Analgesik, antiinflamasi http://www.farmasiku.com/index.php?

target=categories&category_id=171 Analgesik adalah obat yang dapat mengurangi atau menghilangkan rasa nyeri dan akhirnya akan memberikan rasa nyaman pada orang yang menderita. Anti inflamasi adalah obat yang dapat menghilangkan radang yang disebabkan bukan karena mikroorganisme (non infeksi). Gejala inflamasi Inflamasi dapat disertai dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Proses inflamasi meliputi kerusakan mikrovaskuler, meningkatnya permeabilitas vaskuler dan migrasi leukosit ke jaringan radang, dengan gejala panas, kemerahan, bengkak, nyeri/sakit, fungsinya terganggu. Mediator yang dilepaskan antara lain histamin, bradikinin, leukotrin, Prostaglandin dan PAF. Penanganan inflamasi 1 2 3 4 5 6 7 Derivat Asam Salisilat à Aspirin, Benorilat, Diflunisal, Salsalat Derivat Asam Propionat à As.Tiaprofenat, Fenbufen, Flurbiprofen, Ibuprofen, Ketoprofen, Naproksen Derivat.As.Fenamat à As.Mefenamat, Meklofenamat Derivat As.Fenilasetat à Diklofenak, Fenklofenak Derivat Oksikam à Piroksikam, Tenoksikam Der.As.Asetat inden/indol à Indometasin, Sulindak, Tolmetin Deriva Pirazolon à Azapropazon, Fenilbutazon, Oksifenbutazon

ABDIFLAM CODE: C29 Harga Per Satuan Terkecil : Rp1,350.00 Abdiflam Natrium diklofenak 25 mg; 50 mg. Indikasi: sakit pasca traumatik inflamatori, inflamasi dan bentuk degeneratif rematik, rematik non artikular. Dosis: Dewasa: awal: sehari100-150 mg dalam dosis terbagi 2-3x; Anak 14th: 75-100 mg sehari dalam dosis bagi 2-3x. Kemasan: 5 x 10 tablet 50 mg.

AFI RHEUMA CODE: C1

Harga Per Satuan Terkecil : Rp2,300.00 BELI AFI RHEUMA KAPSUL KOMpOSISI : Tiap kapsul mengandung : 4 butil 1,2 difenilpirazolidina 3,5 dion ................... 100 mg CARA KERJA OBAT : Sebagai anti radang dan analgetik INDIKASI : Ankylosing spondylitis, acute gouty arthritis, active rheumatoid arthritis. CARA PEMAKAIAN: Dewasa 2-3 kali sehari 1 kapsul, sesudah makan atau diminum dengan susu, seyogyanya sesuai petunjuk dokter. EFEK SAMPING: - Iritasi gastrointestinal (mual, muntah, rasa terbakar pada lambung). - Retensi : Cairan, edema, rash. - Gangguan hematologi yang serius (leukopenia, agranulositopenia, aplastik-anemia). - Alergi INTERAKSI OBAT: Jangan diberikan bersama - sama dengan : Kumarinantikoagulan, insulin, fenitoin, oral hipoglikemik. KEMASAN : Box isi 10 blister @ 12 kapsul Reg. No. DKL 8901700901 A1 Simpanlah obat ini ditempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER Allogon 500 Harga Per Satuan Terkecil : Rp700.00 BELI ALLOGON 500 mg. Komposisi Mefenamic acid/Asam mefenamat INDIKASI Nyeri ringan, sedang sampai berat seperti sakit kepala, nyeri otot, artralgia (nyeri sendi), sakit gigi, osteoartitis rematoid, gout, nyeri saat haid, nyeri setelah operasi, nyeri setelah terjadi patah tulang, nyeri setelah melahirkan, neuralgia (nyeri pada saraf), dan nyeri pada organ-organ dalam perut. KONTRA INDIKASI Gastritis, ulkus lambung, dan anemia hemolitik. PERHATIAN Kehamilan, dehidrasi, epilepsi, asma. Interaksi obat : antikoagulan oral. EFEK SAMPING

Gangguan & perdarahan saluran pencernaan, ulkus peptikum, sakit kepala, gugup, insomnia (sulit tidur), biduran/kaligata, kemerahan pada kulit, pembengkakan wajah. INDEKS KEAMANAN PADA WANITA HAMIL C: Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin. KEMASAN Kaplet 500 mg x 2 x 10 butir. DOSIS Dewasa : 250-500 mg tiap 6 jam sekali. Anak-anak : 6,5 mg/kg berat badan tiap 6-8 jam sekali. Nyeri saat : diawali dengan 500 mg, kemudian 250 mg tiap 6 jam. haid PENYAJIAN Dikonsumsi bersamaan dengan makanan PABRIK Konimex. Analsik CODE: C2 Harga Per Satuan Terkecil : Rp1,150.00 ANALSIK Tiap kaptet mengandung : Metampiron 500 mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. Metampiron adalah suatu obat analgesik- antipiretik. Diazepam mempunyai kerja sebagai antiansietas, juga memiliki sifat relaksasi otot rangka. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral. INDIKASi : Untuk meringankan rasa nyeri sedang sampai berat, ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam. Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg, wanita hamil dan menyusui. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. Glaukoma sudut sempit, keadaan psikosis akut. EFEK SAMPING : Dapat menimbulkan agranulositosis. Reaksi hipersensitivitas, reaksi pada kulit,ngantuk,pusing,lelah yang berlebihan. Konstipasi, depresi, diplopia, hipotensi, jaundice, perubahan libido, mual, tremor, retensi urin, vertigo. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan

Walaupun jarang menimbulkan agranulositosis.sama dengan obat .bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam.- darah/kelainan darah.Indonesia Analspec CODE: C3 Harga Per Satuan Terkecil : Rp1. Bayi di bawah 1 bulan atau dengan berat badan di' bawah 5 kg. sebaik-nya tidak digunakan untuk jangka pahjang. Diazepam mempunyai kerja sebagai antiansietas. Penderita dengan tekanan darah lebih rendah dari 100 mmHg. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri. HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet.: DPL8822208609A1. Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik. gangguan fungsi hati atau ginjal. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut. Dibuat oleh : PT SANBE FARMA Bandung . ter-utama nyeri kolik dan nyeri setelah operasi dimana di -perlukan kombinasi dengan tranquilizer. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. INTERAKSI OBAT : Penggunaan bersama . wanita hamil dan menyusui.30°C). Metampiron adalah suatu obat analgesik. lumbago. sindroma bahu lengan. No. INDIKASI : Untuk meringankan rasa nyeri sedang sampai berat. Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam.antipiretik. DOSIS : 1 kaplet. ansietas.00 ANALSIK Tiap kaptet mengandung : Metampiron 500mg Diazepam 2 mg FARMAKOLOGI ANALSIK® adalah kombinasi Metampiron dan Diazepam. Reg. karena dapat berakibat fatal. maksimum 4 kaplet sehari. PENYIMPANAN Simpan pada suhu kamar (25°. . juga memiliki sifat relaksasi otot rangka. KONTRA INDIKASI : Pada penderita yang hipersensitif terhadap Metampiron dan Diazepam. sakit punggung.halusinasi dan gangguan tidur. bursitis. Kombinasi ini dimaksudkan untuk menghilangkan rasa nyeri dan spasme organ visceral.250.

bursitis.sama dengan obat . depresi. Karena itu perlu dilakukan pemeriksaan fungsi hati dan hitung darah pada peng-gunaan jangka lama untuk pengobatan nyeri akut. lumbago. Reg. PENYIMPANAN Simpan pada suhu kamar (25°. EFEK SAMPING : Dapat menimbulkan agranulositosis.bila nyeri belum hilang dilanjutkan 1 kaplet tiap 6-8 jam. perubahan libido. Konstipasi. diplopia. Walaupun jarang menimbulkan agranulositosis.30°C). tremor. No. Tidak digunakan untuk mengobati sakit otot dan gejala -gejalaflu dan tidak untuk mengobati rematik.lelah yang berlebihan. INTERAKSI OBAT : Penggunaan bersama . karena dapat berakibat fatal.pusing. sindroma bahu lengan. jaundice. Dibuat oleh : PT SANBE FARMA Bandung . mual.halusinasi dan gangguan tidur. sakit punggung.Glaukoma sudut sempit. vertigo. HARUS DENGAN RESEP DOKTER KEMASAN Dusisi 10 strip @ 10 kaplet. gangguan fungsi hati atau ginjal. Reaksi hipersensitivitas. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin.obat yang mendepresi SSP atau alkohol dapat meningkatkan efek Diazepam. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. PERHATIAN : Hindari penggunaan jangka lama karena menimbulkan kelemahan otot dan ketergantungan fisik dan psikis. DOSIS : 1 kaplet.ngantuk. reaksi pada kulit. hipotensi. ansietas. Hati-hati penggunaan pada penderita depresiberat atau yang mempunyai kecenderungan melakukan bunuh diri.Indonesia Anastan CODE: C4 Harga Per Satuan Terkecil : Rp250. retensi urin. keadaan psikosis akut. maksimum 4 kaplet sehari. Hentikan pengobatan jikaterjadi reaksi-reaksi paradoksial seperti keadaankeaaaan hipereksitasi akut.: DPL8822208609A1. sebaik-nya tidak digunakan untuk jangka pahjang.00 ANASTAN (Mefenamic Acid) 500 mg .

Dapat timbul asma. Mempengaruhi test darah. albuminiea dan kencing darah. aiergik rinrtis atau urticaria karena obat non steroid anti inflamasi yang lain. berkhasiat analgesic dan anti inflamasi. bila cfiare maka pengobatan dihentikan. thrombocytopenia. Kemasan : Anastan forte : Dos isi 10 strip @ 10 kaplet. sehingga hemoiytic anemia coombs positif. mengurangi kerja obat anti coagulant.00 Antalgin . nausea dezziness. Posologi : Dewasa dan anak .hati pada penderita yang mendapat bronkospasma. Mempengaruhi test urine.anak dibawah 14 tahun belum diketahui dengan pasti. karena kemungkinan terjadi" cross sensitivity". : Anastan forte DKL 9207802304 A1 Antalgin CODE: C5 Harga Per Satuan Terkecil : Rp150. Penderita asma. Hati . Peringatan dan Perhatian : Dalam pengooatan. Harus dengan resep dokter No. Dapat timbul agranucytosis. Enteraksi obat : Dengan obat anti coagulant. Cara penyimpanan : Disimpan di tempat tertutup dan diluar pengaruh cahaya. nyeri sesudah operasi dan dysmenorrhoea primer. Keamanan penggunaan pada anak . Juga dapat timbul kantuk. Tiap kapsul mengandung Acidum Mefenamicum 250 mg. Efek samping : Dapat timbul diare biasa hingga berat. Juga pada penderita gangguan fungsi ginjal atau pernah menderita sakit ginjal atau hati.Anastan adalah obat yang mengandung Acidum Mefenamicum. Komposisi : Tiap kaplet mengandung Acidum Mefenamicum 500 mg (Anastan Forte). nervous dan sakit kepala.anak diatas 14 tahun : - Anastan forte jam. Reg. Wanita mengandung atau sedang menyusui. : Awal 1 kaplet (500 mg) kemudian Vi kaplet (250 mg) tiap 6 Indikasi : Sebagai obat untuk meringankan rasa sakit seperti pada sakit gigi. Kontra indikasi : Obat kontra indikasi bagi penderita sakit tukak lambung atau inflamasi pada saluran cerna. sakit kepaia. anemia. terjadi tukak lambung dan pendarahan. Digunakart tidak lebih dari 7 hari. sehingga billirubin urine positif dan protein uria positif.

Indikasi : Untuk menghilangkan rasa sakit. Penderita dengan tekanan darah <100 mmHg.: GKL9420906010A1 Antalgin 500 mg. Peringatan dan Perhatian : Karena dapat menimbulkan agranulositosis yang berakibat fatal.Reg. Reg.200. Cara Kerja Obat : Antalgin adalah derivat metansulfonat dan amidopirina yang bekerja terhadap susunan saraf pusat yaitu mengurangi sensitivitas reseptor rasa nyeri dan mempengaruhi pusat pengatur suhu tubuh. maka sebaiknya tidak digunakan terus-menerus dalam jangka panjang. Kemasan dan Nomor Registrasi Antalgin 500 mg. Kasus porfiria hati (amat jarang) dan defisiensi bawaan glukosa-6-fosfat-dehidrogenase. Bayi 3 bulan pertama atau dengan berat badandibawah 5 kg.30°C (kondisi penyimpanan. kotak 10 blister @ 10 tablet No. Cara Penyimpanan : Simpan pada suhu 25° . Dewasa : sehari 3 kali 1 tablet. Dosis dan Cara Penggunaan : Melalui mulut (per oral). Penderita yang hipersensitif.00 ANTRAIN TABLET .INJEKSI© . antipiretik danantiinflamasi. Antalgin mudah larut dalam air dan mudah diabsorpsi ke dalam jaringan tubuh. terutama kolik dan sakit setelah operasi. botol 1000 tablet No.Komposisi Tiap tablet mengandung antalgin 500 mg. normal).:GKL9420906010A1 HARUS DENGAN RESEP DOKTER INDO FARMA BEKASI – INDONESIA Antrain CODE: C6 Harga Per Satuan Terkecil : Rp10. Efek Samping : Gejala kepekaan yang manifestasinya kelainan pada kulit. Tiga efek utama adalah sebagai analgesik. WanitahamilteTutama^B bulan pertamanaTT6 minggu terakhir. Kontra indikasi : Pada penderita yang alergi terhadap derivat pirazolon. Pada penggunaan jangka panjang dapat menyebabkan agranulositosis. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah.

