Demokrasi dan Partisipasi Publik

PendahuluanDewasa ini istilah demokrasi sering muncul di media massa Indonesia menjelang diadakannya pemilihan legilatif maupun kepala daerah (PILKADA). Tidak berbeda dengan pemilihan yang akan terjadi di lingkungan Rukun Tetangga (RT) 02 Rukun Warga (RW) 19 Dukuh Baturan Desa Trihanggo Gamping Sleman. Meskipun dalam skala dan lingkup yang kecil, tapi pesta demokrasi adalah hak dari warga negara untuk menentukan pimpinan di daerahnya yang dianggap layak dan mampu memegang amanat masyarakat. Secara terminologi, istilah demokrasi berasal dari bahasa Yunani kuno yang terdiri dari kata demos yang artinya adalah rakyat dan kratos/cratein yang berarti pemerintahan . Dalam bahasa Inggris, democracy artinya adalah pemerintahan yang berasal dari rakyat. Sehingga apabila makna dari kedua kata tersebut digabungkan maka demokrasi berarti pemerintahan rakyat. Sedangkan secara umum demokrasi didefinisikan sebagai pemerintahan yang berasal dari rakyat, oleh rakyat, dan untuk rakyat. Pemerintahan dari rakyat artinya adalah pemerintah yang memperoleh amanat merupakan anggota masyarakat yang dipilih dan kemudian diberi amanat oleh rakyat. Oleh rakyat artinya adalah pemerintahan yang dibentuk merupakan hasil dari kesepakatan bersama oleh rakyat sehingga daerahnya memiliki struktur pemerintahan sehingga menjadi teratur. Sedangkan untuk rakyat, memiliki arti bahwa pemerintahan yang dibentuk kemudian bekerja untuk mengabdi dan melayani rakyat tersebut sehingga masyarakat menjadi sejahtera. Inti DemokrasiKekuasaan tertinggi dalam demokrasi ada di tangan rakyat. Rakyat memiliki kedaulatan melalui suara yang digunakan dalam pemungutan suara dalam pemilihan umum. Dengan demikian suara rakyat menjadi penentu dalam pengambilan keputusan pada masyarakat tersebut. Pemilu memberikan kesempatan kepada rakyat

untuk memilih pemimpin yang dianggap paling layak dan mampu untuk mengemban amanat. Kemudian pemimpin yang terpilih akan memperoleh mandat dari rakyat untuk mengelola pemerintah melalui lembaga perwakilan rakyat. Lembaga perwakilan berasal dari anggota masyarakat yang bertugas untuk menjaga agar pelaksanaan pemerintahan tidak mengalami pemyimpangan. Lembaga perwakilan merupakan wadah bagi rakyat untuk menyalurkan aspirasi sehingga suara rakyat tersalurkan pada pemerintah. Rakyat juga bisa secara langsung memberikan masukan tidak hanya kepada lembaga perwakilan tetapi juga kepada pemerintah. Tindakan ini disebut dengan partisipasi publik (rakyat). Partisipasi adalah suatu proses dimana sejumlah pelaku bermitra punya pengaruh dan membagi wewenang di dalam prakarsa “pembangunan”, termasuk mengambil keputusan atas sumberdaya . Sedangkan Partisipasi publik secara sederhana diartikan sebagai keikutsertaan dan keterlibatan masyarakat dalam aktivitas kenegaraan. Wujud partisipasi publik bisa beragam, misalnya ikut pemilihan umum (pemilu), membayar pajak, menyampaikan aspirasi, keluhan, mengontrol pemerintah, dan lain-lain. Salah satu contoh nyata dari partisipasi publik adalah keikutsertaan dalam pemilihan umum (pemilu). Istilah lain dari pemilu adalah pesta demokrasi. Disebut demikian karena pemilu merupakan kegiatan besar menyerupai perayaan/pesta dimana rakyat berhak dan menjadi penentu dari perjalanan masyarakatnya. Pemilu pertama kali dilaksanakan pada jama Yunani Kuno untuk memilih anggota senat polis yang memberikan masukan kepada kaisar. Pada jaman tersebut pemilu dilaksanakan secara langsung dengan cara memilih calon anggota senat yang ada. Di samping itu, jumlah penduduk yang memiliki suara dalam suatu polis masih sedikit sehingga pemilihan bisa dilakukan secara langsung. Dewasa ini, jumlah rakyat di suatu negara sangatlah besar sehingga pemilihan secara langsung sering kali memakan waktu sehingga

Gubernur. yang bersangkutan sebenarnya sama saja dengan mendelegasikan hak untuk menjadi pemimpin dan mengelola daerahnya karena setiap individu memiliki hak yang sama. Pemilihan Presiden. Presiden. Rakyat memilih anggota lembaga perwakilan dan lembaga perwakilanlah yang memilih kepada negara tersebut. Demikian halnya dengan rencana pemilihan Ketua RT 02 ini. Bupati/Walikota. dan Kepala Desa dilakukan secara langsung. Bupati. Ketika seseorang memilih calon pemimpin. Walikota. Namun demikian hak tersebut tidak diserahkan hanya dipinjamkan dalam bentuk amanat dan rakyat bisa meminta kembali bahkan mencabut amanat/hak dipinjamkan kepada pemimpinnya apabila dianggap gagal atau melakukan penyimpangan. Namun hal ini mendapat banyak kritik karena lembaga perwakilan seringkali tidak mewakili aspirasi dari rakyatnya sehingga pemilihan langsung tetap digunakan untuk memilih pemimpin masyarakat. Rakyat memiliki kedaulatan melalui suaranya untuk memilih dan menentukan pemimpin yang paling dipercaya untuk mengemban amanat. DPRD. Amanat dan kekuasaan yang dimiliki oleh pemimpin adalah pemberian rakyat dan bersifat sementara dan bisa dicabut.dikenal pemilihan tidak langsung. Hal ini juga berlaku kepada calon Ketua RT yang akan dipilih. Mengingat setiap individu memiliki hak yang sama untuk memimpin. Kepemimpinan dalam MasyarakatPemimpin adalah individu yang bertugas sebagai kepala pemerintahan. Pemimpin adalah individu yang diberi amanat untuk menjalankan pemerintahan. DPR. Oleh karena itu seorang pemimpin harus bertanggung jawab kepada rakyatnya dan menjalankan tugasnya untuk melayani rakyat. dan kepala desa adalah pemimpin. Ketika memilih seorang pemimpin berarti merelakan hak tersebut dilakukan oleh orang lain. Kepala pemerintahan memiliki tugas untuk mengatur tatanan kehidupan masyarakat sehingga berjalan .

