASI : Untuk menghilangkan rasa nyeri pada sakit kepaia. sakit gigi. Dibandingkan dengan aspirin. DOLODON Suspensi dengan rasa pisang yang enak dan manis disiapkan untuk anakanak dan penderita yang mengalami kesulitan menelan kapsul atau captab. nyeri rematik.

SEDIAAN dan KEMASAN : * DOLODON 250 Kapsul : * DOLODON 500 Captab : * DOLODON Suspensi : Dus berisi 10 strip x 10 kapsul Reg. Hati-hati pada penderita asma karena akan memperburuk keadaan. Pemberian harap dihentikan setelah 7 hari tidak memberikan hasil. No.Botol plastik isi 500 kapsul Reg. DOSIS : Dewasa : Anak-anak : Mula-mula 500 mg. DKL 8714504033 A1 HARUS DENGAN RESEP DOKTER . Hati-hati pada penderita gangguan fungsi hati dan ginjal. terutama bila digunakan bersama-an antikoagulan koumarin. 3 kali se-hari dengan interval 6 sampai 8 jam. No. D 7812379-1 Dus berisi 10 strip x 10 captab Reg.PERINGATAN & PERHATIAN : * * * * * Dapat mengurangi jumiah trombosit. PENYIMPANAN : Simpan pada suhu dibawah 30°C. D 7812379 . No. paling lama 7 hari. No. Atau menurut petunjuk dokter. DKL 8714504104 A1 Botoi isi 60 ml netto Reg. kemudian 250 mg setiap 6 jam 6. Sebaiknya tidak diberikan pada wanita hamil dan wanita menyusui.5 mg Asam Mefenamat per kilogram berat badan. dosis koumarin hams dikurangi. EFEK SAMPING : * * Dapat menyebabkan iritasi tractus gastro intestinal Skin rash dan diare dapat terjadi dan akan hiiang jika pengobatan dihentikan.

INDIKASI : Menghilangkan rasa nyeri dan gejala arthritis reumetoid dan osteoarthritis.00 BELI DOLOFEN – F Ibu profen 400 mg. DOSIS : 3 x sehari 1 kaplet / kapsul . KEMASAN : ( HNA + ) Dos 10 x 10 kapsul Duplopyrin Strip CODE: C111 Harga Per Satuan Terkecil : Rp2.00 BELI Duplopyrin KOMPOSISI : Tiap tablet DUPLOPYRIN mengandung : Fenilbutazon 125 mg Etoksibensamid 125 mg Aluminium Hidroksida Gel kering 100 mg Magnesium Trisilikat 5H2O 150 mg .Produksi : PT MECOSIN INDONESIA JAKARTA Dolofen-F CODE: C26 Harga Per Satuan Terkecil : Rp500.500.

Dapat menghambat absorpsi tetrasiklin dan vitamin-vitamin serta memperlambat absorpsi quinidin. hipersensitivitas serta gangguan fungsi jantung. tukak lambung. osteo arthritis. gouty arthritis. INTERAKSI OBAT : Dapat meningkatkan etek tolbutamide dan kumarin. Magnesium Trisilikat dalam bentuk garam magnesium mudah diserap dan bila terjadi gangguan fungsi ginjal dapat menyebabkan keracunan magnesium. Reg. ankylosing spondylitis. : D. No. juga pada penyakit tiroid dapat terjadi penahanan fungsi sumsum tulang. No. 2815773 Dus isi 24 blister @10 tablet . Reg. ATURAN PAKAI : Dewasa : 1 tablet 3 kali sehari. Disesuaikan dengan usia dan berat badan. hati atau kardiovaskuler. : D. gangguan fungsi ginjal. PERINGATAN & PERHATIAN : Hati-hati penggunaan pada penderita ulkus peptikum. Atau menurut petunjuk Anak-anak : dokter. CARA PENYIMPANAN : Simpan di tempat kering. Harus berhati-hati pemberiannya pada penderita dengan gastritis. pada suhu kamar (25-30°C) dan terlindung dan bahaya KEMASAN : Kaleng plastik isi 1000 tablet . 2815773-1 . ginjal dan hati. KONTRA INDIKASI Hipertensi.INDIKASI Penyakit Rheumatik termasuk rheumatoid arthritis.

. seperti operasi gigi dan tulang. Secara farmakologi Diklofenak menunjukkan aktivitas anti-inflamasi. seperti terkilir.. .00 BELI EFLAGEN Tiap tablet mengandung : Kalium Diklofenak... - KONTRA-INDIKASI Hipersensitivitas terhadap Kalium Diklofenak.. hidung atau tenggorokan.INDONESIA Eflagen 25 CODE: C112 Harga Per Satuan Terkecil : Rp1. Seperti obat-obat AINS yang lain mekanisme kerja belum diketahui.25 mg/ 50 mg FARMAKOLOGI EFILAGEN mengandung Kalium Diklofenak yaitu suatu anti-inflamasi nonsteroidal CAINS... analgesik dan antipiretik..... * nyeri Inflamasi setelah trauma....HARUS DENGAN RESEP DOKTER PT. akan tetapi penghambatannya terhadap sintesa prostaglandin (siklo-oksigenase) dapat dikaitkan dengan aktivitas anti-inflamasi..250.............. * nyeri dan inflamasi setelah operasi.... INDIKASI EFLAGEN diindikasikan : Sebagai pengobatan jangka pendek untuk kondisi akut sebagai berikut: Sebagai adjuvant pada nyeri Inflamasi berat dari Infeksi telinga. Coronet Crown PHARMACEUTICAL INDUSTRIES SURABAYA ....

anak-anak usia > 14 tahun: tidak boleh diberikan pada anak-anak usia Anak-anak : < 14 tahun. impoten. INTERAKSI OBAT Pemberian bersamaan dengan litium atau digoksin dapat meningkatkan konsentrasi litium atau digosin dalam plasma. Pemberian bersamaan dengan diuretik hemat kalium dapat disertai dengan kenaikan kadar kalium dalam darah. trombositopenia. Saluran pencernaan: dispepsia. Ginjal: gangguan fungsi ginjal. Sistem saraf pusat: pusing. Pemberian bersamaan dengan metotreksat dapat meningkatkan toksisitas metotreksat. agra-nulositosis Darah: (sangat jarang). Lain-lain: hipertensi. eksim. sakit kepala.100 mg / hari. diare. nyeri dada. vertigo. Pemberian bersamaan dengan antikoagulan perinah dilaporkan dapat meningkatkan resiko perdarahan. telinga berdenging. DOSIS Dewasa : dosis awal 100 -150 mg/hari dalam 2 . Reg. Pada kasus-kasus sedang dan untuk 75 . mual. palpitasi. muntah. SGPT dan hepatitis (Jarang).- Tukak lambung. EFEK SAMPING Efek samping yang mungkin terjadi pada : nyeri lambung. eritema multiformis. kram perut. Pemberian bersamaan dengan AINS sistemik dapat meningkatkan terjadinya efek samping. edema (Jarang). Kulit: urtikaria. anemia. HARUS DENGAN RESEP DOKTER KEMASAN EFLAGEN 35: No. penderita dalam serangan asma. Hati: peningkatan enzim SGOT.3 dosis terbagi. leukopenia. urtikarta atau rinitis akut yang ditimbulkan oleh asam asetil salisllat atau obat-obat lain yang menghambat sintesa prostaglandin.: Dus Isi 5 strip @ 10 tablet DKLV722222015A1 .

Reg.: Dus isi 5 strip @ 10 tablet DKL9722222015B1 .EFLAGEN 50: No.

Sign up to vote on this title
UsefulNot useful