maksimum 3 kali sehari. KONTRA INDIKASI : Penderita hipersensitif terhadap Metamizole Na. KEMASAN : ANTRAIN* Tablet Kotak berisi 10 strip @ 10 tablet Reg. atau I.ANAK HARUS DENGAN RESEP DOKTER .maksimum 4 tablet sehari.terutama nyeri kolik operasi. berikutnya 1 tablet tiap 6-8 jam. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah.sindroma bahu lengan.No. INTERAKSI OBAT : Bila Metamizole Na diberikan bersamaan dengan Chlorpromazine dapat mengakibatkan hipotermia. Metamizole Na bekerja sebagai analgesik. berikutnya 500 mg tiap 6-8 jam. Wanita hamil dan menyusui. Bayi di bawah 3 buian atau dengan berat badan kurang dari 5 kg. No. diberikan secara injeksi I. maka sebaiknya tidak digunakan dalam jangka panjang. Karena itu perlu dilakukan pemeriksaan fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut.V. Karena dapat menimbulkan agranulositosis yang berakibat fatal. Injeksi : 500 mg jika sakit timbul. Penderita dengan tekanan darah sistolik < 100 mmHg. Mekanisme kerjanya adalah menghambat transmisi rasa sakit ke susunan saraf pusat dan perifer.:DKL7617611210A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA ANTRAIN* Injeksi Kotak berisi 5 ampul @ 2 ml netto Reg. gangguan fungsi hati atau ginjal. PERINGATAN / PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. diabsorpsi dari saluran pencernaan mempunyai waktu paruh 1-4 jam.M. Pada pemakaian jangka lama dapat menimbulkan sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan.: DKL0117616843A1 JAUHKAN DARI JANGKAUAN ANAK . Agranulositosis.sakit punggung. INDIKASI : Untuk meringankan rasa sakit.bursitis.KOMPOSISI : Tiap tablet mengandung : Metamizole Na 500 mg ANTRAINI Injeksi Tiap ml mengandung: Metamizole Na 500 mg CARA KERJA OBAT : Metamizole Na adalah derivat metansulfonat dari aminopirin yang mempunyai khasiat analgesik.lumbago. EFEK SAMPING : Reaksi hipersensitivitas: reaksi pada kulitmisal kemerahan. ATURAN PAKAI : Dewasa: Tablet : 1 tablet jika sakit timbul.

diare. ruam makulo papular.: DKL0033201I301A1 ARGESID 500 . Efek samping : Gangguan saluran cerna seperti iritasi lambung. usus. Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahui.00 ARGESID Asam Mefenamat KOMPOSISI : ARGESID 250 Tiap kapsul mengandung Asam Mefenamat 250 mg. Mangundiprojo no.R. Interaksi Obat : Obat-obatan antikoagulan oral seperti warfarin. nyeri sesudah operasi. Box 10 Strip @10 Kapsul. Interbat Jl. kecuali atas petunjuk dokter. Sidoarjo-61252 Jawa Timur. dispepsia. Tidak boleh melebihi dosis yang dianjurkan dan lebih dari 7 hari. asetosal. Pada penggunaan terusmenerus dengan dosis 2000 mg atau lebih sehari dapat mengakibatkan agranulositosis dan hemolitik anemia. Indikasi : untuk meredakan rasa sakit seperti sakit gigi. pusing. 1 Buduran. dismenore. kolik. Dosis : Dewasa dan anak-anak di atas 14 tahun: Dosis awal 500mg kemudian dilanjutkan 250 mg tiap 6 jam. sakit kepala. vertigo. urtikaria atau mendapat pengobatan antiinflamasi non-steroid lainnya. Reg. meredakan rasa nyeri seperti nyeri otot. hipersensitif usus. mual.SIMPAN DI BAWAH 30°C TERLINDUNG DARI CAHAYA JANGAN DISIMPAN DALAM LEMARI PEMBEKU Diproduksi Oleh : PT.M. muntah. Kemasan: ARGESID 250. sakit kepala. ARGESID 500 Tiap Kaplet salut selaput mengandung Asam Mefenamat 500 mg Farmakologi : Asam Mefenamat merupakan anti inflamasi non-steroid. Peringatan dan Perhatian Tidak dianjurkan diberikan pada wanita hamil dan menyusui. alergik rinitis. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase sehingga mempunyai efek analgetik dan antiinflamasi. karena dapat terjadi sensitivitas silang. nyeri karena trauma. No. nyeri saat melahirkan. radang gangguan ginjal. Indonesia Argesid 500mg Harga Per Satuan Terkecil : Rp1. Kontra indikasi : Tukak lambung.100. H. Hati-hati pemberian pada penderita bronkhospasme.

Box 10 Strip @10 Kaplet No.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan. bersendawa. Penghambatan COX2 menentukan efek terapi NSAI. esofagitis. pendarahan gastro-intestinal makroskopik. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). Insufisiensi ginjal berat yang tidak didialisa. jarang terjadi fotosensitisasi.konstipasi. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serumkreatinin dan/atau serum urea. gangguan jumlah sel darah : lekosit. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma. Reg. Pendarahan gastrointestinal. EFEK SAMPING : Saluran cerna : dispepsia. terutama . urtikaria. KONTRA INDIKASI : Ulkus lambung yang aktif. rasa sakit di perut. lekopenia dan trombosito penia. muntah-muntah. Mekanisme kerja meloxicam sebagai efek anti-inflamasi.700. Bila diberikan bersama-sama dengan obat mielotoksik yang potent. analgesik. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. Insufisiensi hepar yang berat. rasa mual.00 Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut. polip dihidung. ulkus gastroduodenal. x Anakanak dan remaja yang berumur kurang dari 15 tahun. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. Anemia. Pada kulit : pruritus. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1. ruam kulit. PROMEDRAHARDJO FARMASIINDUSTRI Sukabumi – Indonesia Artrilox 15 CODE: C8 Harga Per Satuan Terkecil : Rp7. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya. jarang terjadi kolitis. diare. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin. stomatitis.: DKL0033201109A1 ( Simpan di tempat sejuk (15-25)°C dan kering ) HARUS DENGAN RESEP DOKTER PROMED PT. rasa kembung. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik). Masa kehamilan dan menyusui.5 mg mengandung Meloxicam 7.

NSAI jarang menimbulkan nefritis interstitial. Seperti hal obat-obat NSAI. peningkatan tekanan darah. dan pada umumnya orang tua menderita gangguan fungsi ginjal. Pada pasien tersebut. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. dosis meloxicam tidak boleh melebihi 7. pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. Pernafasan : jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya.methotrexate. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. Kardiovaskuler: edema. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. pusing. sirosis hati. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. Seperti pada obat-obat NSAI. vertigo. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). muka kemerahan. sindrom nefrotik dan penyakit ginjal. nekrosis medularis ginjal. tinitus. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. akan menyebabkan terjadinya sitopenia. Seperti halnya obat-obat NSAI lainnya. ngantuk. pasien dengan gagal jantung kongestif.5 mg/hari. palpitasi. Bila pemberian bersama obat anti koagulan tidak dapat dihindari. hati atau jantung. Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. dianjurkan untuk menghentikan aktivitas. hati ataupun jantung. heparin secara sistemik. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. sindrom nefrotik. Pemberian bersama ticlopidine (anti-koagulan oral). glomerulonefritis. Sistem susunan saraf pusat : kepala terasa ringan. Bila kondisi ini dalam waktu lama. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. maka harus dimonitor efek - . Pasien yang beresiko tinggi adalah pasien yang dehidrasi. trombolitik dapat meningkatkan resiko pendarahan. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. Pada pasien yang volume & aliran darah ke ginjal menurun. Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal.

antikoagulan. Artritis reumatoid :15 mg/hari. DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari.Reg. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2. Tablet harus ditelan dengan air/minuman pada waktu makan.700. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari.5 mg/hari tergantung respon klinis. Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7.5 mg per hari. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut. dianjurkan untuk memonitor jumlah sel darah. Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker. Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam.farmasiku. Osteoartritis:7. Pada pasien yang dehidrasi. ACE inhibitor.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEPDOKTER Diproduksi oleh: COMBIPHAR BANDUNG-INDONESIA http://www. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. Kontrasepsi : menurunkan efektivitas alat KB IUD. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi. Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7.com Artrilox 7. sehingga perlu dimonitor fungsi ginjal. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi. 2 Strip @ 10 Tablet No. Dosis terapeutik dapat dikurangi sampai 7. Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya. vasodilator.5 mg per hari. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas. 2 Strip @ 10 Tablet No.5 CODE: C7 Harga Per Satuan Terkecil : Rp4.DKL9904125810A1 Artrilox 15 mg Tablet Box. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate. KEMASAN : Artrilox 7.00 . sehingga akan mempercepat eliminasi meloxicam.Reg.5 mg Tablet Box.5 mg/hari. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak.

jarang terjadi kolitis. EFEK SAMPING : Saluran cerna : dispepsia. pendarahan gastro-intestinal makroskopik. angio-edema atau urtikaria bila diberikan asam asetilsalisilat atau obat NSAI lainnya. dan antipiretik melalui penghambatan biosintesa prostaglandin yang diketahui berfungsi sebagai mediator peradangan.BELI Artrilox® Meloxicam KOMPOSISI : Setiap tablet Artrilox 7. Fungsi ginjal menjadi abnormal dengan peningkatan kadar serum kreatinin . analgesik. ulkus gastroduodenal. pendarahan pembuluh darah otak atau penyakit pendarahan lainnya. Penghambatan COX2 menentukan efek terapi NSAI. sedang penghambatan COX1 menunjukan efek samping pada lambung dan ginjal. Dikontraindikasikan pada pasien yang menunjukkan gejala asthma. Insufisiensi hepar yang berat. Pendarahan gastrointestinal. Proses penghambatan oleh meloxicam lebih selektif pada COX2 daripada COX1. INDIKASI : Terapi simtomatis jangka pendek eksaserbasi osteoartritis akut. Mekanisme kerja meloxicam sebagai efek anti-inflamasi. KONTRA INDIKASI : Ulkus lambung yang aktif. Terapi simtomatis jangka panjang artritis reumatoid (poliartritis kronik). muntah-muntah. Insufisiensi ginjal berat yang tidak didialisa. Fungsi hati menjadi abnormal untuk sementara waktu dengan peningkatan kadartransaminase dan btlirubin. esofagitis.5 mg Setiap tablet Artrilox 15 mg mengandung Meloxicam 15mg. rasa mual. Hipersensitif terhadap meloxicam (atau zat tambahan dalam Artrilox). rasa sakit di perut.5 mg mengandung Meloxicam 7. CARA KERJA OBAT : Artrilox adalah obat NSAI (Non Steroid Anti Inflammatory) baru dari golongan asam enolat. diare. konstipasi. Masa kehamilan dan menyusui. x Anakanak dan remaja yang berumur kurang dari 15 tahun. polip dihidung. rasa kembung. bersendawa.

dianjurkan untuk menghentikan aktivitas. Obat-obat NSAI menghambat sintesa prostaglandin pada ginjal yang sangat berperan dalam menunjang perfusi ginjal. Pada pasien yang volume & aliran darah ke ginjal menurun. jarang terjadi fotosensitisasi. stomatitis. volume diuresis dan fungsi ginjal harus dimonitor secara hati-hati pada permulaan terapi. penggunaan pada orang lanjut usia harus dilakukan hati-hati karena pada umumnya memiliki kelainan fungsi ginjal. Bila pada penggunaan Artrilox menimbulkan rasa mengantuk dan vertigo. nekrosis medularis ginjal. Seperti pada obat-obat NSAI. juga pasien yang mendapat diuretika atau pasien yang baru menjalani operasi dimana cenderung terjadi hipovolemia. NSAI jarang menimbulkan nefritis interstitial.5 mg/hari. peningkatan tekanan darah. dosis meloxicam tidak boleh melebihi 7. vertigo. Kardiovaskuler : edema. Penggunaan pada pasien yang lemah harus disertai pengawasan karena toleransi terhadap efek samping meloxicam berkurang. terutama methotrexate. hati atau jantung. ruam kulit. Untuk penderita gangguan fungsi ginjal stadium terakhir (dengan dialisa). pemberian Artrilox harus dihentikan pengobatan dan dilakukan pemeriksaan lebih lanjut. Pada pasien tersebut. pusing. PERINGATAN DAN PERHATIAN : Seperti pada umumnya obat-obat NSAI lainnya. muka kemerahan. sindrom nefrotik dan penyakit ginjal. urtikaria. tinitus. gangguan jumlah sel darah : lekosit. Pasien yang beresiko tinggi adalah pasien yang dehidrasi. Seperti halnya obat-obat NSAI lainnya. palpitasi. Pada pasien yang mengalami gangguan ginjal ringan atau sedang (yaitu pasien dengan bersihan kreatinin lebih besar dari 25 mL/menit) tidak diperlukan penurunan dosis. diperlukan pengawasan untuk pasien yang pernah menderita penyakit gastro-intestinal bagian atas dan pasien yang sedang diterapi dengan antikoagulan. hati ataupun jantung. pasien dengan gagal jantung kongestif. - - - - . pemberian NSAI dapat menyebabkan gagal ginjal dan akan mengalami penyembuhan bila dihentikan pemberian NSAI. Bila kondisi ini dalam waktu lama. Bila diberikan bersama-sama dengan obat mielotoksik yang potent. sirosis hati. penggunaan pada pasien yang lemah dan orang tua harus hati-hati karena toleransi terhadap efek samping telah berkurang. Pernafasan:jarang terjadi timbulnya asma akut setelah pemberian aspirin atau obat-obat NSAI lainnya termasuk meloxicam. Pada kulit : pruritus. telah dilaporkan kadang terjadi peningkatan serum transaminase atau parameter lain dari fungsi hati sedikit di atas normal dan bersifat sementara. Anemia. lekopenia dan trombosito penia. ngantuk. dan pada umumnya orang tua menderita gangguan fungsi ginjal. Pemberian meloxicam harus dihentikan bila terjadi ulkus peptikum atau pendarahan gastro-intestinal. Bila pada pasien terjadi efek samping mukokutaneous maka perlu dipertimbangkan untuk penghentian pemberian meloxicam. glomerulonefritis.- dan/atau serum urea. akan menyebabkan terjadinya sitopenia. Sistem susunan saraf pusat : kepala terasa ringan. Seperti hal obat-obat NSAI. sindrom nefrotik.