pemimpin haruslah memiliki visi yang baik sehingga masyarakat yang dipimpinnya memiliki tujuan. Pemimpin dalam hal ini harus mengakomodasi kepentingan rakyat banyak sehingga pemenuhan atas kebutuhan yang menjadi hajat hidup orang banyak harus didahulukan. Setiap individu dalam masyarakat memiliki kepentingan yang berbeda-beda. Masyarakat dengan sukarela telah menyerahkan haknya menjadi pemimpin untuk dipimpin oleh orang lain. Sumber daya tersebut harus dikelola dan dialokasikan secara tepat sehingga sasaran yang dituju mengena dan tidak terjadi pemborosan. Masyarakat juga harus mematuhi ketentuan pemerintah yang bertujuan untuk kemakmuran masyarakatnya sehingga resiko terjadi konflik dapat dikendalikan. Seorang pemimpin harus menjadi wakil masyarakatnya dalam berhubungan dengan masyarakat yang lain. Pemimpin harus memiliki pengetahun dan wawasan yang luas sehingga mampu mewakili masyarakatnya untuk berkomunikasi dengan pihak lain.dengan baik. . Pemenuhan kebutuhan membutuhkan sumber daya yang dimiliki oleh daerah tersebut. Perbedaan kepentingan memungkinkan terjadinya benturan antar anggota masyarakat dan berakibat pada timbulnya perselisihan. Komunikasi yang baik harus berjalan sehingga menciptakan kedamaian antar wilayah. Masyarakat juga harus secara aktif melakukan pengawasan terkait pemanfaatan sumber daya daerahnya karena kekayaan daerah pada hakikatnya adalah milik masyarakat dan dipungut dari masyarakat oleh pemerintah meskipun pengelolaan diserahkan pada pemerintahan setempat. tapi dibantu oleh perangkat organisasi lain. Keseluruhan tugas yang dimiliki oleh pemimpin adalah amanat dari masyarakatnya. Kekuasaan yang dimiliki merupakan tanggung jawab yang berasal dari masyarakat. Masyarakat dalam menjalankan kehidupannya juga berhubungan dan berdampingan dengan masyarakat lain. Meskipun tidak memimpin sendiri.

3) Partisipasif: melibatkan masyarakat dalam musyawarah. seorang pemimpin harus mempertanggungjawabkan tugasnya kembali kepada masyarakat.Oleh karena itu. Oleh karena itu diperlukan kriteria pemimpin yang ideal. Masyarakat berhak untuk memilih pemimpin sesuai dengan hati nurani yang dimiliki. Keterlibatan warga sangat . Dengan kriteria tersebut. Hati nurani yang baik seharusnya bisa mengantarkan pemilihan pada seorang pemimpin yang terbaik di mata masyarakat. Terdapat beberapa kriteria untuk memilih pemimpin ideal. dan 4) Akuntabel (bertanggung jawab): menjalankan kegiatan yang bermanfaat untuk masyarakat. Akuntabilitas adalah kewajiban untuk menyampaikan pertanggungjawaban atau untuk menjawab dan menerangkan kinerja dan tindakan seseorang/badan hukum/pimpinan kolektif suatu organisasi dalam penggunaan sumber daya yang ada. 2) Transparan (terpercaya): pengelolaan sumber daya bisa diketahui oleh masyarakat. yaitu: 1) Terbuka (jujur): bisa berkomunikasi dengan semua pihak. Dengan demikian masyarakat sebagai pihak yang memiliki sumber daya dan melimpahkannya pada pemimpin akan menilai keberhasilan pelaksanaan tugas yang diamanatkan. dan apa saja yang telah dicapai dengan penggunaan wewenang dan sumberdaya tersebut kepada pihak yang memiliki hak atau kewenangan untuk meminta keterangan atau pertanggungjawaban . Hal ini bertujuan agar tugas-tugas yang dibebankan pada seorang pemimpin bisa berjalan dan berhasil. Tugas masyarakat setelah seorang pemimpin berhasil dipilih adalah mematuhi dan menjalankan kebijakan serta peraturan yang dibuat untuk kepentingan masyarakat. Setiap warga juga wajib untuk melibatkan diri dalam berbagai kegiatan yang diselenggarakan oleh organisasi masyarakat di lingkungannya. calon pemimpin diharapkan bisa mengemban tugas yang akan diletakkan di pundaknya. Ini adalah wujud dari akuntabilitas pemimpin kepada warganya.

Oleh karena itu. dan untuk warga. setiap individu harus siap menjadi ketua apabila dipilih oleh warga yang lain. mematuhi. Dengan demikian semua orang yang menjadi warga di lingkungan tersebut memiliki hak yang sama. Hak tersebut adalah untuk memilih dan dipilih menjadi Ketua RT berdasarkan kriteria yang telah disepakati. Yang bersangkutan harus legawa dan siap menjalankan tugas. Ini adalah wujud dari tanggung jawab moral warga terhadap pemimpin yang dipilihnya. membantu. . dan mengawasi ketua baru demi RT 02 semakin maju di masa datang. oleh warga.penting dan tidak hanya pada pelaksanaannya tapi juga dalam perencanaan kegiatan. Dengan demikian kegiatan yang dilaksanakan benar-benar dibutuhkan dan mampu dirasakan manfaatnya secara luas. Sedangkan warga yang lain harus menerima. warga juga harus berpartisipasi secara aktif dalam melakukan pengawasan dan kontrol atas kegiatan yang diselenggarakan di wilayahnya. Selanjutnya. PenutupPemilihan Ketua RT 02 di Padukuhan Baturan merupakan kegiatan dari warga.

HUBUNGAN BIROKRASI DENGAN DEMOKRASI Dra. Cita-cita utama dari sistem birokrasi adalah mencapai efisiensi kerja yang seoptimal mungkin.usaha paling penting berupa implementasi Undang-Undang. Birokrasi diartikan :"kekuasaan. Ciri organisasi yang mengikuti sistem birokrasi ini ciri. ©2003 Digitized by USU digital library 11984 : 26. orientasi impersonal. menurutnya birokrasi merupakan tipe ideal bagi semua organisasi formal. birokrasi kadang-kadang digunakan dalam suatu hal yang diremehkan. karir yang panjang.982: 241).Si Jurusan Ilmu Adminisrasi Negara Fakultas Ilmu Sosial dan Ilmu Politik Universitas Sumatera Utara Berbicara tentang birokrasi sering kali kita asumsikan dengan urusan yang berbelitbelit. prosedur yang panjang dan memakan waktu yang lama. kekuasaan hirarkis.cirinya adalah pembagian kerja dan spesialisasi. pokoknya selalu mendapat “tanda” negatif dari pendengarnya. islam maupun non islam. dan membagi pelayanan kesejahteraan (Herbert M. Menurut Weber organisasi birokrasi dapat digunakan sebagai pendekatan efektif untuk mengontrol pekerjaan manusia sehingga sampai pada sasarannya. dan para administrator pemerintah yang tidak efisien (Herbert M. Hal ini akan menjadi lebih transparan apabila kita memantau birokrasi yang berhubungan atau berurusan dengan organisasi formal.Levine.” Birokrasi sebagai suatu sistem organisasi formal dimunculkan pertama sekali oleh Max Weber pada tahun 1947. M. Konsep Birokrasi Dalam kamus Akademi Perancis tahun 1798. Namun apakah sudah menjadi hal yang sulit direform bahwa birokrasi selalu menghambat kemudahan. Tulisan ini mencoba menjabarkan birokrasi berkaitan dengan demokrasi dan melihat posisi itu melalui Rekonstruksi. DARA AISYAH. Apalagi topik yang akan dikaji ada hubungannya dengan demokrasi sehingga memerlukan suatu pemikiran yang serius untuk menelaah dan menilai akibat-akibat yang terjadi dan yang ditimbulkan oleh aksi birokrat dalam konteks demokrasi yang perlu diperbaiki. peraturan ekonomi. karena organisasi birokrasi punya struktur yang jelas tentang kekuasaan clan orang yang punya kekuasaan mempunyai pengaruh sehingga dapat memberi perintah untuk mendistribusikan tugas kepada orang lain (Robert Denhard.Levine. negeri maupun swasta. kaku. 1982 : 240). diantaranya usaha. lisensi dalam perekonomian dan masalah-masalah profesional. Organissasi mengopcrasikan prinsip-prinsip dasar hirarki kantor dimana ada garis-garis yang jelas dari atasan dan bawahan. Sedangkan menurut kamus bahasa Jerman edisi 1813. tidak imaginatif. Masyarakat didominasi oleh para birokrat.pengaruh dan para kepala dan star biro pemerintahan. 1. Menurut Herbert M. birokrasi di definisikan sebagai:"wewenang atau kekuasaan dari berbagai departemen pemerintahan. a. ditulis oleh James Burnham tahun 1941 yang menekankan pentingnya kelompok manajerial di dalam perekonomian. 1989 : 100) Berdasarkan tulisan tersebut James memberi persamaan antara . Birokrasi memainkan peranan aktif di dalam proses politik di kebanyakan negara dan birokrasi menggunakan banyak aktifitas-aktifitas. dan efisiensi. persiapan proposal legislatif. dan tidak ada pemisahan yang tajam antara kelompok manajerial clan pejabat politik (Martin Albrow.Levine. boleh dikatakan artinya canggung.32). peraturan-peraturan. Pembahasan birokrasi selalu menarik untuk dibicarakan baik sebagai bahan diskusi maupun sebagai bahan kajian ilmiah untuk diperdebatkan dengan tujuan mencari solusinya. kemajuan dan perkembangan suatu sistem politik khususnya memperkecil ruang gerak demokrasi. Oleh karena itu lebih baik dijelaskan terlebih dahulu apa birokrasi dan demokrasi itu Bagaimana kontribusinya terhadap demokrasi Bagaimana posisi birokrasi dengan demokrasi melalui rekonstruksi bagaimana situasi problematik yang terjadi di Indonesia dan strategi seperti apa yang dapat diterapkan di Indonesia sehingga antara birokrasi dan demokrasi bisa direkonstruksi.

demokrasi magandung dua dimensi kontes dan partisipasi yang menurut Robert Dahl merupakan hal menentukan bagi demokrasi. Demokrasi berarti liberte.O'G Anderson yaitu prinsip ajaran demokrasi pandangan Jawa yang sangat mempengaruhi sistem politik dan proses demokratisasi Indonesia. Selama masih ada tipe-tipe pejabat negara dan seperangkat nilai yang dianggap sebagai bagian inheren dalam demokrasi yang sebenamya. fraternite. parapenguasaharusbertanggungjawabkepadaperwakilandarimasyarakat.masalah kebijaksanaan umum. dimana ada kontrol yang efektif. David Held menyatakan ada 7 prinsip utama penyelenggaraan negara berdasarkan demokrasi yaitu: 1. 1994: 3. berkumpul dan berorganisasi. para penguasa harus bertindak sesuai dengan kepentingan masyarakat. Arnerika Serikat tahun 1863 yaitu pemerintahan dari rakyat. definisi yang paling singkat tentang demokrasi adalah apa yang diucapkan oleh Abraham Lincoln di Gettysburg. Cara pandang tentang demokrasi dari waktu ke waktu mengalami perkembangan sejalan dengan semakin kompleksnya hubungan antar warga. Pensylvania. Demokrasi yang dapat menghambat nilai-nilai kultural menurut seorang Indonesianist Benedict R. Kata demokrasi berasal dari bahasa Yunani. 5. Kontribusi birokrasi dengan Demokrasi Kebanyakan orang menganggap bahwa konsep birokrasi sebagai administrasi yang tidak efisien dan rasional. Huntington. 1992 : 32). mencakup aplikasi kriteria evaluatif dan spesifikasi sifat . egalite. Masyarakat yang dibentuk dan diperintah oleh para birokrat akan menjadi masyarakat -masyarakat birokratis yang nantinya masyarakat tersebut akan menjadi birokrasi-birokrasi masyarakat yang patuh dan tunduk pada pengaruh sikap-sikap dan nilai-nilai para birokrat. ©2003 Digitized by USU digital library 2 2. 3. (prisma No. para penguasa berkewajiban untuk mempertanggungjawabkan tindakantindakannya kepada masyarakat . 1995 : 6).4 tahun XXI. Demokrasi juga mengimplikasikan adanya kebebasan sipil dan politik yaitu kebebasan berbicara. menerbitkan. oleh warga negara terhadap kebijakan pemerintah. parapenguasaharusdipiliholehmasyarakat. 6. memutuskan kebijaksanaan umum dan melaksanakan hukum dan administrasi pemerintahan. karena adanya perubahan sikap dari masyarakat akan bergantung kepada pengaruh para birokrat. ekonomi dan ideologi yang menjadi anutan. parapenguasadipilihmelaluirepresentatif/perwakilandarimasyarakatdan 7.4). b. rezim yang memerintah. yang dibutuhkan bagi perdebatan politik dan pelaksanaan kampanye-kampanye pemilihan itu (Samuel P. maka masalah birokrasi dan demokrasi tidak akan pernah berhenti. maupun nilai masyarakatnya sendiri dalam memaksimalkan upaya yang ada menuju iklim demokratisasi yang diidam-idamkan. khususnya dalam cara pandang terhadap pembangunan politik. maka untuk kasus negara berkembang seperti Indonesia demokrasi yang muncul sangat bergantung kepada perilaku elit politik dan struktur budaya.kekuasaan kelas para manajer dengan kelas para birokrasi negara. masyarakat secara perseorangan harus terlibat dalam pembuatan keputusan yang penting dalam arti memutuskan hukum-hukum publik dan masalah. Basis kultural dalam pemerintahan Orde Baru di Indonesia itu dapat dilihat dari bagaimana hubungan antara elit politik dengan warga negara sebagai hubungan antara kawulo dan gusti. c. Konsep Demokrasi Pada tulisan ini perhatian kita tertuju pada masalah birokrasi dan hubungannya dengan demokrasi. antara kekuasaan di kalangan "wong ghede dan wong cilik”. 4. Usaha demokratisasi masih memerlukan rentang waktu yang cukup panjang bagi lembaga-lembaga politik. untuk rakyat Esensi dari demokrasi adalah bahwa rakyat memerintah atau melakukan pemerintahan oleh dirinya (government by the people) (majalah Koridor. Kalau kita amati model demokrasi David Held diatas. Hal ini akan cepat menjerat masyarakat akan runtuhya nilai-nilai demokrasi sehingga ada suatu pertentangan dengan nilainilai tersebut yang dianggap sebagai suatu problema yang memerlukan pemecahan. oleh rakyat. masyarakat harus memerintah dalam arti semua harus terlibat dalam membuat undang-undang. menurut bahasa Yunani.