Pemberian bersamaan dengan obat anti-hipertensi (misal beta-bloker.5 mg/hari tergantung respon klinis. Bila diperlukan dapat ditingkatkan sampai 15 mg/hari. Pemberian bersama cyclosporin dapat meningkatkan nefrotoksisitas. dianjurkan untuk memonitor jumlah sel darah. Artritis reumatoid :15 mg/hari. Kontrasepsi : menurunkan efektivitas alat KB IUD. diuretik) akan menyebabkan efek anti hipertensi turun karena obat NSAI akan menghambat prostaglandin yang mempunyai efek vasodilatasi. sehingga perlu dimonitor fungsi ginjal. .5 mg per hari. ACE inhibitor. Pemberian bersama ticlopidine (anti-koagulan oral). - - - DOSIS DAN CARA PEMBERIAN : Dosis maksimum Artrilox yang dianjurkan adalah 15 mg/hari. pengobatan dengan NSAI dapat menyebabkan insufisiensi ginjal akut. Pemberian Artrilox hanya untuk orang dewasa karena belum ada penelitian dosis untuk anak-anak. Tablet harus ditelan dengan air/minuman pada waktu makan. Dosis terapeutik dapat dikurangi sampai 7.5 mg per hari. maka harus dimonitor efek antikoagulan. heparin secara sistemik. Pada pasien yang diberikan meloxicam dan diuretik bersamaan dianjurkan minum yang banyak dan dimonitor fungsi ginjalnya pada awal terapi. Cholestyramine akan mengikat meloxicam di saluran gastro-intestinal. karena obat NSAI dapat meningkatkan nefrotoksisitas melalui efek prostaglandin di ginjal. Pada pasien yang dehidrasi. Dianjurkan untuk memonitor kadar plasma lithium dari awal hingga akhir pengobatan dengan meloxicam.INTERAKSI OBAT : Pemberian bersamaan dengan satu atau lebih NSAI dosis tinggi dapat meningkatkan resiko ulkus gastro-intestinal dan pendarahan melalui kerja sinergis. Lithium : obat NSAI dilaporkan dapat meningkatkan kadar plasma lithium. Osteoartritis:7.5 mg/hari. Bila pemberian bersama obat anti koagulan tidak dapat dihindari. vasodilator. Pemberian bersamaan dengan methotrexate dapat meningkatkan toksisitas hematologi methotrexate. sehingga akan mempercepat eliminasi meloxicam. trombolitik dapat meningkatkan resiko pendarahan. Pasien yang mempunyai resiko meningkatnya efek samping : dosis awal 7. Pasien dialisa dengan gagal ginjal berat: dosis tidak boleh melebihi 7.

DKL9904125810A1 Artrilox 15 mg Tablet Box.Over Dosis : Pada kasus overdosis harus dilakukan tindakan pengurasan lambung dan tindakan penunjang lainnya karena belum diketahui antidotnya. 2 Strip @ 10 Tablet No. POSOLOGI : Dewasa dan anak diatas 14 tahun Dosis awal dianjurkan 500 mg kemudian dilanjutkan250 mg tiap jam sesudah makan. Kaplet 500 mg. KOMPOSISI : Tiap kapsui mengandung 250 mg Asam mefenamat "Flap kaplet 500 mg salut selaput mengandung 500 mg Asam mefenamat. JAUHKAN DARI JANGKAUAN ANAK-ANAK HARUS DENGAN RESEP DOKTER Di produksi oleh: COMBIPHAR BANDUNG-INDONESIA Asam Mefenamat Kapsul 250 mg. 2 Strip @ 10 Tablet No.Reg.DKL9904125810B1 SIMPAN DITEMPAT KERING DAN AMAN. INDIKASI : . KEMASAN : Artrilox 7. Kerusakan pada gastrointestinar~yang berat dapat diobati dengan antasida clan antagonis reseptor H2.Reg.5 mg Tablet Box.

pendenta asma. KEMASAN : Kapsul 250mg : Dus 10 strip® 10 Kapsui . EFEK SAMPING : Umumnya Asam Mefenamat dapat dibenkan dengan baik pada dosis yang dianjurkan. diare. sakit sehabis operasi dan melahirkan.Untuk menghitangkan segala macam nyeri dan ringan sampai sedang dalam kondisi akut dan kronis. Reg : GKL9930011201 A1 Kaplet 500 mg : Dus 10 strip® 10 Kaplet . KONTRA INDIKASI : Pada penderita dengati tukak lambung / usus. nyeri otot. termasuk nyeri karena trauma. No Reg GKL 9830010709 A1 CARA PENYIMPANAN : Simpan ditempat kering dansejuk. No. PERINGATAN DAN PERHATIAN : Jangan dibenkan pada penderita bronkospasme aliergik rhinitis.Indonesia Asimat CODE: C10 Harga Per Satuan Terkecil : Rp800. sakit kepala dan sakit gigi. P. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. Keamanan penggunaan pada anak-anak dibawah umur 14 tahun belum diketahui dengan pasti. Jangan digunakan lebih dan dosis yang dianjurkan atau lebih dari 7 hari kecuali atas petunjuk dokter. urticaria atau mendapat obat non steroid anti-inflamasi yang lain karena kemungkinan terjadi sensitiyitas silang Jangan digunakan pada wanita hamil dan menyusui.penderita ginjal dan penderita yang hipersensitif. Harus dengan resep dokter. terhindar dari cahaya.T. pada penggunaan jangka panjang yang terus menerus dengan dosis 2000 mg atau lebih sehan dapat mengakibatkan agranulositosis dan hemolitik anemia. nyeri sendi. muntah.00 BELI ASIMAT 500 . nyeri sewaktu haid. PHYTO KEMO AGUNG FARM A Jakarta .

muntah dan diare. nyeri otot. nyeri sewaktu haid. pusing. perdarahan lambung.KOMPOSISI : Tiap kaplet salut selaput ASIMAT500 mengandung Mefenamic Acid 500 mg CARA KERJA : Mefenamic Acid adalah suatu analgetik yang mempunyai daya anti-inflamasi. Agranulositosis dan hemolitik anemia mungkin dapat terjadi pada penggunaan dalam jangka waktu lama yang terus menerus dengan dosis 2000 mg atau lebih sehari. POSOLOGI / DOSIS : Dewasa dan anak-anak > 14 tahun : Dosis oral yang dianjurkan 500 mg kemudian dilanjutkan 250 mg setiap 6 jam jika diperiukan. sakit sehabis melahirkan. penderita asma. penderita ginjal dan penderita yang hipersensitif terhadap Mefenamic Acid. sakit kepala dan sakit gigi. termasuk nyeri karena trauma. . EFEK SAMPING : Efek samping yang timbul umumnya dapat ditolerir dengan baik pada dosis yang dianjurkan. INDIKASI : Untuk mengurangi nyeri dari ringan sampai sedang dalam kondisi akut dan kronis. Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. KONTRA INDIKASI : Pada penderita dengan tukak lambung / usus.

Jangan digunakan pada wanita hamil dan menyusui.Indonesia BlI-24/02/05 AULIN TABLET 100 MG Harga Per Satuan Terkecil : Rp4. MERSIFARMATM Sukabumi .PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. No. INTERAKSI OBAT : Antikoagulan oral. urticaria atau mendapat obat nonsteroid anti-inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. Jauhkan obat dari jangkauan anak-anak. Reg. Jangan digunakan lebih dari dosis yang dianjurkan atau lebih dari 7 hah kecuali atas petunjukdokter.550. allergic rhinitis. CARA PENYIMPANAN : Simpan di tempat sejuk dan kering. 10 strip @ 10 kaplet salut selaput ASIMAT 500. terlindung dari cahaya matahari. PENGEMASAN DAN NOMOR REGISTRASI Box. Keamanan pengguhaan pada anak-anak di bawah 14 tahun belum diketahui dengan pasti.00 BELI AULIN TABLET 100 MG KOMPOSISI : Tiap tablet mengandung Nimesulide 100 mg URAIAN : . DKL9833300909A1 HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT.

Orang dewasa 1 tablet 2xsehari setelah makan (1 tablet 100 mg) .Aulin tidak dianjurkan digunakan pada anak-anak dibawah 12 tahun KONTRA INDIKASI : . atau pendarahan gastrointetinal.Pasien yang diketahui hipersensitif terhadap Nimesulide .Pasien dengan riwayat reaksi hipersensitif (seperti bronkospasme. urticaria) terhadap OAINS dan acetosal . DOSIS & CARA PEMAKAIAN : .rhinitis. Setiap box berisi 2 blister @ 10 tablet 100 mg Nimesulide. .4-NITRO-2-phenoxymethane sulponanilide INDIKASI : Aulin merupakan suatu obat anti inflamasi non steroid untuk berbagai kondisi yang membutuhkan anti inflamasi.250. atau pendarahan aktif lainnya atau gangguan pendarahan . DKI 0051900210A1 PABRIK : Helsinn Birex Pharmaceuticals HARUS DENGAN RESEP DOKTER Benostan 500 Harga Per Satuan Terkecil : Rp1.Pasien dengan tukak lambung atau usus.Pasien dengan kelainan fungsi ginjal berat (CCT <30 ml/menit) . analgesika.Pasien dengan insufisiensi hepar sedang atau berat . antipiretika seperti osteoarthritis penyakit rematikekstra-artikular. rasa nyeri dan inflamasi setelah intervensi bedah dan setelah trauma akut dan dismenoria.Penggunaan pada anak-anak KEMASAN & NO REG. pendarahan serebrovaskular.Pasien dengan gangguan koagulasi berat .00 BELI BENOSTAN tab KOMPOSISI Mefenamic acid/Asam mefenamat .ulserasi berulang.

dehidrasi. nyeri rematik PENYAJIAN Dikonsumsi bersamaan dengan makanan : : : 3 kali sehari 250 -500 mg. sakit kepala. epilepsi. 3 kali sehari 500 mg. Obat seharusnya diberikan bila hanya keuntungan potensial memberikan alasan terhadap bahaya potensial pada janin.INDIKASI Nyeri. . KONTRA INDIKASI Ulkus peptikum atau ulserasi usus. KEMASAN Tablet 500 mg 10stp DOSIS • Dewasa Anak berusia 6 bulan atau • lebih Dismenore (nyeri saat • haid). PERHATIAN Kehamilan. ruam kulit. penyakit radang usus besar. EFEK SAMPING Gangguan & perdarahan saluran pencernaan. mengantuk. demam. ulkus peptikum. pusing. Interaksi obat : antikoagulan oral. asma. gugup. 6. kerusakan hati atau ginjal. INDEKS KEAMANAN PADA WANITA HAMIL Penelitian pada hewan menunjukkan efek samping pada janin ( teratogenik atau embriosidal atau lainnya) dan belum ada penelitian yang terkendali pada wanita atau penelitian pada wanita dan hewan belum tersedia. migren.5 mg/kg berat badan/hari dalam 3-4 dosis terbagi.gangguan penglihatan. diskrasia darah. penyakit ginjal.

INDIKASI : Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala. anti infiamasi dan antipiretik. Bimastan CODE: C11 Harga Per Satuan Terkecil : Rp200. muntah. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik.PABRIK Bernofarm. diare dan rasa sakit pada abdominal. . 500 mg. Penderita yang dengan Asetosal mengalami bronkospasme. sakit gigi. kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. KONTRA INDIKASI : Pasien yang hipersensitif terhadap Mefenamie Acid. termasuk nyeri karena trauma. dismenore primer. EFEK SAMPING : Sistem pencernaan : mual. CARA KERJA OBAT : Bimastan merupakan kelompok anti inflamasi non steroid. Penderita dengan tukak lambung dan usus. alergi rhinitis dan urtikaria. 250 mg. nyeri otot dan nyeri sesudahoperasi.00 BELI BIMASTAN© KOMPOSISI : Tiap kapsul mengandung: MefenamicAcid Tiap kaptab salut selaput mengandung: MefenamicAcid Tiap kaptab mengandung: MefenamicAcid 500 mg. Penderita dengan gangguan ginjal yang berat. TAKARAN PEMAKAIAN : Dewasa dan anak-anak > 14 tahun: Dosis awai: 500 mg.

-

Sistem hematopetik : leukopenia, eosinophilia, trombocytopenia dan agranulocytopenia. Sistem saraf : rasa mengantuk, pusing, penglihatan kabur dan insomnia.

PERINGATAN DAN PERHATIAN : Sebaiknya diminum sesudah makan. Hati-hati digunakan pada wanita hamil dan menyusui. Keamanan penggunaan pada anak - anak dibawah 14 tahun belum diketahui dengan pasti. KONTRA INDIKASI : Penggunaan bersama antikoagulan oral dapat memperpanjang "Prothrombin".

OVER DOSIS : Jika terjadi over dosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbon absorben) untuk menyerap obat. KEMASAN : Dus isi 10strip® "10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 10 strip @ 10 kaptab No. Reg. DKL 8931402104 A1 Dus isi 50 blister @ 10 kapsul No. Reg. DKL 8931402001 A1 Dus isi 40 blister @ 10 kaptab salut selaput No. Reg. DKL 9731407209 A1 Dus isi 10 blister @ 10 kaptab salut selaput No. Reg. DKL 0431407209 A1 Botol isi 1.000 kapsul No. Reg. DKL 8931402001 A1

250mg 500 mg 250 mg 500 mg 500 mg 250 mg

SIMPAN DITEMPAT SEJUK (15 - 25)°C DAN KERINGTERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT. BIMA MITRA FARMA TANGERANG - INDONESIA Bio mega CODE: C12

Harga Per Satuan Terkecil : Rp300.00 BELI BIO MEGA

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiro Vitamin B1 Vitamin B6 Vitamin B12 INDIKASI :

500 mg 50 mg 50 mg 100 mcg

Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat. KONTRA INDIKASI : * * * * Penderita hipersensitif Bayi di bawah 3 bulan, atau dengan berat badan di bawah 5 kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg

EFEK SAMPING : Agranulositosis, reaksi kepekaan, mengantukdan pusing."

PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik, lumbago, sakit punggung, bursitis, sindroma bahu, lengan. Karena dapat menimbulkan agranulositosis yang berakibat fatal, maka sebaiknya tidak digunakan dalam jangka panjang terusmenerus. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah, gangguan fungsi hati atau ginjal. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius.

DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput.

KEMASAN : Dus, isi 10 strip @ 10 tablet salut selaput NO. REG. DKL9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT. GRAHA FARMA SOLO - INDONESIA Biomega 10 Kaplet Harga Per Satuan Terkecil : Rp300.00 BELI Biomega

KOMPOSISI : Tiap tablet salut selaput mengandung : Metampiron Vitamin B1 Vitamin B6 Vitamin B12

INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia, terutama pada keadaan rasa sakit yang berat.

KONTRA INDIKASI :

sindroma bahu. Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah. DOSIS : Dewasa: Sehari 3 kali 1 tablet salut selaput. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. gangguan fungsi hati atau ginjal. KEMASAN : Dus. INTERAKSI OBAT : Metampiron bila diberikan bersama-sama dengan klorpromazina dapat menimbulkan hipotermia serius. DKL 9631106809 A1 Simpan di tempat yang sejuk dan kering HARUS DENGAN RESEP DOKTER PT.INDONESIA Biropyron Harga Per Satuan Terkecil : Rp300. isi 10 strip @ 10 tablet salut selaput NO.00 BELI BIROPYRON Kaplet Salut Selaput . sakit punggung. mengantuk dan pusing. lumbago.- Penderita hipersensitif Bayi dibawah 3bulan. REG. GRAHA PARMA SOLO . PERINGATAN DAN PERHATIAN : Tidak untuk pengobatan sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. bursitis.atau dengan berat badan dibawah 5kg Wanita hamil dan menyusui Penderita dengan tekanan darah sistolik 100 mmHg EFEK SAMPING : Agranulositosis. lengan. reaksi kepekaan.

DOSIS: 1 kaplet 3x sehari .000 kaplet No. DKL0231406809 A2 Botol isi 1. . DKL0231406809 A1 SIMPAN DITEMPAT SEJUK (15-25)°C DAN KERING TERLINDUNG DARI CAHAYA HARUS DENGAN RESEP DOKTER PT.Penderita dengan tekanan darah sistolik < 100 mm Hg EFEKSAMPING: Reaksi hipersensitif pada kulit. ginjal. karena itu perlu dilakukan pemeriksaan uji fungsi hati atau ginjal dan darah pada penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut.Wanita hamil dan menyusui .INDONESIA Bodrex CODE: C13 Harga Per Satuan Terkecil : Rp5. gangguan fungsi hati. Reg. PERINGATAN DAN PERHATIAN: . KEMASAN: Dus isi 10 Strip® 10 Kaplet No. misalnya kemerahan dan agranulositosis.Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik.Penderita hipersensitif . bursitis.hati pada penderita yang pernah mengalami gangguan pembentukan darah / kelainan darah. Reg. sakit punggung. KONTRA INDIKASI: . BIMA MITRA FARMA TANGERANG . .Karena dapat menimbulkan agranulositosis dan berakibat fatal.Hati.00 BELI BODREX . maka sebaiknya tidak digunakan dalam waktu panjang dan terus menerus.KOMPOSISI: Tiap kaplet salut selaput mengandung: Methampyrone 500 mg Thiamine HCl 50 mg Pyridoxine HCl 100 mg Cyanocobalamine 100 mcg INDIKASI: Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia.500.Pada pemakaian jangka lama dapat timbul sindrom neuropathy yang akan berangsur hilang bila pengobatan dihentikan. lumbago. sindroma bahu lengan. .

INDIKASI : Meringankan SAKIT KEPALA. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. segera hubungi dokter/unit pelayanan kesehatan terdekat. . DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. SAKIT GIGI dan menurunkan DEMAM. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. • Penderita Hipersensitif.Meringankan SAKIT KEPALA. • Reaksi hipersensitifitas. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. dapat meningkatkan resiko kerusakan fungsi hati. sakit gigi. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang.

PHARM.... No.. DBL 8522700810 A1 Dibuat oleh P.... TEMPO SCAN PACIFIC Tbk............50 mg CARA KERJA OBAT paracetamol merupakan analgetik-antipiretik dan ibuprofen merupakan obat golongan analgetik-antipiretik dan anti inflamasi non steroid (AINS) yang memiliki efek analgetik(menghilangkan rasa nyeri)...SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg.T. Bekasi-lndonesia atas lisensi dari DR..efek analgesik dari paracetamol dan ibuprofen bejerja sinergis dengan caffeine dalam meredakan sakit kepala INDIKASI ....00 BELI BODREX EXTRA KOMPOSISI tiap tablet mengandung : paracetamol....................... FABRIK / Rheinfelden / Germany P91108000 Bodrex Extra CODE: C111 Harga Per Satuan Terkecil : Rp3.700..........antipiretik(demam) dan anti inflamasi(mengurangi proses peradangan).....350 mg ibuprofen.........200 mg caffeine. FRITZ BODE GmbH/ CHEM....

No.muntah. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : .Tempo Scan Pacific Tbk.DTL0622719204A1 PT.00 BELI BODREX Meringankan SAKIT KEPALA. 3-4 kali sehari anak-anak 6-12 tahun : 1/2-1 kaplet.200. Bekasi-Indonesia Bodrex Flu batuk CODE: C14 Harga Per Satuan Terkecil : Rp1. 3-4 kali sehari EFEK SAMPING gangguan saluran cerna seperti mual.nyeri ulu hati.meredakan sakit kepala DOSIS dan ATURAN PAKAI dewasa dan anak-anak >12 tahun : 1-2 kaplet.kemerahan pada kulit dan gangguan darah INTERAKSI OBAT efek toksik dari paracetamol dapat meningkat pada pemberian bersam-sama dengan obat yang menyebabkan kerusakan hati SIMPAN PADA SUHU DI BAWAH 30'C Reg.

No. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. DBL 8522700810 A1 Dibuat oleh . sakit gigi. SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg. segera hubungi dokter/unit pelayanan kesehatan terdekat. • Penderita Hipersensitif. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. INDIKASI : Meringankan SAKIT KEPALA. SAKIT GIGI dan menurunkan DEMAM. • Reaksi hipersensitifitas. • Hati-hati penggunaan obat ini pada penderita penyakit ginjal. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. dapat meningkatkan resiko kerusakan fungsi hati.Parasetamol Kofein CARA KERJA OBAT : 600 mg 50 mg bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang.

P. FABRIK / Rheinfelden / Germany P91108000 Bodrex migra CODE: C15 Harga Per Satuan Terkecil : Rp1. PHARM. INDIKASI : Meringankan SAKIT KEPALA. FRITZ BODE GmbH/ CHEM.T. SAKIT GIGI dan menurunkan DEMAM. Parasetamol juga bekerja sebagai antipiretik untuk menurunkan demam. segera hubungi dokter/unit pelayanan kesehatan terdekat. • Penderita Hipersensitif. Bekasi-lndonesia atas lisensi dari DR. • Penggunaan obat ini pada penderita yang mengkonsumsi alkohol. DOSIS YANG DIANJURKAN : • Dewasa dan anak diatas 12 tahun : 1 tablet 3-4 kali sehari • Anak-anak 6-12 tahun : 1/2 -1 tablet 34 kali sehari • Atau sesuai petunjuk dokter. dapat . KONTRAINDIKASI : • Penderita gangguan fungsi hati yang berat. PERINGATAN DAN PERHATIAN : • Bila setelah 2 hari demam tidak menurun atau setelah 5 hari rasa sakit tidak berkurang. sakit gigi. TEMPO SCAN PACIFIC Tbk. • Reaksi hipersensitifitas. SAKIT' GIGI dan menurunkan DEMAM KOMPOSISI : Tiap tablet lapis dua mengandung : Parasetamol 600 mg Kofein 50 mg CARA KERJA OBAT : bodrex® mengandung Parasetamol yang bekerja sebagai analgesik untuk meredakan sakit kepala. EFEK SAMPING : • Dosis besardanjangka lama menyebabkan kerusakan fungsi hati.00 BELI BODREX Meringankan SAKIT KEPALA.300.

... FABRIK / Rheinfelden / Germany P91108000 Cargesik 500 Kaplet CODE: C111 Harga Per Satuan Terkecil : Rp250....T...... EFEK SAMPING : ...... Bekasi-lndonesia atas lisensi dari DR.... 500 mg Tiap kapsul mengandung Asam Mefenamat... TEMPO SCAN PACIFIC Tbk..Sistem saraf: rasa mengantuk... pusing.... Hati-hati penggunaan obat ini pada penderita penyakit ginjal.... No.... muntah..Sistem pencemaan : mual....... diare dan rasa sakit pada abdominal......... termasuk nyeri karena trauma.. eosinophilia..Penderita dengan gangguan ginjal yang berat.......Penderita yang dengan aspirin mengalami bronkospasme.. .. . alergi rhinitis dan urtikaria...Penderita dengan tultaK lambung dan usus.... FRITZ BODE GmbH/ CHEM..• meningkatkan resiko kerusakan fungsi hati. SIMPANLAH PADASUHU KAMAR (DIBAWAH 30 °C) KEMASAN : Kotak berisi 2 blister @ 10 tablet Reg.....Sistem hematopoetik : Leukopenia. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzym siklooksigenase sehingga mempunyai efek analgesik..... KONTRA INDIKASI: .... nyeri otot dan nyeri sesudah operasi.. PHARM.. penglihatan kabur dan insomnia.... .. 500 mg Asam Mefenamat merupakan kelompok anti-inftamasi non steroid.Sebaiknya diminum sesudah makan. anti-inflamasi dan antipiretik... dismenore primer.. sakit gigi...00 BELI Cargesik KOMPOSISI: Tiap kaplet mengandung Asam Mefenamat........ .... INDIKASI Meredam nyeri ringan sampai sedang sehubungan dengan sakit kepala.. ..... trombocytopenia dan agranulocytopenia............... PERINGATAN DAN PERHATIAN : .......Penderita yang hipersensitif terhadap asam mefenamat........ DBL 8522700810 A1 Dibuat oleh P.... ..

Reg. Dokter Carroll.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik. dengan melalui percobaan selama bertahun . Reg.: DKL 9323402504 A2 HARUS DENGAN RESEP DOKTER SIMPAN PADA SUHU KAMAR (25 .Hati-hati jika digunakan pada wanita hamil dan menyusui. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan. Cara pemakaian : Dewasa : . . Pemakaian sebaiknya sesudah makan.Botol plastik @ 500 kapsul No. isi 10 blister @ 10 kaplet No. rheumatik atau sering buang air diwaktu malam.: DKL 9323402504 Al . KEMASAN & No. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan. encok pada pangkal paha. Reg. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. USA. Dengan ramuan yang berhasil itu. isl 10 strip @ 10 kaplet No. kemudian dianjurion 250 mg tiap 6 jam sesuai dengan kebutuhan. . OVERDOSIS: Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktlf (karbo adsorben) untuk menyerap obat. Atau menurut petunjuk dokter.30)°C Semarang .Keamanan penggunaan pada anak-anak di bawah 14 tahun belum diketahul dengan pasti.. Pill ini cocok untuk : Sakit pinggang.Indonesia Carroll Super Pills Botol CODE: C17 Harga Per Satuan Terkecil : Rp11. INTERAKSI OBAT : Penggunaan bersamaan antikoagulan oral dapat memperpanjang "prothrombln*. Reg.Dus. DOSIS: Secara umum-dapat digunakan dosis pemakaian sebagai berikut: Dewasa dan anak-anak > 14 tahun : Dosis awal: 500 mg. Prof.000. : DKL 9123401701 Al .Dus.

3 kali sehari. No. Dianjurkan minum banyak air. diminum 2 dengan kali air sehari. yang dapat memulihkan kembali tenaga dan mempercepat penyembuhan. sehingga selain menyembuhkan Corroll's Super Pills juga menambah nafsu makan. Pill ini cocok untuk : Sakit pinggang. Perubahan warna ini adalah reaksi normal. diminum dengan air hangat. warna kencing menjadi biru atau hijau.00 BELI CARROLL'S SUPER PILLS Pill ini adalah ramuan dari Prof. pemakaian : makan. USA. Cara Dewasa 1 1 pill pill sebelum sebelum tidur. 2 kali sehari. Prof. PERHATIAN : Setelah menelan pill ini. 1 pill sebelum tidur.250.1 pill sebelum makan. Keadaan yang sedikit berat boleh makan : 2 pill sebelum makan. diminum dengan air hangat. Dokter Carroll. rheumatik atau sering buang air diwaktu malam.INDONESIA Carroll Super Pills Sachet CODE: C16 Harga Per Satuan Terkecil : Rp1. dengan melalui percobaan selama bertahun . hangat. 2 pill sebelum tidur. dan tidak menguatirkan. encok pada pangkal paha. D 7811980 DIPRODUKSI OLEH : ARTOIS FARMA TANGERANG . Reg. Dokter Carroll menambahkan vitamin Bl (Thiamine Mononitrate) dan Nicotinamide. Dengan ramuan yang berhasil itu.tahun dan selama itu telah dicobakan kepada para pasien dengan hasil yang baik. : .

dan tidak menguatirkan. diminum boleh 3 dengan banyak makan kali air : sehari. pusing atau vertigo. ruam kulit. No. Tidak boleh untuk anak. Reg. OLEH : FARMA . hangat.300.Keadaan 2 pill 2 pill Dianjurkan PERHATIAN yang sedikit berat makan. Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi Efek samping : kadang-kadang nyeri epigastrium. Kemasan : Dos 5x10 tablet 25 m. : sebelum sebelum tidur. minum Setelah menelan pill ini. Perubahan warna ini adalah reaksi normal.00 BELI Cataflam Kalium diklofenak 25 mg.INDONESIA CATAFLAM 25 CODE: C30 Harga Per Satuan Terkecil : Rp2. Dosis : Dewasa : awal :100-150 mg sehari. 50 mg/tablet. D 7811980 DIPRODUKSI ARTOIS TANGERANG . warna kencing menjadi biru atau hijau. sakit kepala. air.

350. Cataflam D 50 Harga Per Satuan Terkecil : Rp4. ruam kulit. osteoartritis (penyakit sendi degeneratif yang disertai dengan kelainan tulang . Tidak boleh untuk anak. Indikasi : pengobatan jangka pendek untuk nyeri dan inflamasi. Kemasan : Dos 5x10 tablet 50 m. 50 mg/tablet. pusing atau vertigo. sakit kepala. Dosis: Dewasa : awal : 100-150 mg sehari. INDIKASI : Pengobatan jangka pendek pada peradangan & nyeri sesudah operasi. Efek samping : kadang-kadang nyeri epigastrium.00 BELI CATAFLAM D KANDUNGAN : Diclofenac / Diklofenak.CATAFLAM 50 CODE: C31 Harga Per Satuan Terkecil : Rp4.200. keadaan meradang setelah trauma (terpukul/terbentur/teririrs) yang disertai rasa sakit/nyeri.00 BELI Cataflam Kalium diklofenak 25 mg.

PERHATIAN : • Gejala/riwayat penyakit lambung-usus. pankreatitis. menyusui. atau ginjal. DOSIS : • Dewasa: dosis awal 2-3 tablet. eritema multiform. penyakit Crohn. • Porfiria. gangguan sistem kardiovaskular (jantung dan pembuluh darah). antikoagulan. eritroderma. Siklosporin. peningkatan serum transaminase. sindroma Stevens-Johnson. pusing. Metotreksat. Interaksi obat : Lithium. sindroma Lyell. • Anak berusia lebih dari 14 tahun : 2 tablet. ruamkulit. Digoksin.berdekatan). diskrasia darah. KEMASAN : Tablet 50 mg x 50 biji. sakit kepala. INDEKS KEAMANAN PADA WANITA HAMIL : Baik penelitian reproduksi hewan tidak menunjukkan risiko pada janin maupun penelitian terkendali pada wanita hamil atau hewan coba tidak memperlihatkan efek merugikan (kecuali penurunan kesuburan) dimana tidak ada penelitian terkendali yang mengkonfirmasi risiko pada wanita hamil semester pertama (dan tidak ada bukti risiko pada trisemester selanjutnya). vertigo. • Jarang : ulkus peptikum. • Usia lanjut. • Kemampuan mengendarai & menggunakan mesin mungkin terpengaruh. meningitis aseptik. abnormalitas fungsi ginjal. KONTRA INDIKASI : Ulkus lambung atau usus. antidiabetes oral. reaksi hipersensitifitas. perdarahan lambung-usus. hepatitis. diuretika. • Kasus-kasus tertentu : gangguan perasaan atau penglihatan. • Hamil. • Asma. • Gangguan fungsi hati. jantung. purpura (keadaan yang ditandai dengan bercak-bercak perdarahan dalam kulit atau selaput lendir). reumatisme non artikular & sindroma nyeri pada tulang belakang. . EFEK SAMPING : • Kadang-kadang : gangguan saluran pencernaan. • Kehilangan volume ekstraseluler. gout akut. pneumonitis. Dianjurkan untuk memonitor secara teratur fungsi hati & hitung darah selama • penggunaan jangka panjang.