Northcote Parkinson Ketiga. Posisi infrastruktur politlk vis-a-vis suprastruktur politik secara relatif lebih kuat.1989 : 1 07). yang dapat mendistribusikan secara merata hasil dari perjuangan masyarakat tersebut. yaitu suatu proses dimana suatu biroksasisemakin mendekati tipe ideal sebagaimana dikemukakan oleh Max Weber. pejabatbenar-benarmernilikikekuasaandantugasyangsemakinbesarsehingga jabatan tersebut harus dijalankan secara bijaksana . Menurut analisa Dr. masa diluar birokrasi secara politis dan ekonomis pasif. partai politik. karena mereka percaya bahwa bukan kekuasaan yang dijalankan pejabat yang menimbulkan masalah tetap cara menggunakan kekuasaan itulah yang menjadi masalahnya.Jackson (1978) dalam konteks Indonesia. yaitu kecendrungan birokrasi semakin menguasai masyarakat. Friedrich dan Finer prihatin terhadap masalah kesesuaian praktek-praktek administrasi negara modem dengan nilai-nilai demokrasi. yaitu pertama proses weberisasi. 2.Muhadjir Darwin yang menyimpulkan bahwa birokrasi di Indonesia sedang “sakit” dengan titik tekanannya berdasarkan hukum Parkinson.terutama pembangunan yang mampu mengantisipasi dan menahan gejolak-gejolak eksternal sehingga bisa mencapai tingkat pertumbuhan yang memadai. Ada tiga kecendrungan yang dialami oleh setiap birokrasi. proses orwelisasi.28 ). 2. Menurut teori. di Indonesia terlebih dahulu didekatkan melalui 2 konsep yaitu : 1. menciptakan suatu sosok sistem politik bureau-nomia (Moeljarto Tjokrowinoto. konsep ini diamati secara serius karena mendiskusikan tentang pejabat-pejabat negara yang menjalankan tujuan-tujuan demokrasi. sedangkan parameter birokrasi “ sehat “ yang dijadikan sandaran adalah konsep birokrasi weber . apalagi konsep birokrasi sebagai kekuasaan yang dijalankan oleh pejabat. sehingga menyebabkan lemahnya peranan partai politik dan dampaknya semakin memperkuat peranan birokrasi. 1996: 159). 3. konsep masyarakat politik birokratik yang dikembangkan pertama sekali oleh Fred Riggs (1966) dan digunakan oleh Karl D. Berdasarkan konsep Jackson tersebut maka ciri-ciri pokok masyarakat politik birokratik adalah : 1. untuk itu perlu dilihat bagaimana masing-masing karakteristik antara birokrasi dan demokrasi digunakan dalam usaha mendiagnosis dan menyembuhkan masalah yang terjadi. untuk birokrasi di Indonesia agaknya cendrung ke arah parkinsonisasi dan orwelisasi ketimbang ke arah weberisasi. proses parkinsonisasi yaitu proses dimana birokrasi cendrung menuju kedalam keadaan patologis sebagaimana pernah diduga kuat oleh C. sehingga perlu dipertanyakan kemampuan masyarakat politik birokratik ini untuk melaksanakan pembangunan . pejabat menuntut kekuasaan terlalu besar dan perlu dikembalikan pada fungsinya semula. seperti parlamenter. Bertitik tolak dari ciri-ciri tersebut maka dapat kita simpulkan bahwa birokrasi di Indonesia cendrung mendekati ke tiga ciri tersebut. terwujud konfirmasi. Perlu dipertanyakan apakah tindakan tergantung pada bagaimana nilainilai demokrasl Itu ditafsirkan dan mana diantara penafsiran itu yang dipandang salah. Dalam sistem politik demokrasi liberal yang berawal dari Maklumat Wakil Presiden No. januari-april 1995 : 27.Kedua. lembagapolitikyangdominanadalahaparatbirokrasi 2. 3. konsepkapitalismebirokratikyangdirumuskanolehWittfogel(1957). dan kelompok kepentingan semuanya lemah dan tidak mampu melakukan kontrol terhadap birokrasi. lembaga–lembaga politik lainnya. kekuaasaan perlu bagi para pejabat sehingga harus dicari metode-metode pelayanan yang dapat disalurkan bersama-sama.(Muhadjir Effendy.nilai-nilai tersebut (Martin Albrow. Konsep birokrasi cendrung dianggap sebagai suatu aspek ancaman terhadap demokrasi. dimana politik yang ikut menentukan sosok administrasi pemerintah pada waktu itu. agar dapat memahami birokratisasi dalam pembangunan nasional. ©2003 Digitized by USU digital library 3 Problema yang harus dipecahkan untuk dapat menumbuh kembangkan demokrasi dengan menempatkan birokrasi secara konsisten di dalam sistem politik. dalam jurnal Bestari.X tertanggal 3 November 1945. yaitu 1. Martin Albrow membedakan tiga posisi dasar tentang fungsi-fungsi pejabat di negara demokrasi.

Kepatuhan tanpa syarat pada hakikatnya menghindari kritik dan ketidaksepakatan yang menjadi inti demokrasi (Peter M. karena belum tentu yang dilakukan birokrat baik.1987: 202. untuk dapat berfungsi. sehingga sulit untuk mencapai tahap masyarakat yang "marginal detterence". ©2003 Digitized by USU digital library 4 d. Jika birokrasi berlebihan maka masyarakat dirugikan karena masyarakat punya otonomi yang terbatas. yaitu pemberian tanggungjawab pada negara untuk melakukan sesuatu pada masyarakat. kalau mentalnya masih mental pencuri. Bila kita lihat contoh di Indonesia. baik juga untuk rnasyarakat. 3. Hal ini kemudian dicetuskan dalam bentuk protes yang mengacaukan suasana. dan sulit menciptakan masyarakat yang sadar pajak dalam sistem yang diterapkan untuk meningkatkan penerimaan negara. Demokrasi dan birokrasi sesungguhnya sangat diperlukan dalam proses pembangunan suatu negara .. tentu saja birokrasi dapat memerintah masyarakat tanpa Menimbulkan perlawanan mereka Namun sebagaimana kita juga pemah belajar dari masa lampau. Marshall. inilah yang disebut antitesis demokrasi..Meyer . yakni dengan memantapkan organisasi-organisasi sifatnya yang lebih birokratis daripada berupa pengaturan secara demokratis.Dampak Kekuasaan Birokrasi Terhadap Kondisi Demokrasi kekuasaan birokrasi menimbulkan pertanyaan yang menyebabkan para ilmuan mulai berpikir. Nilai-nilai demokratis tidak saja berarti tujuan-tujuan masyarakat yang ditentukan oleh keputusan mayoritas. Dalam jangka pendek. kerelaan yang pertama-tama bersifat pasif pada akhimya membangkitkan rasa ketidakberdayaan. sehingga ada kesan terpaksa untuk memenuhi kewajiban perpajakan. dengan demikian keadaan menjadi sulit bila masyarakat cendrung tidak mematuhi hukum. Apabila kita menunggu sampai suasana itu benar-benar terjadi. yang meminta negara untuk menyelesaikannya dan meminta negara melayani hal tersebut sebagai contoh yaitu negara yang demokratis. Pada dasamya masyarakat lebih menginginkan terciptanya kesadaran daripada kepatuhan. dorongan yang bersifat sosial.nilai demokrasi.Blau. karena freewill terbatas untuk masyarakat. tetapi juga bahwa tujuan-tujuan tadi diterapkan melalui metode-metode efektif yang ada. akan tetapi semakin kuat birokrasi dalam negara maka akan semakin rendah demokrasi dan sebaliknya semakin lemah birokrasi maka akan semakin tinggi demokrasi. Bila pemerintah harus memaksa kepatuhan yang sepenuhnya. hal ini berarti mengurangi demokrasi. Ibarat seorang pencuri bertobat untuk tidak akan mengulangi perbuatannya karena dia takut kepada Allah (sadar bahwa mencuri itu perbuatan dosa). bahwa masyarakat wajib pajaknya sudah lelah dengan seabrek peraturan yang harus dipatuhi.ciri organisasi yang diharapkan terlalu ideal sehingga kadang kala belum tentu cocok dengan kondisi atau situasi di suatu negara. Gejala tumbuhnya birokrasi yang terlarnpau kuat diungkapkan oleh Fred W Rigg ketika ia rnelakukan penelitiam modernisasi di Thailand yang kemudian muncul . doronganekonomi. yaitu : tuntutan dari rnasyarakat sehingga membuat birokrasi menjadi lebih besar peranannya. karena ciri.tetapi pada kenyataanya selalu menimbulkan masalah. Keberadaan birokrasi-birokrasi semacam itu tidak merusak nilai.203). adanya tuntutan negara semakin berkembang terus. Birokrasi sulit untuk direm karena ada dorongan dari dalam (birokrat itu sendiri) ataupun dari luar seperti : 1. setidak-tidaknya masyarakat harus memberikan pengertiannya karena pada kenyataannya jumlah polisi tidak cukup banyak di dalam melakukan kontrol atas penerapan hukum. 2. ada pandangan bahwa negara ©2003 Digitized by USU digital library 5 sebagai penggerak pembanggunanan nasional dan negara diasumsikan sebagai fungsi yang strategis. Sedikit kepatuhan sudah merupakan suatu kondisi bagi demokrasi. Adil dan perlakuan yang sama bagi seluruh penduduk ternyata membutuhkan seperangkat hukum yang kompleks da peraturan-peraturan administratif.. dorongan politik. dan W. daripada takut karena adanya ganjaran hukuman yang menantinya.