INDIKASI : Sebagai pengobatan jangka pendek untuk kondisi-kondisi akut seperti: Nyeri inflamasi setelah trauma. KONTRA INDIKASI : Hipersensitif terhadap diclofenac. Kadang-kadang peningkatan enzim SGOT. PABRIK Novartis. SGPT.00 BELI CATANAC KOMPOSISI : Tablet CATANAC 25 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac1 Tablet CATANAC 50 mg Tiap tablet salut enterik mengandung : Kalium Diclofenac FARMAKOLOGI : Kalium Diclofenac merupakan anti inflamasi yang bukan golongan steroid. EFEK SAMPING : Gangguan pada saluran pencernaan. hidung atau tenggorokan. Sebagai ajuvan pada nyeri inflamasi yang berat dari infeksi telinga. Selain anti inflamasi. seperti terkilir. peptic ulcer. seperti operasi gigi atau tulang. Peptic ulcer. Nyeri dan inflamasi setelah operasi. nyeri dan demam. pruritus dan depresi. vertigo. Catanac 50mg CODE: C18 Harga Per Satuan Terkecil : Rp2.Diberikan dalam 2-3 dosis terbagi.400. Bekerja menghambat biosintesa pros-taglandin yang merupakan faktor terbesar penyebab inflamasi. sakit kepala. juga menunjukkan efek analgesik pada nyeri sedang dan berat. PERINGATAN DAN PERHATIAN : .

diclo-fenac akan mempertinggi konsentrasi obat-obat tersebut dalam plasma. 200mg.00 BELI Celebrex Selekoksib 100 mg. INTERAKSI OBAT : Bila diberikan bersama produk lain yang mengandung Lithium. Reg. Tidak dianjurkan untuk wanita hamil dan menyusui. DKL 9806707515A1 Dus 30 tablet CATANAC 50 mg (3 strip @ 10 tablet salut enterik) No. gangguan fungsi jantung dan ginjal.950.T. KEMASAN : Dus 30 tablet CATANAC 25 mg (3 strip @ 10 tablet salut enterik) No. Kasus ringan dan anak lebih dari 14 th : 75-100 mg dibagi atas 2-3 kali sehari.Indonesia CELEBREX 100 CODE: C32 Harga Per Satuan Terkecil : Rp7. ETHICA Jakarta . Cyclosporin atau Digoxin. . Reg.Indonesia Untuk: P.Penderita dengan riwayat gangguan saluran cerna. DKL 9806707515B1 HARUS DENGAN RESEP DOKTER SIMPAN Dl TEMPAT SEJUK DAN KERING Dibuat oleh : P. sebaiknya dilakukan pemeriksaan fungsi hati dan darah secara periodik. Methotrexate. Bila diberikan bersama Neomycin. Bila diberikan bersama diuretik dan B Bloker. TAKARAN PEMAKAIAN : Dewasa : 100-150 mg dibagi atas 2-3 kali sehari. Pada pemakaian jangka panjang.T. tukak lambung. SOHO INDUSTRI PHARMASI Jakarta . dapat mempengaruhi/mengurangi efek kedua obat ini. akan berkurang absorbsinya. Cholestiramin dan liquid parafin.

Efek samping : Intoksikasi saluran cerna.00 BELI CETALGIN-T KOMPOSISI : Na Metamizol 500 mg . reaksi anafilaktik. Dosis : Osteoartritis:1x sehari 200 mg atau 2z sehari 100 mg. artritis reumatoid 2x sehari 100200 mg. Cetalgin Harga Per Satuan Terkecil : Rp850. Perihal : Dapat menyebakan intoksikasi saluran cerna. jangan diberikan pada wanita hamil karena dapat menyebabkan kelahiran prematur. pasien penderita asma. intoksikasi kardovaskuler. intoksikasi sistem saraf periferal. Kemasan : Dos 3x10 kapsul 100 mg. Kontra Indikasi : Hipersensivitas..Indikasi: penobatan ostoeartritis dan artritis rematoid. urtikaria.

EFEK SAMPING : Reaksi alergi. neuralgia. DOSIS • Dewasa • Anak berusia 8-12 tahun 3 kali sehari 1 kaplet. rasa sakit/nyeri yang berkaitan dengan penyakit lainnya.00 BELI CETALMICT . 1-2 kali sehari &frac12-1 kaplet. agranulositosis. sakit pinggang.100.Vitamin B1 Vitamin B6 Vitamin B12 Kafein INDIKASI : 60 mg 15 mg 15 mg 50mg Sakit kepala. Interaksi obat : Klorpromazin. KEMASAN : Kaplet 10 x 10 biji. porfiria. PENYAJIAN : Dikonsumsi bersamaan dengan makanan PABRIK: Soho Cetalmic 500 mg CODE: C19 Harga Per Satuan Terkecil : Rp1. perdarahan lambung-usus. KONTRA INDIKASI : Kelainan perdarahan. PERHATIAN : Hipersensitif terhadap Aspirin.

pusing. Keamanan pada anak-anak dibawah 14 tahun .KOMPOSISI : • CETALMIC® 250 kapsul Tiap kapsul mengandung asam mefenamat 250 mg • CETALMIC® 500 kaplet salut selaput Tiap kaplet mengandung asam mefenamat 500 mg FARMAKOLOGI : CETALMIC® mengandung asam mefenamat yang mempunyai khasiat analgesik. INDIKASI : Untuk menghilangkan berbagai rasa sakit dan nyeri dari ringan sampai sedang termasuk sakit kepala. muntah. asam mefenamat merupakan satu-satunya derivat fenamat yang memiliki daya kerja baik central maupun perifer. diare. penderita asma. nyeri haid. Kira . anti inflamasi dan antipiretik. penderita yang hipersensitif. EFEK SAMPING : Pada beberapa kasus pernah dilaporkan terjadinya rasa mual. Jangan digunakan pada wanita hamil/menyusui. Juga sebagai antipiretik pada keadaan demam. nyeri trauma. kadar puncak tercapai setelah 2 jam. Asam mefenamat terikat sangat kuat pada protein plasma. sakit gigi. agranulasitosis. PERINGATAN DAN PERHATIAN : Jangan diberikan pada penderita bronkospasma. hemolotik anemia. perdarahan lambung. Sebagai analgesik. waktu paruh dalam plasma adalah 3-4 jam.kira 50% diekskresi dalam urine dan 20% ditemukan dalam faeces. penderita ginjal. nyeri otot. nyeri setelah operasi dan melahirkan. rhinitis alergi atau mendapat obat non steroid anti inflamasi yang lain karena kemungkinan terjadi sensitivitas silang. KONTRA INDIKASI : Penderita tukak lambung/usus. Asam mefenamat cepat diabsorpsi.

10 strip @ 10 kapsul DKL9224209401A1 • CETALMIC8 500 mg kaplet salut selaput Box.00 BELI Danalgin Metampiron Diazepam .350. rhinitis. KEMASAN : • CETALMIC® 250 mg kapsul Box. Danalgin CODE: C20 Harga Per Satuan Terkecil : Rp1. Jangan digunakan lebih dari 7 hari kecuali atas petunjuk dokter.belum diketahui dengan pasti. CYBUFEN is also contraindicated in patients with active peptic ulcer. TAKARAN PEMAKAIAN : Dewasa dan anak di atas 14 tahun : Dosis awal 500 mg. CYBUFEN may also be used for other painful inflammatory conditions CONTRAINDICATIONS CYBUFEN should not be used in patients who have exhibited hypersensitivity during previous administration. dilanjutkan 250 mg tiap 6 jam. CYBUFEN should not be given to patients in whom aspirin or other nonsteroidal anti-inflammatory drugs have induced an asthmatic syndrome. urticaria. 10 strip @ 10 kaplet salut selaput DKL 9224209509A1 HARUS DENGAN RESEP DOKTER SIMPAN DI BAWAH SUHU 30°C TERLINDUNG DARI CAHAYA PT SOHO INDUSTRI PHARMASI JAKARTA-INDONESIA Cybufen 300mg Harga Per Satuan Terkecil : Rp5. Sebaiknya diberikan pada waktu makan. Due to the possibility of cross sensitivity.00 BELI INDICATIONS CYBUFEN is indicated for acute and long-term use in the relief of signs and symptoms of osteoarthritis and rheumatoid arthritis.050. angioedema or exacerbation of nasal polyps.

4 jam. usia lanjut dan penderita dengan gangguan hati yang berat. lumbago. Diazepam dimetabolisme terutama di hati dan terikat pada reseptor di daerah spinal cort. Waktu paruh bervariasi antara 20-70 jam. Konsentrasi plasma puncak diazepam dicapai setelah 15 . Hati-hati pada penderita yang pernah mengalami gangguan pembentukan darah/ kelainan darah. Mempunyai aktivitas sebagai ansiolitik dan hipnotik. Penderita dengan tekanan darah sistolik < 100 mmHg. Wanita hamil dan menyusui. Metampiron bekerja sebagai analgetik. tetapi metabolit aktif yang dominan yaitu desmetil diazepam mempunyai waktu paruh 30 -100 jam. Indikasi : Untuk meringankan rasa sakit sedang sampai berat terutama nyeri kolik dan sakit setelah operasi dimana dipehukan kombinasi dengan tranquillizer. Depresi pernapasan. Bayi dibawah 6 buian. Waktu paruh diazepam dan desmetil diazepam biasanya meningkat pada neonatus. gangguan fungsi hati atau ginjal. serebelum. diabsorpsi dari saluran pencernaan dan mempunyai waktu paruh 1 . Peringatan dan perhatian : Jangan mengemudikan kendaraan atau menjalankan mesin selama minum obat ini. Kontra indikasi : Penderita hipersensitif. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada . bursitis. maka sebaiknya tidak digunakan dalam jangka panjang terus menerus.Komposisi : Tiap kaplet mengandung : Metampiron 500 mg Diazepam 2 mg Farmakologi : DANALGIN bekerja sebagai anatgetik dan tranquillizer. Ttdak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. Keadaan psikosis akut. Glaukoma sudut sempit. Gangguan pulmoner akut.19 menit. sindroma bahu-lengan. Karena dapat menimbulkan agranulositosis yang berakibat fatal. sakit punggung. sistem limbik dan korteks serebral.

No. Interaksi obat: Penggunaan bersama obat-obat depresan SSP atau alkoho! dapat meningkatkan efek depresan. No. Mengantuk. : DPL8804405304A1 Kotak berisi 50 strip x 10 kaplet. berikutnya 1 kaplet tiap 6-8 jam. konstipasi. 30°C). retensi urin. keleiahan. mual. JAKARTA-INDONESIA Datan forte CODE: C21 Harga Per Satuan Terkecil : Rp1. Efek samping : Reaksi hipersensitivitas : reaksi pada kulit misal kemerahan.00 BELI DATAN®KapIet ASAM MEFENAMAT . HARUS DENGAN RESEP DOKTER DANKOS PT DANKOS FARMA. perubahan libido. No. Obat ini dapat menyebabkan kelemahan otot dan ketergantungan secara fisik dan psikologis. Hati-hati penggunaan pada penderita depresi berat atau yang mempunyai kecen-derungan melakukan bunuh diri. jaundice. Reg. Hentikan pengobatan jika terjadi reaksi-reaksi paradoksikal seperti keadaankeadaan hipereksitasi akut. hipotensi. Dosis : Jika sakit 1 kaplet.250. ansietas. : DPL8804405304A1 Simpan pada suhu kamar (maks.- penggunaan yang lebih lama dari penggunaan untuk mengatasi rasa sakit akut. depresi. halusinasi dan gangguan tidur. : DPL8804405304A1 Botol berisi 75 kaplet. tremor. maksimum 4 kaplet sehari. ataksia. dipiopia. Agranulositosis. vertigo. Kemasan: Kotak berisi 10 strip x 10 kaplet. Reg. : DPL8804405304A1 Kaleng berisi 500 kaplet. Reg. Reg. No.

Iritasi lambung jarang terjadi dan dapat dikiirangi dengan menelannya bersama makanan.nyeri otot. EFEK SAMPING : Pada beberapa orang dapat menyebabkan iritasi lambung. sakit kepala dan sakit gigi. keseleo. DATAN dapat diabsorbsi dengan baik oleh saluran pencernaan.Diare dapat terjadi pada penggunaan jangka panjang yang terus menerus dengan dosis 2.Komposisi : Tiap kaplet DATAN mengandung 250 mg Asam Mefenamat. nyeri sendi. . Kontraindikasi : Penderita tukak lambung dan usus.diare.Keamanan penggunaan DATAN pada wanita hamil belum diketahui. . liipersensitif. Peringatan dan perhatian : . mempunyai daya kerja sebagai analgetik yang kuat dengan disertai efek anti inflamasi dan antipiretik.000 mg atau lebih perhari dan merupakan indikasi untuk menghentikan pengobatan. . Farmakologi : DATAN dengan zat aktif Asam Mefenamat. Indikasi : Menghilangkan segala macam rasa nyeri baik akut maupun kronis.Efek samping adalah minimal pada dosis yang dianjurkan. Kadar maksimal dalam darah akan tercapai dalam waktu 2 jam setelah pemberian. Sekitar 50 % dari dosis yang diberikan akan diekskresikan melalui urine dalam bentuk inetabolit terkonyugasi dalam waktu 48 jam. nyeri sewaktu haid. DOSIS : . nyeri sehabis operasi dan melaliirkan.kolik usus. renal disease.Keamanan pada anak di bawah usia 14 tahun belum terbukti.seperti : nyeri karena trauma.mual dan sakit kepala. Tiap kaplet DATAN forte mengandung 500 mg Asam Mefenamat. .

.kemudian dilanjutkan dengan 250 500 mg setiap 6 jam.00 BELI DENTACID™ Komposisi Tiap kaplet mengandung Asam mefenamat .100.. HARUS DENGAN RESEP DOKTER Diproduksi oleh : PT PYRIDAM FARMATbk.. No.. Cianjur-lndonesia Dentacid 500 Harga Per Satuan Terkecil : Rp1.... Kaplet DATAN forte: Dus berisi 10 strip @ 10 kaplet... DKL8921004I04A1. No.. DKL8921004104B1 Penyimpanan: Simpanlah di tempat yang sejuk (15-25 * C) dan kering. Kemasan : Kaplet DATAN : Dus berisi 10 strip @ 10 kaplet.Dewasa: Dosis awal yang dianjurkan adalah 500 mg.. 500 mg Cara kerja obat Asam mefenamat merupakan kelompok antiinflamasi non steroid. Reg. bekerja dengan cara menghambat sintesa prostaglandin dalam jaringan tubuh dengan menghambat enzim siklooksigenase .. Reg.

sakit gigi. trombocytopenia dan agranulocytopenia. Dosis Dewasa dan anak-anak ± 14 tahun: Dosis awal 50 mg. . termasuk nyeri karena trauma. eosinophilia. Sistem saraf: rasa mengantuk. Kontraindikasi . kemudian dianjurkan 250 mg tiap 6 jam sesuai dengan kebutuhan. Peringatan dan perhatian .Pasien yang hipersensitif terhadap asam mefenamat. Indikasi Meredakan nyeri ringan sampai sedang sehubungan dengan sakit kepala.Penderita dengan tukak lambung dan usus. Efek samping Sistem pencernaan: mual.Penderita yang dengan asetosal mengalami bronkospasme. Sistem hematopoetik: leukopenia. penglihatan kabur dan insomnia. . . .sehingga mempunyai efek analgesik. diare dan rasa sakit pada abdominal. nyeri ototdan nyeri sesudah operasi.Keamanan penggunaan pada anak .anak dibawah 14 tahun belum diketahui dengan . . muntah.Hati-hati jika digunakan pada wanita hamil dan menyusui. antiinflamasi dan antipiretik. alergi rhinitis dan urtikaria.Penderita dengan gangguan ginjal yang berat. dismenore primer. pusing.Sebaiknya diminum sesudah makan.

Lindungi dari cahaya.pasti. No.Indonesia . Overdosis Jika terjadi overdosis maka pasien harus dirangsang muntah atau pasien diberi arang aktif (karbo absorben) untuk menyerap obat. Kemasan Dus isi 10 strip x 10 kaplet HARUS DENGAN RESEP DOKTER. Penyimpanan Simpan pada suhu kamar (di bawah 30°C). Reg. Interaksi obat Penggunaan bersamaan dengan antikoagulan oral dapat memperpanjang "prothrombin". HEXPHARM JAYA Cipanas .: DKL0704426004A1 Diproduksi oleh: PT.

Obat ini mempunyai sifat antiinflamasi. bursitis.00 BELI DIVOLTAR® Diklofenak natrium tablet salut enterik Komposisi : Tiap tablet salut enterik mengandung : Diklofenak natrium 25 mg atau 50 mg Farmakologi : DIVOLTAR® adalah obat antiinflamasi nonsteroid dengan struktur kimia yang baru (suatu derivat asam asetat). DIVOLTAR" hancur dan melarut langsung dalam usus halus. Obat ini 99. Bekasi .4 jam. analgesik dan antipiretik yang kuat. Seperti obat-obat antiinflamasi nonsteroid lainnya. Indikasi : 1. . ankilosing spondilitis. Diklofenak mengalami metabolisme lintasan pertama dalam hati. dimana diklofenak diabsorpsi dengan oepat. salah urat. tenosinovitis.Indonesia Divoltar 50mg CODE: C22 Harga Per Satuan Terkecil : Rp1. dan dislokasi. DANKOS FARMA Jakarta .7% terikat pada protein plasma dan waktu paruh eliminasinya 1 . Kadar puncak dalam plasma dicapai setelah 1 . DIVOLTAR® merupakan penghambat prostaglandin sintetase. Penyakit reumatik inflamatoar dan degeneratif: artritis reumatoid.2 jam. Kelainan muskulo-skeletal akut: periatritis. Menghilangkan/mengurangi rasa nyeri dan inflamasi nonreumatik. Sebagai tablet salut enterik. osteoartritis.500.Untuk: PT. termasuk bentuk juvenil. Dengan demikian. tendinitis.Indonesia Dipasarkan oleh: PT KALBE FARMA Tbk. Diklofenakdimetabolisme hampir sempurna dalam hati: ekskresi obat yang utuh melalui ginjal kurang dari 1%. iritasi lambung dikurangi. 2. dan penyakit pirai akut. 3.

3 mg/kg sehari. Anak 1 tahun atau lebih :1 .Kontra indikasi : 1. Dosis dan cara pemberian Dewasa : Dosis awal 75 -150 mg sehari. DKL8811606917B1 PT KALBE FARMA Tbk. penderita usia lanjut (lebih mudah mengalami efek samping obat-obat antiinflamasi nonsteroid). gagal ginjal dan sindroma nefrotik juga terjadi. ikterus. Efek samping: Pada awal pengobatan. Reg. dibagi dalam 2 . tetapi sangat jarang. fungsi ginjal.3 dosis. Penderita asma yang mengalami serangan asma. Peringatan dan perhatian : 1. . urtikaria. retensi cairan dan peningkatan serum transaminase kadang-kadang terjadi. penderita dengan insufisiensi hati. seperti halnya dengan obat-obat antiiflamasi nonsteroid lainnya. No. 2. atau rinitis akut bila mendapat asetosal atau obat-obat antiinflamasi nonsteroid lainnya. sendawa. DIVOLTAR® harus dihentikan. Ulkus peptikum atau perdarahan saluran cerna. Tablet harus ditelan seluruhnya sewaktu makan atau setelah makan. nausea dan diare. Reaksi kulir. DIVOLTAR® dapat meningkatkan kadar plasma lithium atau digoksin. nyeri kepala atau pusing. Leukopenia. Penderita yang mendapat pengobatan jangka panjang dengan DIVOLTAR®. hati dan hitung darah).3 dosis. No. dan anemia aplastik dapat juga terjadi. dosis biasanya 75 -100 mg sehari. Bila ini terjadi. Userasi dan perdarahan saluran cerna. Hipersensitivitas terhadap diklofenak.hati pada: penderita dengan gangguan saluran cerna atau dengan riwayat ulkus peptikum. DKL8811606917A1 Dos isi 5 strip x 10 tablet salut enterik. Reg. Untuk terapi jangka panjang. 3. 2. dibagi dalam 2 . dapat terjadi nyeri epigastrium. jantung atau ginjal yang parah. 4. harus dimonitor sebagai tindakan berjaga-jaga (mis. trombositopenia. DIVOLTAR® tidak boleh diberikan selama kehamilan kecuali bila mutlak diperlukan. Gunakan dengan hati . hepatitis. Kemasan : Tablet 25 mg : Tablet 50 mg : Dosisi 5 strip x 10 tablet salut enterik. 3. Efek samping ini biasanya ringan.

Efek samping: Efek samping yang biasa timbul adalah gangguan saluran cerna. serta reaktivitas bronkospastik terhadap asam asetilsalisilat atau antiinflamasi non steroid lainnya. Dosis : Dewasa : Anak-anak : 200 mg 400 mg 0. . dibagi dalam beberapa dosis. maksimum diberikan sebanyak 500 mg sehari. dibagi dalam beberapa dosis.1. sakit kepala atau vertigo.9 .Bekasi . Komposisi: DOFEN® 200 Tiap tablet salut selaput mengandung: Ibuprofen DOFEN® FORTE Tiap tablet salut selaput mengandung: Ibuprofen Indikasi: Reumatik artritis. 20 mg/kg bobot badan sehari. Simpan pada suhu kamar (di bawah 30°C).00 BELI DOFEN® 200 DOFEN® FORTE Tablet salut selaput DOFEN adalah tablet bersalut selaput (film coat) yang mempunyai khasiat sebagai analgetika-antipiretika dan antiinflamasi. Rasa nyeri ringan sampai sedang dan rasa nyeri pada waktu haid.6 .2 gram sehari. angiodema. Dofen Forte 400mg CODE: 121 Harga Per Satuan Terkecil : Rp400. Untuk anak yang bobot badannya kurang dari 30 kg.2. Kontra indikasi: Jangan diberikan kepada penderita yang hipersensitif terhadap ibuprofen atau penderita dengan sindroma polip hidung. osteoartritis dan gout artritis.Indonesia Lindungi dari cahaya.4 gram sehari. Atau menurut petunjuk dokter. HARUS DENGAN RESEP DOKTER. Dosis penunjang 0.

DKL8505001617B1 HARUS DENGAN RESEP DOKTER. Kemasan dan Nomor Registrasi: DOFEN 200 : Kotak. Pada penderita dengan riwayat penyakit saluran cerna bagian atas perlu dilakukan pengawasan yang ketat.00 BELI DOGMATIL SULPIRIDE 3 bidang pengobatan utama : ITUKAK SALURAN PENCERNAAN PSIKIATRI VERTIGO ■ Tukak saluran pencernaan Pengobatan pada waktu serangan : 2 . Hati-hati bila digunakan pada penderita dengan gangguan fungsi ginial dan perlu dilakukan monitor yang ketat. BAMBANG UTOYO 138 PALEMBANG-INDONESIA Dogmatil CODE: C23 Harga Per Satuan Terkecil : Rp3. Tidak boleh digunakan pada penderita yang diketahui hipersensitif terhadap aspirin atau antiinflamasi non steroid lainnya Hati-hati bila digunakan pada penderita dengan kelainan faktor intrinsik untuk pembekuan darah. 10 strip @ 10 tablet. DKL8505001617A1 DOFEN FORTE: Kotak.2 minggu. . Terapi penunjang : 3 kapsul @ 50 mg/hari selama 3 minggu. SIMPAN PADA SUHU DI BAWAH 30°C. pruritus. gangguan fungsi ginjal tetapi ini jarang terjadi.3 ampul/hari selama 1 .Juga dapat menimbulkan ruam kulit. Peringatan dan perhatian: Hati-hati bila digunakan pada penderita dengan riwayat dekompensasi jantung atau hipertensi. TERLINDUNG DARI CAHAYA. Pada dosis yang berlebihan dapat terjadi gejala saluran cerna dan gejala susunan saraf pusat.650. 10 strip @ 10 tablet. Dibuat oleh: DEXAMEDICA JL.

Anak-anak : 5 -10 mg/kg b.6 ampul/hari. • Depresi karena berbagai sebab. • Sindroma post gegar-otak.b. halusinasi. Tidak mempengaruhi sistim neurovegetative. Reg. D 6015158 . Dewasa : 2 . TOLERANSI : Pada terapi jangka panjang atau pada pengobatan ulangan tidak menimbulkan adiksi. Reg./hari. ■ Vertigo karena berbagai sebab 3. EFEK SAMPING : Kadang-kadang dapat menyebabkan gangguan siklus menstmasi atau efek extra pyramidal ringan yang mudah hilang. dibagi dalam beberapa dosis.4 tablet @ 200 mg/hari. • Psikosa pada masa anak-anak. Tanpa kontraindikasi maupun incompatibility. Kewaspadaan tetap terpelihara bahkan sering kali meninggi. KEMASAN: Tablet dalam strip berisi 20 @ 200 mg (khusus pemakaian psikiatri) No. keadaan delusi 2 . Reg. • Depresi pada geriatrik. • Neurosa dengan harnbatan psikomotor. • Keadaan depresi yang reaktif. dibagi dalam beberapa dosis. • Kelainan psikofungsionil • Kelainan tingkah laku yang ringan.Terapi lanjutan : 1 . (waham) kronis.6 kapsul/hari. dibagi dalam beberapa dosis. kebingungan./hari. • Kelainan tingkah laku yang berat. D 6015425 -Kapsul dalam strip berisi 20 dan 100 @ 50 mg.4 minggu.3 kapsul/hari selama 3 . dibagi daTam beberapa dosis. dan keadaan pra-psikosa. Terapi penunjang per oral: • Skizofrenia akut. remaja Anak-anak : 10 mg/kg b. ■ Kelainan psikiatri utama Pengobatan pada waktu serangan : • Psikosa akut dengan gejala-gejala 3 . D 7811131 -Ampul 6 @ 100 mg/2 ml No.b.4 kapsul @ 50 mg/hari. delusi. No.

preparat hipnotik.SIMPAN Dl BAWAH SUHU 30°C.PARIS . memperkuat efek analgesik Tramadol HCl namun dengan efek samping opioid yang minimal. baik akut maupun kronik serta nyeri setelah operasi.450. KONTRA INDIKASI : Intoksikasi akut bila digunakan bersama dengan alkohol.00 BELI Dolana KOMPOSISI : Setiap Kapsul mengandung : Setiap Suppositoria mengandung : Setiap 1 mL Larutan injeksi DOLANA 50 mg mengandung : Setiap 2 mL Larutan injeksi DOLANA 100 mg mengandung : CARA KERJA OBAT : Tramadol HCl adalah analgesik yang bekerja sentral.JAKARTA. TERLINDUNG DARI CAHAYA Tablet dan Kapsul di produksi oleh : PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Injeksi diproduksi oleh : PT ETHICA. . Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg Tramadol Hidroklorida 50 mg Tramadol Hidroklorida 100 mg INDIKASI : Untuk mengatasi nyeri berat. Dengan menghambat "reuptake". dengan sifatnya sebagai agonis partial pada reseptor opioid (reseptor U) yang berperan pada efek analgesik. noradrenaline pasca sinaptik dan memblok reseptor serotonergik. Disamping itu juga bekerja pada reseptor monoaminergik di susunan saraf pusat. SESIF .FRANCE DELAGRANGE Dolana Kapsul CODE: C122 Harga Per Satuan Terkecil : Rp3. untuk PT SOHO INDUSTRI PHARMASI JAKARTAINDONESIA Dengan lisensi dari DELAGRANGE.

gangguan fungsi ginjal dan hati yang berat atau hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok (renjatan ) Dapat terjadi penurunan fungsi paru-paru apabila penggunaan tramadol dikombinasi dengan obat depresi SSP lainnya atau bila melebihi dosis yang dianjurkan. Hendaknya tidak diberikan selama serangan asma bronkial atau kegagalan jantung sekunder sampai penyakit.000. tramadol tidak dapat menekan gejala "withdrawal" akibat pemberian morfin. mual. hipnotik maka efek sedasi/kelelahan kemungkinan meningkat. pruritus. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin. Pada penderita dengan gangguan fungsi ginjal / hati perlu dilakukan penyesuaian dosis. pusing. Hati-hati bila digunakan pada penderita trauma kepala. peningkatan tekanao intrakranial. sakit kepala.00 BELI Dolfenal . Tramadol HCl tidak boleh diberikan pada pasien yang menerima MAO Inhibitors. Penderita dengan depresi pernapasan terutama jika ada cyanosis dan sekresi bronkial yang berlebihan. PERINGATAN DAN PERHATIAN : Tramadol tidak boleh digunakan pada penderita ketergantungan obat. Penderita yang hipersensitif terhadap tramadol atau opiat. paru-paru kronik EFEK SAMPING Berkeringat. muntah. Dispepsia obstipasi. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi tramadol dengan cepat. sedasi.- analgesik atau obat-obat lain yang bekerja pada susunan saraf pusat. DOLFENAL CODE: C33 Harga Per Satuan Terkecil : Rp1.1 % tramadol diekskresikan melalui ASI. Penderita yang mendapat pengobatan penghambat MAO. kemerahan. INTERAKSI OBAT : Dengan obat-obat yang bekerja pada susunan saraf pusat seperti Trankuilizer. Pertimbangkan manfaat dan resiko yang mungkin terjadi bila digunakan pada wanita hamil dan menyusui karena 0. Meskipun termasuk antagonis opiat. mulut kering dan lelah.