akan tetapi hubungan antara tujuan dan kebijakan-kebijakan utama tidak selalu jelas. Berdasarkan studi Guelermo O'Donnel bahwa negara telah muncul sebagai kekuatan politik yang tidak hanya relatif mandiri berhadapan dengan faksi-faksi elit pendukungnya serta masyaraklu sipil. Sementara demokrasi merupakan keinginan dari sebagian besar rnasyarakat untuk rnendapatkan keberdayaan sehingga proses tawar menawar antara state dan sipil society dapat berkembang dengan baik khususnya dalam kerangka pengembalian keputusan politik sebagaimana prinsip-prinsip dasar dari demokrasi itu sendiri. dalam konsep yang sama Karl D.jackson. menurut model ini hasil pembuatan keputusan secara kebetulan dipengaruhi 4 komponen yaitu : para partisipan. Otoritarian Birokratik memang diciptakan untuk melakukan pengawasan yang kuat terhadap masyarakat sipil.8. contohnya : kebijakan pengentasan kemiskinan. namun menjalar sampai kepada kegiatan ekonomi sosial budaya termasuk juga ideologi. 1990 : 82) . maka model O'Donnell birokrasi itu tidak hanya berkolaborasi dengan kekuasan tetapi juga melibatkan diri hampir di semua bidang kegiatan. ©2003 Digitized by USU digital library 6 Modal kebijakan merupakan pendekatan yang akan dipakai dalam merekonstruksi birokrasi dan demokrasi. 3. tetapi turut melakukan kebijakan berupa tindakan membela si miskin sebagai suatu pertanda merekonstruksi demokrasi. tetapi ia telah menjadi kekuatan dominan yang marnpu mengatasi keduanya. terutama dalam upaya mencegah massa rakyat di bawah keterlibatan politik yang terlampau aktif agar proses akselerasi industrialisasi tidak tergangggu (Guelermo O'Donnel dalam Muhammad AS Hikam. Jurnal IImu Politik No. Keterlibatan negara tidak hanya dalam bidang poitik formal. 2. apa yang menjadi tantangan masa depan. Birokrasi merupakan salah satu sarana bagi kekuasaan negara untuk memperkuat posisi politik dan merupakan sumber legitirnasi politiknya. apa perlu kebijakan direvisi atau direform. Allison mendeskripsikan 4 model kebijakan yaitu : 1. AIPI LIPI Jakarta 1991: 68). Model Garbage Can.dengan konsep "Bureaucratic Polity" yang menggambarkan betapa birokrasi di Thailand telah memasuki suatu jaringan kehidupan politik dan ekonomi yang sangat kuat yang dilakukan oleh negara terhadap kehidupan masyarakat. Pendekatan ini sering juga disebut organisasi anarki. merupakan kebijakan yang mencari tujuan yang pasti. adanya kesadaran para aktor dalam birokrasi sehingga mengambil nilai tertentu yang siap dimaksimalkan pemerintah. Thompson. B.Jackson untuk studinya tentang birokrasi di Indonesia. merupakan kebijakan yang dimulai dengan melihat kebijakan yang ada. dalam Karl D. masalah-masalah dan kesempatan untuk memilih (Charles . merupakan model yang ideal dengan melihat proses kebijakan sebagai suatu proses yang sangat rasional dimana policy maker atau aktor-aktor yang terlibat dalam proses kebijakan dianggap memiliki persepsi yang jelas tentang tujuan yang akan dicapai (Charles H Levine. hat ini menandakan bahwa birokrasi bukan pemerintahan rakyat tetapi mengembalikan peran negara sebagai arbiter (perantara). berkolaborasi dengan kekuasaan pemerintah. akan tetapi keduanya justru menunjukkan tingkat perbedaan yang mendasar dan kalaupun memungkinkan dapat dipertemukan satu sama lain melalui rekonstruksi antara keduanya. Frank J. Synoptic Model. 1987:4).Para aktor politik bisa menilai konsekuensi-konsekuensi positif dan negatif. Birokrasi dan Demokrasi melalui penjelasan tersebut ibarat dua sisi dari mata uang yang sama. birokrasi dan demokrasi sangat diperlukan dalam kegiatan negara dan masyarakat. e.Guy Peters.Pye. Studi Fred W Rigg tentang Bureaucratic Polity dan GuelermO'Donnel tentang Bureaucratic Authoritarian nampaknya menggarisbawahi bahwa dalam masyarakat tertentu posisi birokrasi sudah berada di bawah kontrol politik kekuasaan dalam rangka mendapatkan sumber legitimasi politik melalui sarana birokrasi. Proses kebijakannnya sering kali tidak dimulai dari titik nol karena selalu dimulai dengan kebijakan yang ada sehingga standard operating procedurenya terlalu kuat.Jackson dan Lucian W. Model Incremental. solusi. Jika dalam studi Rigg birokrasi. Dalam hal ini birokrasi tidak hanya penerima kebijakan dari pejabat-pejabat politik.Rekonstruksi Birokrasi dan Demokrasi Melalui Beberapa Pendekatan. yang menempatkan birokrasi melalui pemasukan nilai budaya masyarakat yang dominan sebagai suatu kekuatan tersendiri dalam mempengaruhi sistem politik dan perilaku politik elit kekuasaan (Karl D.