Dolika Kapsul CODE: C123 Harga Per Satuan Terkecil : Rp2. Indikasi : nyeri. de3hidrasi.gangguan penglihaan.diskrasia darah.00 BELI DOLIKA INJEKSI / KAPSUL KOMPOSISI Tiap ml Dolika 50 Injeksi mengandung : Tiap ml Dolika 100 Injeksi mengandung : Tiap kapsul mengandung : Tramadol HCI Tramadol HCI Tramadol HCI 25 mg 5 mg 50 mg Dewasa dan anak >14 tahun : kemudian 250 mg. Kontra indikasi : Tukak/inflamasi saluran cerna.Asam mefenamat 500 mg. Dosis : 4x sehari : Kemasan : Dos 100 tablet. kerusakan hati dan ginjal. asma. . hipersensivitas.pusing.sakit kepala.reaksi kulit. Efek samping : Gangguan saluran cerna.700.mengantuk. Perihal : tukak lambung.nefropati. peradangan.perdarahan saluran cerna.

CARA KERJA OBAT Tramadol HCI merupakan Non-Opioid Analgetika yang bekerja pada reseptor opioid. Dolika tidak boleh diberikan lebih lama daripada yang diperlukan. Pada penderita dengan gangguan fungsi ginjal atau hati. INDIKASI Nyeri akut dan kronik berat. dapat ditambahkan injeksi 1 ml Dolika atau 1 kapsul Dolika setelah selang waktu 30 . EFEK SAMPING . Lama pengobatan : Pada pengobatan Dolika jangka panjang. Apabila masih terasa nyeri. Nyeri pasca operasi. Karenanya dokter harus menetapkan lamanya pengobatan.60 menit. kemungkinan terjadinya ketergantungan tidak dapat disingkirkan. perlu dilakukan penyesuaian dosis. dosis Dolika yang diberikan adalah sebagai berikut : Dosis untuk orang dewasa dan anak umur di atas 14 tahun : DOLIKA KAPSUL : Dosis tunggal : 1 kapsul Dosis harian : sampai 8 kapsul Dosis tersebut biasanya cukup untuk meredakan nyeri. atau bila pengobatan perlu dihentikan sementara. biasanya diberikan dalam bentuk injeksi DOSIS PEMAKAIAN Dosis yang diberikan sebaiknya disesuaikan dengan intensitas nyeri Bila tidak ada petunjuk lain dari dokter. Nyeri akibat tindakan diagnostik. Dosis harian sebesar 400 mg/hari jangan dilampaui.

obstipasi. analgesik atau obat-obat yang mempengaruhi SSP lainnya.- Sama seperti analgesik sentral lainnya. Jarang sekali terjadi reaksi ortostatik akibat pemberian injeksi Tramadol dengan cepat. hipnotika. hipnotika) dapat meningkatkan efek sedasinya. sampai sekarang terbukti insidens ketergantungan setelah penggunaan Dolika jarang dijumpai. Simpan di tempat kering dan sejuk. efek samping berikut dapat terjadi pada pengobatan Dolika : mual. dispepsia.100. Penderita yang hipersensitif terhadap tramadol atau opiat.00 BELI DOLO FENAC iniamme Monomtrate + Lyanocobalamin Vitamin Neurotropik + NSAID Komposisi : Setiap tablet salut enterik mengandung: . Dolo fenac CODE: C24 Harga Per Satuan Terkecil : Rp3. berkeringat. muntah. Penderita yang mendapat pengobatan penghambat MAO. mulut kering dan sakit kepala. KONTRA INDIKASI Intoksikasi akut dengan alkohol. sedasi. INTERAKSI OBAT Penggunaan injeksi Dolika bersama dengan obat-obat yang bekerja pada SSP (seperti tranquiliser. CARA PENYIMPANAN Jauhkan dari jangkauan anak-anak. kulit kemerahan. terhindar dari cahaya. Meskipun tramadol berinteraksi dengan reseptor opiat. pusing. pruritus. Sebaliknya penggunaan tramadol bersama dengan tranquiliser juga dapat meningkatkan efek analgesiknya. lelah.

Dosis dan Pemberian Tiga tablet per hari. edema. yang merupakan koenzim reaksi karboksilasi dan transaminasi. dengan demikian mempengaruhi pematangan sel dan memelihara keutuhan jaringan syaraf. Efek anti inflamasi serta efek farmakologis lainnya berhubungan dengan efek penghambatan sintesa prostaglandin. Obat ini harus diberikan dengan hati-hati pada pasien dengan gangguan ginjal.s diperiukan dalam sintesis asam nukleat dan mielin.OiclofenacSodium Pyridoxol HCI Thiamine Mononitrate Vitamin B12 Mekanisme Kerja : 50 mg 50 mg 50 mg 1 mg Diclofenac merupaKan obat anti inflamasi non steroid. berfungsi terutama dalam metabolisme protein dan asam amino. Perhatian : Diclofenac dapat menyebabkan retensi cairan. Perhatian atau larangan penggunaan selama hamil dan menyusui : .Penderita dengan luka atau pendarahan pada saluran cerna. Thiamin penting untuk metabolisme karbohidrat. Indikasi : Meringankan rasa sakitsedangsampai beratyangdisertai neuritisdan/atau neuralgia. anti inflamasi analgesik. efektivitas dan banannya belum diketahui. Vitamin B. Untun oengobatan inflamasi dan penyakit-penyakit rematik degeneratif. pemberian Diclofenac bersama NSAID lainnya tidak direkomendasikan. hati dan jantung penderita usia lanjut. mempunyai efek sebagai anti rematik. dan gangguan koagulasi pada pasien dengan penyakit kardiovaskular atau hipertensi. lebih baik setelah makan. dalam tubuh dikonversi menjadi bentuk aktifnya thiamin pirofosfat yang merupakan koenzim pada reaksi dekarboksilasi asam aketo. Pasien dapat diobati dalam waktu lama iika diperiukan sesuai anjurandokter.pada pasien dengan dehidrasi. Pada anak. Pyridoxol HCI di dalam tubuh diubah menjadi pyridoxol fosfat. akan meningkatkan resiko toksisitas ginjal.

gangguan ingatan. erythroderma (exfoliative dermatitis). Pada penghentian pyridoxol. anoreksia. eczema. perdarahan usus. disorienteasi. muntah. diare berdarah. retensi urin. Polycythemia vera. lesi esophagus. mual. Kulit (kasus tersendiri) : vesicular eruptions. glositis. ada perbaikan bertahap pada disfungsi neuronal dan pemulihan secara menyeluruh pada pasien-pasienini. sindroma Stevens-Johnson toxic epidermal necrolysis.pusing. Ginjal (kasusjarang): hematuria. kondisi sistim pencernaan. Pemberian pyridoxol dosis tinggi dapat menyebabkan smdroma neuropati sensoris tertentu.Kadang-kadang terjadi: colitis ulserativa atau Crohn's procto'colitis' gingivostomatitis. hati dan ginjal harus diteliti terlebih dahulu. proteinuria. flatulence. gangguan rasa.sakit kepala. Sebelum meresepkan obat ini. insufisiensi renal akut.jarang terjadi : gastroduodenal hemoragik (perdarahan gastro-duodenal). reaksi fotosensitif.kelelahan. dispepsia. Sistem pencernaan : sakit perut. Erupsi kulit dan reaksi hipersensitifitas lain yang diketahui disebabkan oleh formulas! ini. .Tfitasi psikotik. meskipun studi histopatologik tidak menunjukkan adanya hubungan smdroma tersebut dengan semua tingkatan degenerasi neuronal. Perhatian dan kemungkinan efek karsinogenik. konstipasi. hal ini dihubungkan dengan hipersensitifas yang jarang terjadi. erythema multiforme.gangguan sensoris dan visuat. alopecia. Efek samping : Ada laporan tersendiri mengenai reaksi pada pemberian parenteral thiamin dan vitamin B12 untuk jangka panjang. hematemesis ulkus perforasi. diare. Sistem saraf pusat : dizziness.TJhnifus.Obat tidak boleh digunakan selama kehamilan dan menyusui. mutagenik dan teratogenik dan efek pada fertilitas: Tidak ada bukti efek karsinogenik.Kasus yang jarang:parestesia. mutagenik dan teratogenik atau efek fertilitas pada studi manusia atau hewan. insomma. purpura.

meskipun signifikansinya tidakjelas. Pyridoxol fosfat menyebabkan dekarboksilasi perifer levodopa sehingga menurunkan efikasi pada pengobatan penyakit Parkinson. Darah ( kasus tersendiri) : thrombocytopenia. urticaria atau rhinitis yang dipicu oleh asam asetilsalisilik atau derifatnya. Penggunaan penicillamine yang diperpanjang dapat menyebabkan kekurangan vitamin B. Qastroduodenal/peptic ulcer. Jika pyridoxol diberikan bersama cyclosporine.aplastic anemia. Polycythemia vera. Pemberian carbidopa dengan levodopa secara bersamaan menghambat efek pyridoxol Pyridoxol HCI tidak boleh diberikan pada dosis lebih tinggi daripada 5 mg per hari pada pasien yang sedanq diobati dengan levodopa saja. Interaksi : Thiamin dilaporkan berpotensi terjadinya penghambatan neuromuscular. hepatitis.hemolyticanemia. Vitamin B12 tidak boleh diberikan pada tingkat awal penyakit Leber (atrophl hereditari dari saraf optik). Kontraindikasi : Hipersensitifitas terhadap obat ini. dengan atau tanpa penyakit kuning. reaksi anafilaksis.agranulocytosis. . antagon. Cycloserine dan hydralazine adalah vitamin B..leucopenia.Hati (kasus jarang) : peningkatan aktifitas aminotransferase (glutamic-pyruvic dan glutamic-oxaloacetic transaminases). edema. Hipersensitifitas (kasus jarang) : arterial hypotension. kadar plasma ada kemungkinan menurun. Pengobatan dengan pyridoxol HCI 200 mg per hari selama satu bulan menurunkan sampai 50% konsentrasi serum phenobarbital dan phenytoin.s dan pemberian pyridoxine menurunkan efek samping neuronal dengan penggunaan obat-obat ini. Pasien yang mengalami bronchial.

Penggunaan antiinflamasi nonsteroid lain secara bersamaan dapat meningkatkan resikoefeksampingvangtidakdiinginkan. Pemberian neomycin dan colchicine secara simultan memperburuk absorbs! vitamin B secara oral. Pengukuran pendukung harus dilakukan untuk mengobati hipotensi. asam aminosalisilik dan garamnya.. Monitoring yang cukup direkomendasikan untuk kasus-kasus ml.00 BELI DOLO MEGANEURON Kaplet Salut Selaput KOMPOSISI : . Overdosisatau ingestion taksengaja:Gejala dan Penanganan (Antidot) Tidak ada kasus yang dilaporkan tentang overdosis dengan thiamin atau vitamin B. Diclofenac menurunkan aktivitas obat-obat diuretik. primidone). Kemasan : Boks lO blister® lO tablet salut enterik Dolo Meganeuron Harga Per Satuan Terkecil : Rp750. dan supresi pernafasan. insufisiensi qinial konvulsi. dan oleh asupan aikohol yang berlebihan selama lebih dan 2 minggu. tetapi tidak pada pasien dengan gastrectomy parsial atau total Kepentingan klinis dan observas* ini tidak diketahui. Tindakan berikut ini harus dilakukan: bilas lambung dan pemberian charcoal aktif. pengobatan pennnjang dan simptomatik harus dilakukan Tidak ada gambaran spesifik mengenai hal itu. harus diperhatikan kemungkinan ini pada saat meresepkan dosis tinggi asam askorbat dengan vitamin B12. Pemberian kloramfenikol dan vitamin B„ secara simultan dapat memperburuk responhemopoietic terhadap vitamin. iritasi pada usus halus oleh kobalt. golongan potasium lepas lambat. Prednisone dilaporkan meningkatkan absorpsi vitamin B12 dan sekresi faktor intrinsik pada beberapa pasien dengan anemia pernicious. Pemberian diclofenac dengan obat-obat lithium-based atau digoxin atau siklosporin atau metotreksat secara simultan dapat menyebabkan peningkatan plasma obat-obat ini. iritasi gastrointestinal. Asam askorbat dapat menghancurkan jumlah vitamin B12 secara signifikan dan faktor intrinsik dalam kondisi in vitro. Pada kasus intoksikasi akut dengan diclofenac.Absorpsi vitamin B„ di sistim gastrointestinal dapatditurunkan dengan pemberian berikut ini aminoglikosida colchicme. Pasien diobati dengan antikoagulan harus dimonitor dengan ketat Obat-obat antnnflamasi nonsteroid harus dihentikan 24 jam sebelum memulai pengobatan dengan metotreksat untuk mencegah peningkatan plasma cytostatic dan kejadian efektoksik. Neuropathy sensoris dan sindroma neuropati sensoris lainnya yang disebabkan pemberian pyridoxol megadoses akan sembuh dan pulih kembali dengan penghentian pengobatan. antikonvulsan (phenytoin' phenobarbital.