Model Birokratik Politik. J. jika kita mengacu ke negeri sendiri yaitu Indonesia. Menteri Emil Salim berhasil mengadakan reformasi pada organisasi dan tala kerja departemen. para birokrat agak alergi karena daya inovasi kaum birokrat dipengaruhi oleh advokasi dari para pimpinan politik yang harus diyakini melalui reformasi tersebut. dalam orasi ilmiah yang disampaikan pada kuliah perdana program MAP UNT AG.(Charles H. dan Menteri Saleh Affif mengadakan reformasi untuk menggairahkan kegiatan ekonorni melalui serangkaian kebijakan deregulasi. aliansi yang kuat antara birokrasi dan organisasi politik. Pada waktu yang lalu. maka ada kecendrungan kita memakai model Incremental. punya agenda masing-masing. 2. Namun. yang menimbulkan dorongan yang kuat pada birokrasi yang cendrung lebih mempertahankan status-Quo daripada reformasi. belum nampak adanya minat yang cukup besar dikalangan para pimpinan organisasi politik mengenai reformasi administrasi. Strategi Birokrasi yang Diterapkan Di Indonesia melalui Contoh kasus Reformasi Perpajakan. karena hidupnya dari gaji yang diperoleh dari pajak rakyat dan bukan malah menjadi alat untuk menekan rakyat. . memperjungkan atau membangun strategi-strategi sendiri dengan koalisi.84) 4. Problema birokrasi yang melanda negara Indonesia dengan adanya pelaksanaan peraturan dan juga yang semakin banyak.B. Sepertinya mendengar kata reformasi.1990: 84). seperti yang dilakukan oleh Emil Salim. telah menimbulkan politisasi birokrasi yang berlebihan. reformasi tersebut belum mampu menciptakan suatu snow ball reformasi administrasi yang terus sustainable dan akhirnya mampu menciptakan sistem adrninistrasi yang handal dan dapat bargaining mendukung pembangunan ekonomi politik (Sofian Effendi. Berdasarkan beberapa model yang ditawarkan. Kurang berhasilnya reformasi administrasi di Indonesia selama kurun waktu PJPT-1 ini nampaknya dipengaruhi paling tidak oleh 2 faktor : 1. Reformasi tersebut dapat dilaksanakan walaupun pada kurun waktu tersebut birokrasi Indonesia secara umum masih konservatif dan belum terbuka terhadap perubahan. Reformasi administrasi perlu dilancarkan sebagai bagian dari pembangunan politik. beberapa teknokrat dalam birokrasi mencoba mengadakan upaya-upaya reformasi . terutama melalui pengaruh jalur-jalur A dan B di Golkar. Pembuatan keputusan-keputusan poitik nasional amat didominasi oleh pemerintah dan kesan seperti itu sukar dibantah. Padahal seharusnya birokrasi bekerja untuk rakyat. g. Posisi saling berhadapan antara birokrasi yang mewakili lembaga negara dengan civil society yang berada pada posisi masyarakat. Bila aparatur administrasi mampu mendukung pembangunan nasional. liberalisasi dan industrialisasi ekonomi Indonesia. 1994 :3).Levine. Situasi Problematis yang teriadi di Indonesia. ©2003 Digitized by USU digital library 7 Sumarlin dan Saleh Affif ketika beliau-beliau tersebut menjadi Menteri Penertiban Aparatur Negara pada Kabinet Pembangunan I.Guy Peters. maka dapat tercipta sistem tersebut sehingga mampu mendukung demokratisasi politik. f. merupakan bagian yang tidak dapat terpisahkan dari upaya mencari wilayah dinamika dari studi pembangunan politik yang akan meningkatkan kehidupan politik ideal yang demokratis.H.evine. Thompson. kurang mampu mendorong empowering masyarakat karena birokrasi melihat masyarakat dari kaca mata bagaimana masyarakat melaksanakan peraturan dan bukan melihat bagaimana inisiatif masyarakat itu sendiri sehingga ada kesan pemaksaan yang dapat menimbulkan benih-benih konflik yang mengakibatkan rakyat sebagai lawan dari birokrasi. Menteri Sumarlin mengadakan reformasi pada sistem remunerasi pegawai negeri. bergaining atau kompromi sesuai dengan tujuan yang ia miliki.B Guy Peters.Thompson.II dan III.Frank J. dimana terlalu banyak prosedur dan standard operating procedure terlalu dinomorsatukan atau dijadikan sebagai salah satu instrumen yang digunakan oleh pemerintah pusat. sehingga reformasi administrasi tidak pernah menjadi fokus perhatian tetapi hanya sebagai pendukung pembangunan ekonomi .Frank J. kuatnya dominasi ekonomi perencanaan pembangunan nasional. 1990 :83. merupakan proses pengambilan keputusan dalam melibatkan banyak aktor/kelompok-kelompok kepcntingan yang masing-masing punya nilai atau kepentingan sendiri.

dibentuk Komite atau Panitia Pengarah dengan mengikutsertakan beberapa pejabat dari jajaran Departemen Keuangan. bernegara dan berpemerintahan. peraturan-peraturan pajak yang beraneka ragam. Ketiga unsur tersebut adalah kebijaksanaan. Pada dasarnya pemungutan pajak rnerupakan perwujudan atas kewajiban kenegaraan dan partisipasi anggota masyarakat dalam memenuhi keperluan pengelolaan negara dan pembangunan nasional. Kebijaksanaan perpajakan merupakan pemilihan unsurunsur tertentu dari berbagai alternatif yang didasarkan atas sasaran yang ingin dicapai. para menteri bidang Ekonomi Keuangan dan lndustri (EKUIN) serta beberapa anggota lembaga perekonomian mempertimbangkan bahwa rencana pembaruan perpajakan di Indonesia dengan menggunakan batasan tahunan dan bukan bulanan. hanya saja situasi dan kondisinya belum memungkinkan.Keempat. Pada sistem lama.. termasuk beberapa ©2003 Digitized by USU digital library 9 diantaranya dari jajaran Direktorat Jenderal Pajak. Keenam. maupun karena menyusun sistem yang barn tidaklah mudah. tampaklah bahwa sesungguhnya pada masa lalupun telah ada upaya-upaya untuk mengadakan pembaruan sistem perpajakan. dimana yang bertindak sebagai pelaku administrasi pajak di Indonesia adalah Direktorat Jendral Pajak. Sedangkan administarsi perpajakan adalah cara. Langkah kedua. Ketiga. terdapat bermacam-macam tarif pajak baik untuk perorangan maupun untuk perseroan.. tarif pajak dan prosedur pajak.cara dan prosedur pengenaan serta pemungutan pajak. Dari keenam kelemahan yang terjadi pada sistem yang lama. obyek pajak. menuangkan kebijakan perpajakan ke dalam suatu konsep dalam bentuk perundang-undangan yang ketat.pokok dan hasil dari misi-misi pembaruan perpajakan di beberapa negara.Hal yang kedua. Pada awal tahun 1981. baik karena kemungkinan mendapat tantangan dan antipati dari rakyat yang memang telah lama mengalami trauma dan sindrome pajak pada masa penjajahan. demi tercapainya keadilan sosial dan kemakmuran yang merata.Kedua pelaksanaan kewajiban perpajakan sangat tergantung pada aparat perpajakan. Direktorat jendral Bea dan Cukai serta Direktorat Jendral Moneter. sehingga menimbulkan kesan membingungkan dan bahkan terdapat pembebanan pajak berganda. Pemilihan unsur-unsur tersebut berkenaan dengan subyek pajak. Langkah ketiga. Kelima. yang dalam banyak hal. sehingga menimbulkan kecendrungan masyarakat wajib pajak kurang turut bertanggung jawab dalam memikul beban negara yang pada hakikatnya untuk kepentingannya sendiri dalarn bermasyarakat. adalah hukum pajak atau hukum fiskal yaitu keseluruhan peraturan yang meliputi wewenang pemerintah untuk mengambil kekayaan seseorang dan menyerahkannya kembali kepada masyarakat melalui Kas Negara.. keputusankeputusan tersebut menggambarkan pemanfaatan hasil-hasil kegiatan yang sejenis di negara-negara lain. tatacara pemungutan pajak yang berbelit-belit. sasaran perpajakan semata-mata untuk pemerintah penjajah Belanda dengan berkedok pengisian kas negara tetapi nyata-nyata digunakan untuk kepentingan kolonial.Keputusan itu dikelompokkan dalam 8 langkah kebijakan sebagai berikut : Langkah pertama. Dalam rangka memecahkan problematik yang terjadi pada waktu itu. tingginya tariftarif tersebut sehingga menimbulkan rangsangan untuk menghindari pajak mela1ui berbagai cara. hukum perpajakan dan administrasi perpajakan.Melalui tulisan ini ada strategi positif yang dapat memperbaiki kelemahan birokrasi menuju demokrasi di Indonesia dengan mengambil contoh yang pemah terjadi di Indonesia yaitu Pelaksanaan Reformasi Perpajakan. maka dalam menyusun sistem yang baru. maka para pemikir ekonomi Indonesia pada tahun 1980-1981 sudah mengenal pokok. terdapat berbagai jenis pajak sehingga menimbulkan ketidakjelasan bagi masyarakat dalam memenuhi kewajibannya. Komisi tersebut berfungsi . Dari paparan di muka . diarnbil Beberapa keputusan tingkat menteri dalam hal strategi dan teknik untuk pembaharuan perpajakan Indonesia. Sebagai bahan kajian bahwa dalam perundang-undangan pajak lama terdapat beberapa permasalahan dan sekaligus kelemahan yang perlu disoroti yaitu: ©2003 Digitized by USU digital library 8 Pertama. diperhatikan saling keterkaitan antara tiga unsur pokok pemungutan pajak.