Thiamine HCl. INDIKASI : Meringankan rasa sakit yang disebabkan oleh neuritis dan neuralgia. bursitis. Karena itu perlu dilakukan pemeriksaan uji fungsi hati dan darah pada penggunaan yang lama untuk mengatasi rasa sakit akut. Bayi dibawah 6 bulan. sindroma bahu-lengan. sakit punggung. Hati-hati dengan penderita yang pernah mengalami gangguan pembentukan darah/kelainan darah. mempunyai waktu paruh 1 -4 jam. . Diabsorpsl dan saluran pencemaan. Wanita hamil dan menyusui. terutama pada keadaan sakit yang berat.Tiap Kaplet Salul Selaput mengandung: Methampyrane TniamineHCI Pyridoxine HCl Cyanooobalamine 500 mg 50 mg 100 mg 100 mg FARMAKOLOGI : Methampyrone bekerja sebagai analgesia. lumbago. Penderita dengan tekanan darah sistolik < 100 mmHg. Karena dapat menimbulkarragranulositosis yang berakibat fatal. maka sebaiknya tidak digunakan dalam jangka waktu terus menerus. Pyrldoxine HCl dan Cyanocobalamine dalam dosis besar dapat membantu memelihara fungsi sel-sel saraf. gangguan fungsi hati atau ginjal. PERINGATAN DAN PERHATIAN : Tidak untuk mengobati sakit otot pada gejala-gejala flu dan tidak untuk mengobati rematik. KONTRA INDIKASI : Penderita hipersensitif.

INDONESIA R.032.900. DOSIS : 1 Kaplet salut selaput 3 kali sehari KEMASAN : Dus.Reg. EMBA MEGAFARMA SEMARANG .EFEK SAMPING : Reaksi hipersensitifitas: reaksi pada kulit misal kemerahan. 10 strip @ 10 kaplet salut selaput No. Agranulositosis.1 Dolocap Harga Per Satuan Terkecil : Rp1.00 BELI DOLOCAP capsul KOMPOSISI : Tiap kapsul mengandung: Tramadol HCI 50 mg FARMAKOLOGI : Tramadol HCI merupakan suatu analgetik opioid.: DKL 9815706509 A1 SIMPAN DITEMPAT YANG SEJUK DAN KERING HARUS DENGAN RESEP DOKTER Produksi: PT. .

kulit kemerahan.INDIKASI : • • Digunakan untuk: Nyeri akut dan kronik yang berat. terutama dengan adanya cyanosis. kelelahan dan miosis. dispepsia. berkeringat. Nyeri pasca bedah. palpitasi. koma. hypotension. OVER DOSIS : • • Pada pemberian over dosis dapat terjadi miosis. Intoksikasi akut dengan alkohol. DOSIS : Dosis yang diberikan disesuaikan dengan intensitas nyeri lazimnya : • 1 kapsul sehari (maksimum 8 kapsul per hari). muntah. drowsiness. atau obat-obat analgetik opiat atau obat-obatyang mempengaruhi SSP lainnya. hypotermia. apabila masih terasa nyeri dapat ditambahkan 1 kapsul setelah selang 30 . KONTRA INDIKASI: • • • • Penderita yang hipersensitif terhadap Tramadol atau opiat. hipnotika. kolaps kardiovaskular. Pada anak-anak dan bayi dapat terjadi kejang-kejang. EFEK SAMPING : • • • • Pada dosis normal. sembelit. Pada dosis lebih besar dapat menyebabkan depressi pernapasan dan hipotensi dengan kegagalan sirkulasi dan koma. brandikardia orthostatic. sodasi. Penderita yang mendapat pengobatan MAO inhibitor. seperti pada golongan analgesik opiat (analgesik sentral) dapat terjadi: mual.60 menit. Penderita dengan depressi pernapasan. Mulut kering. confusion. kejang dan depressi pernapasan. Dosis tersebut di atas biasanya cukup untuk meredakan nyeri. mungkin juga dapat terjadi spasme uterik atau biliary. . muntah. Untuk mengatasi depressi pernapasan dan syok dengan Naloxone HCI. vertigo.

gangguan fungsi ginjal dan hati yang berat. kering dan terlindung dari cahaya. . Tidak boleh diberikan lebih lama dari petunjuk dokter. KEMASAN : Dos berisi 5 blister® 10 kapsul PENYIMPANAN : Simpanlah di tempat yang sejuk. Meskipun termasuk antagonis opiat. Oleh karena itu dokter harus menentukan dengan jelas lama pengobatan. Tramadol tidak dapat menekan gejala "witdrawal" akibat pemberian morfin. Hati -hati pemberian pada ibu menyusui karena 0. Selama minum obat ini jangan mengendarai kendaraan bermotor atau menjalankan mesin.• Nalorphine HBr. obat-obat hipnotika. Keracunan akut lewat mulut dapat diatasi dengan pengosongan lambung. Hati-hati bila digunakan pada penderita trauma kepala. peningkatan tekanan intra kranial.1% Tramadol diekskresikan melalui ASI. HARUS DENGAN RESEP DOKTER. tranquillizer. Pada pengobatan jangka panjang. • Sebaliknya penggunaan Tramadol bersama dengan tranquillizer juga dapat meningkatkan efekanalgesiknya. hipersekresi bronkus karena dapat meningkatkan resiko kejang atau syok. antidepressan trisiklik dan anestetika. Dapat terjadi penurunan fungsi paru bila Tramadol digunakan bersama dengan obat-obat penekan SSP lainnya atau bila penggunaan melebihi dosis yang dianjurkan. Pemberian pada wanita hamil harus dipertimbangkan manfaat dan resiko yang mungkin terjadi. dapat menyebabkan ketergantungan. PERHATIAN : • • • • • • • • Tramadol tidak boleh digunakan pada penderita ketergantungan obat. INTERAKSI OBAT : • Efek depressi / sedasi diperkuat dengan adanya obat-obat yang bekerja pada SSP seperti : alkohol. sedangkan kejang dapat ditekan dengan pemberian Benzodiazepin. Levallorphan tartrat.

demam pada anak-anak dan dewasa. KONTRA INDIKASI : Penderita tukak lambung . nyeri pasca bedah dan persalinan. yaitu analog amin asam salisilat.00 BELI DOLODON kapsul * captab * suspensi capsule * captab * suspension KOMPOS1SI : DOLODON 250 Kapsul : DOLODON 500 Captab : DOLODON Suspensi : Tiap kapsul berisi 250 mg Asam Mefenamat Tiap captab mengandung 500 mg Asam Mefenamat Tiap sendok takar (5ml) suspensi mengandung 50 mg Asam Mefenamat.Dolodon CODE: C25 Harga Per Satuan Terkecil : Rp250. Dibandingkan dengan aspirin. ± 50 % dari dosis yang diberikan ditemukan kembaii dalam urine. Asam Mefenamat diserap dari traktus gastro intestinal dan kadar dalam sirkulasi mencapai puncaknya dalam waktu 2 jam setelah pemberian obat. nyeri rematik. terutama dalam bentuk metabolitnya. nyeri waktu haid. FARMAKOLOGI : DOLODON berisi Asam Mefenamat yang merupakan derivat asam antrani-lat. Dalam waktu 48 jam. yang mempunyai daya antipiretik dan anatgesik dengan potensi yang sama dengan aspirin dan dengan sedikit daya anti inflamasi. sakit gigi. Asam Mefenamat ku-rang menyebabkan terjadinya pendarahan gastrointestinal. DOLODON Suspensi dengan rasa pisang yang enak dan manis disiapkan untuk anakanak dan penderita yang mengalami kesulitan menelan kapsul atau captab. INDIKASI : Untuk menghilangkan rasa nyeri pada sakit kepaia.

No. No. dosis koumarin hams dikurangi. Hati-hati pada penderita asma karena akan memperburuk keadaan.PERINGATAN & PERHATIAN : * * * * * Dapat mengurangi jumiah trombosit. Sebaiknya tidak diberikan pada wanita hamil dan wanita menyusui. Atau menurut petunjuk dokter. PENYIMPANAN : Simpan pada suhu dibawah 30°C. Pemberian harap dihentikan setelah 7 hari tidak memberikan hasil.5 mg Asam Mefenamat per kilogram berat badan. EFEK SAMPING : * * Dapat menyebabkan iritasi tractus gastro intestinal Skin rash dan diare dapat terjadi dan akan hiiang jika pengobatan dihentikan. DKL 8714504033 A1 HARUS DENGAN RESEP DOKTER .Botol plastik isi 500 kapsul Reg. DKL 8714504104 A1 Botoi isi 60 ml netto Reg. D 7812379-1 Dus berisi 10 strip x 10 captab Reg. No. D 7812379 . Hati-hati pada penderita gangguan fungsi hati dan ginjal. 3 kali se-hari dengan interval 6 sampai 8 jam. kemudian 250 mg setiap 6 jam 6. No. DOSIS : Dewasa : Anak-anak : Mula-mula 500 mg. paling lama 7 hari. SEDIAAN dan KEMASAN : * DOLODON 250 Kapsul : * DOLODON 500 Captab : * DOLODON Suspensi : Dus berisi 10 strip x 10 kapsul Reg. terutama bila digunakan bersama-an antikoagulan koumarin.

500. KEMASAN : ( HNA + ) Dos 10 x 10 kapsul Duplopyrin Strip CODE: C111 Harga Per Satuan Terkecil : Rp2.00 BELI DOLOFEN – F Ibu profen 400 mg. INDIKASI : Menghilangkan rasa nyeri dan gejala arthritis reumetoid dan osteoarthritis.00 BELI Duplopyrin KOMPOSISI : Tiap tablet DUPLOPYRIN mengandung : Fenilbutazon 125 mg Etoksibensamid 125 mg Aluminium Hidroksida Gel kering 100 mg Magnesium Trisilikat 5H2O 150 mg . DOSIS : 3 x sehari 1 kaplet / kapsul .Produksi : PT MECOSIN INDONESIA JAKARTA Dolofen-F CODE: C26 Harga Per Satuan Terkecil : Rp500.

Dapat menghambat absorpsi tetrasiklin dan vitamin-vitamin serta memperlambat absorpsi quinidin. 2815773 Dus isi 24 blister @10 tablet . INTERAKSI OBAT : Dapat meningkatkan etek tolbutamide dan kumarin. ginjal dan hati. ankylosing spondylitis. KONTRA INDIKASI Hipertensi. No. No. hipersensitivitas serta gangguan fungsi jantung. Reg. pada suhu kamar (25-30°C) dan terlindung dan bahaya KEMASAN : Kaleng plastik isi 1000 tablet . hati atau kardiovaskuler. osteo arthritis. Atau menurut petunjuk Anak-anak : dokter. : D. gangguan fungsi ginjal. gouty arthritis.INDIKASI Penyakit Rheumatik termasuk rheumatoid arthritis. Disesuaikan dengan usia dan berat badan. Reg. Magnesium Trisilikat dalam bentuk garam magnesium mudah diserap dan bila terjadi gangguan fungsi ginjal dapat menyebabkan keracunan magnesium. tukak lambung. PERINGATAN & PERHATIAN : Hati-hati penggunaan pada penderita ulkus peptikum. ATURAN PAKAI : Dewasa : 1 tablet 3 kali sehari. juga pada penyakit tiroid dapat terjadi penahanan fungsi sumsum tulang. CARA PENYIMPANAN : Simpan di tempat kering. 2815773-1 . Harus berhati-hati pemberiannya pada penderita dengan gastritis. : D.

... seperti operasi gigi dan tulang..00 BELI EFLAGEN Tiap tablet mengandung : Kalium Diklofenak.. akan tetapi penghambatannya terhadap sintesa prostaglandin (siklo-oksigenase) dapat dikaitkan dengan aktivitas anti-inflamasi.. * nyeri dan inflamasi setelah operasi..INDONESIA Eflagen 25 CODE: C112 Harga Per Satuan Terkecil : Rp1...HARUS DENGAN RESEP DOKTER PT...25 mg/ 50 mg FARMAKOLOGI EFILAGEN mengandung Kalium Diklofenak yaitu suatu anti-inflamasi nonsteroidal CAINS........... Coronet Crown PHARMACEUTICAL INDUSTRIES SURABAYA .250. Secara farmakologi Diklofenak menunjukkan aktivitas anti-inflamasi.. - KONTRA-INDIKASI Hipersensitivitas terhadap Kalium Diklofenak. analgesik dan antipiretik..... seperti terkilir. INDIKASI EFLAGEN diindikasikan : Sebagai pengobatan jangka pendek untuk kondisi akut sebagai berikut: Sebagai adjuvant pada nyeri Inflamasi berat dari Infeksi telinga.... * nyeri Inflamasi setelah trauma. hidung atau tenggorokan... Seperti obat-obat AINS yang lain mekanisme kerja belum diketahui... ..

sakit kepala. trombositopenia. Hati: peningkatan enzim SGOT. telinga berdenging. palpitasi. Ginjal: gangguan fungsi ginjal. Saluran pencernaan: dispepsia.3 dosis terbagi. muntah. edema (Jarang). eritema multiformis. Kulit: urtikaria. leukopenia. SGPT dan hepatitis (Jarang). anemia. DOSIS Dewasa : dosis awal 100 -150 mg/hari dalam 2 . urtikarta atau rinitis akut yang ditimbulkan oleh asam asetil salisllat atau obat-obat lain yang menghambat sintesa prostaglandin. agra-nulositosis Darah: (sangat jarang).100 mg / hari. mual.- Tukak lambung. impoten. EFEK SAMPING Efek samping yang mungkin terjadi pada : nyeri lambung. anak-anak usia > 14 tahun: tidak boleh diberikan pada anak-anak usia Anak-anak : < 14 tahun. vertigo. eksim. Sistem saraf pusat: pusing. Pemberian bersamaan dengan diuretik hemat kalium dapat disertai dengan kenaikan kadar kalium dalam darah. Pemberian bersamaan dengan metotreksat dapat meningkatkan toksisitas metotreksat. Lain-lain: hipertensi. Pada kasus-kasus sedang dan untuk 75 . Reg. penderita dalam serangan asma. nyeri dada. Pemberian bersamaan dengan AINS sistemik dapat meningkatkan terjadinya efek samping. kram perut. Pemberian bersamaan dengan antikoagulan perinah dilaporkan dapat meningkatkan resiko perdarahan. INTERAKSI OBAT Pemberian bersamaan dengan litium atau digoksin dapat meningkatkan konsentrasi litium atau digosin dalam plasma.: Dus Isi 5 strip @ 10 tablet DKLV722222015A1 . diare. HARUS DENGAN RESEP DOKTER KEMASAN EFLAGEN 35: No.

EFLAGEN 50: No. Reg.: Dus isi 5 strip @ 10 tablet DKL9722222015B1 .