menyiapkan latihan dan pendidikan bagi para pejabat perpajakan. baik dari luar maupun dalam negeri untuk memberikan pengalamannya sekaligus menguji konsep pembaruan sistem perpajakan di Indonesia. Setelah sampai rancangan tersebut ke DPR. memperluas wawasan pembaharuan sistem perpajakan sehingga mencaku bidang-bidang yang sebelumnya tidak merupakan obyek pajak. mengenai mana yang benar dan mana yang salah.44. . mengharuskan agar usaha persiapan ini dilakukan secara biasa saja tanpa publikasi besar-besaran . Meskipun seringkali didengungkan masalah kebersamaan dan demokrasi di dalam organisasi Direktorat Jendral Pajak tapi kenyataannya kekuasaan lebih ditentukan oleh landasan rasional sehingga masalah organisasi harus didahulukan daripada masalah pribadi. mengawasi dan berperanserta langsung dalam penelitian yang dilakukan oleh tim tenaga ahli asing yang mungkin akan digunakan. juga membuat kebijakan dan mengimplementasikannya berat sebelah (LV . sehingga diharapkan timbul kesadaran. Langkah keempat. Ambisi utama daripada sistem birokrasi adalah tercapainya efisiensi kerja yang seoptimal mungkin tapi bukan malah mempolitisikan birokrasi dengan pilihan.(Salamun A. secara jujur harus diakui bahwa sebagian besar menekankan pentingnya mental aparatur pajak mendapat perhatian pemerintah. T. telah terbukti bahwa usaha birokrasi untuk merekonstruksi demokrasi tidak bisa lepas dari politik publik. di samping tenaga ahli ekonomi dan hukum. Dari para anggota DPR yang pada umumnya dikenal sebagai tokoh-tokoh masyarakat yang vokal. pengertian dan pemahaman yang tulus. Dari banyak tanggapan spontan yang muncul pada hari-hari paertama pengajuan RUU ke DPR.Bautista dkk. baik kalangan pemerintahan. kebijaksanaan untuk memulai sistem perpajakanan yang baru secara keseluruhan tanpa sedikitpun mengambil bagian-bagian dari sistem yang lama.. sehingga kekuasaan kepemimpinan politik mampu membuat birokrasi bertanggung jawab terutama alas dasar kepentingan publik. menerapkan langsung hasil dari tiap-formulasi tanpa menunggu laporan hasil keseluruhan paketnya.Carino. dan ilmu teknologi komputer dalam pekerjaan studi pembaruan sistem perpajakan di Indonesia.pilihan kebijakan yang memuaskan klien-klien tertentu. dimana kekuatan-kekuatan sosial dan negara mengarahkan birokrasi kesana. Dalam rangka pengkajian masalah pembaruan sistem perpajakan di Indonesia. Seperti telah dijelaskan. Langkah kedelapan.45). Langkah ketujuh. korupsi. selama proses pembahasan di DPR banyak pihak dari berbagai disiplin ilmu. kalangan masyarakat dan berbagai sudut pandang yang memberikan tanggapan. baik itu pendidikan formal maupun pendidikan informal untuk memulai kaderisasi pejabat pajak yang terlatih baik. 1990 :43. swasta maupun para ilmuwan dari berbagai disiplin ilmu. Berdasarkan pengalaman sejarah.mengarahkan. Langkah keenam. sehingga mampu mendorong birokrasi untuk meningkatkan responsivitas mereka terhadap keinginan rakyat . Diperlukan juga tenaga-tenaga ahli dalam bidang-bidang lain seperti ahli administrasi perpajakan akuntan. namun tetap rnemperhatikan berbagai pendapat dari kelompok-kelompok yang ada dalam masyarakat. saran dan juga kritik tajam. disamping tim pengarah ada lagi tim yang dibentuk oleh Departemen Keuangan. Keikutsertaan para ahli tersebut baik akademisi maupun para profesional dan pejabat yang berwenang di dalam negeri dimaksudkan untuk memperoleh proses dan pemecahan masalah dalam pengerjaannya. melibatkan ©2003 Digitized by USU digital library 10 kepentingan pribadi di atas kesejahteraan umum. Responsive terhadap tuntutan rakyat. ini tidak akan jadi persoalan bila birokrasi tetap dipandang sebagai instrumen negara. Langkah kelima. Direktorat Jendral Pajak dan Tim dari Luar Departemen Keuangan. 1993 : 119 -140). telah diundang tenaga ahli dan tokoh-tokoh terkemuka yang sangat berpengalaman dan bereputasi Intemasional dalam bidang perpajakan. mana yang haq dan mana yang bathil.

tekanan kekuasaan dan dinamika dibangun sistematis di dalam menjalankan. Pada konteks organisasi public. Disini demokrasi dikesampingkan. Dilema yang muncul adalah birokrasi harus professional dan responsive tapi.ORMASI ADMINISTRASI DAN PARADOKS DEMOKRASI Ini menjelaskan tentang perselingkuhan antara birokrasi dengan elit politik yang semakin inten. Kebijakan yang dirumuskan dianggap sah dan demokratis. eksekutif melalui birokrasinya terbawa tuntutan reformasi administrasi melalui paradigma pasar. Birokrasi sebenarnya tidak akan bisa netral. Melalui institusi Presiden dan Wakil Presiden dengan Wakil Rakyat. telah dimanfaatkan oleh kepentingan politik ditengah arus demokratisasi. hanya karena adanya keberadaan symbol institusi dari demokrasi. Dua hal penting model bureaucratic polity eksis: . DPR. sepert terwujudnya good governance. Ini dilakukan untuk menghindari kegagalan implementasi dan kritik keras terhadap birokrasi. Dugaan bahwa dinamika komplek terpotret melalui bargaining dalam sector public yang memungkunkan terjadi manipulasi dalam pengelolaan sector public. karena reformasi administrasi sering direduksi pada tatanan tehnis. pada sisi lain otonominya sebenarnya sedang ditekan oleh politisi melalui paradigma baru. Di sisi berhadapan birokrat begitu kuat menjaga motif nilai manajer departemen. Reformasi politik. yakni DPR. Birokrasi dan jebakan politik Orde baru melalui bureaucratic polity.

tiga komponen dinamika politik terkait dengan birokrasi menggejala: komponen political competition. komponen actor. 2. Pada sisi yang lain. Proses politik pada tingkat ini bisa sangat kompleks. Birokrasi sebagai komponen dari suatu pemerintah dari pusat sampai dengan daerah politik. Pertautan keduanya terjalin dengan bungkus rapi dibalik mekanisme demokrasi. Struktur dikotomi dilihat dari sisi struktur formal. Decision making benarbenar diperankan oleh arena inti proses kompetisi politik yang dibangun diluar birokrasi sesungguhnya. Justru tulisan ini akan menjelaskan adanya kedekatan elit politik dengan birokrasi. 1. . Actor inilah komponen yang pertama. Sehingga yang tersisa di mata rakyat hanyalah kekuasaan dari birokrasi. para pejabat yang memiliki kewenangan formal. Dinamika interaksi politik dengan birokrasi pada pemerintahan hasil pemilihan secara lansung. Tulisan ini tidak menjelaskan jarak antara birokrasi dengan elit politik dalam dinamika administrasi publik di Indonesia. bureaucratic polity tidad jauh beda dari bentuk pemerintahan olek derajat untuk decision making nasional daerah kekuatan sosial dan politik keluar pejabat tidak tinggi bagi modal kota. demokratisasi yang diusung dan diyakini akan membawa perubahan yang besar di Indonesia justru telah memanipulasi sektor publik melalui instrumen reformai administrasi yang sedang populer. namun bersifat informal di sekitar presiden. 2. Setiap kebijakan yang dirumuskan dianggap sah dan demokratis oleh DPR yang dianggap simbol institusi dan demokrasi. Birokrasi yang selalu dituntut responsif sesungguhnya sedang mengalami tekanan elit politik. Daripada kekuatan penuh dicapai meluli kompetisi interpersonal di lingkaran elite di fisik yang tertutup dekat presiden.1.tanpa memperdulikan rakyat yang akan terkena dampak langsung. daerah utama untuk kompetisi politik tidak di negara yang besar dan kekuatan tidak dicapai terus memperbaiki bagi banyak gerakan. Adanya dikotomi administrasi dan politik dijelaskan dengan konteks yang spesifik. Birokrasi melalui aparat negara begitu kuat menjaga nilai manajer yang diinternalisasikan dari nilai politiknya pada kebijakan tersebut. Namun.

tapi eksekutif dan birokrasinya menghendaki hal tersebut sebagai bagian dari balas jasa kampanye pemilihan presiden langsung dan untuk mengamankan kekuasaannya dan hal . Dinamika komplek tersebut terlihat melalui politik bargaining dalam sektor publik yang memungkinkan terjadinya manipulasi dalam pengelolaan publim sektor.Pada konteks organisasi publik. setiap kebijakan yang dibuat selalu bias dengan kepentingan politik. Namun disisi lain. sehingga kemungkinan adanya bargaining dan cheating ada meski dalam era demokratisasi dan kampanye good-governance. para ekskutif melalui birokrasinya terbawa tuntutan reformasi administrasi seperti terwujudnya good governance. Dilema yang terjadi adalah. bahwa pada sisi birokrasi dituntut untuk selalu profesional dan responsif. Birokrasi Pemerintahan (Bureaucratic Government) Interaksi politik dan birokrasi terjadi begitu inten dalam dinamika pemerintahan kita. Hal ini dilakukan agar terhindar dari kegagalan implementasi dan nilai negatif birokrasi. memberikan implikasi pada ricuhnya kebijakan publik. Reformasi birokrasi dimanfaatkan oleh kepentingan politik ditengah arus demokratisasi. birokrasi ditekan oleh politisi melalui nilai-nilai dari paradigma baru tersebut. termasuk tekanan global (IMF. World bank). contoh konkritnya dapat dilihat dari Pilkada secara langsung. Sistem pemilu secara langsung yang diterapkan. Hal tersebut dapat terjadi di pusat maupun daerah (pemilihan kepala daerah secara langsung). Interaksi yang terjadi bukan saja politisi memanfaatkan eksekutif.Oleh karena itu. perubahan dari partai attachment menjadi personal attachment dan terjadinya transformasi kepentingan elit menjadi kepentingan publik sehingga dapat menyebabkan pemerintah lamban dan tidak responsif.

kepentingan. Menurut kerangka yang dikembangkan Carino. .tersebut dianggap hal yang normal. Menurut Carino. Model birokrasi yang berada pada posisi intermediate ada 2 kategori. yaitu : a. yaitu:1. padahal didalamya terdapat manipulasi kepentingan rakyat yang berarti kepentingan demokrasi. Kategori Functional Village Dari perumusan kebijakan / policy sampai dengan implementasinya / pelaksanaannya semuanya tertata rapi. dan pengalaman yang sama.1992:4). Value normatif pada kategori ini adalah value yang memiliki orientasi pada efektivitas dan produktivitas lembaga. tetapi ada cara-cara yang tidak demokratis yang berakibat pada implikasi pemerintahan yang otoriter. ada kemungkinan penyalahgunaan posisi. Kategori Village Life Menjelaskan bahwa baik aparat atau elit politik memiliki latar belakang sosial ekonomi. sehingga negara yang sedang melakukan konsolidasi demokrasi memungkinkan elit eksekutif memiliki akses dalam memainkan informasi dalam birokrasi. Posisi ini sama dengan yang pertama. Pada sisi yang ekstrim. sedangkan Peters dan Pierrs (2001:5) memahami pola interaksi politisi dengan birokrasi lebih mendalam (intensitas terinternalisasinya nilainilai demokrasi) dan terkesan overlapping (birokrasi dan politisi). Bureaucratic sublation of. b. 2. or co-quality with the executive.yang mengakibatkan birokrasi yang awalnya sama akan ada posisi yang lebih tinggi sehingga perlu dikontrol. ada 2 bentuk model. sesungguhnya pemerintahan yang demikian sedang berusaha tampil secara demokratis. pola interaksi tersebut secara teoritis akan menempatkan siapa dimana/dominasi birokrasi ataukah birokrasi sederajat dengan politisi. Executive ascendancy seperti bentuk dikotomi politik administrasi yang murni (Carino. mereka memetakan interaksi kedunya dalam bentuk tumpang tindih karena internalisasi nilai-nilai demokrasi.

nasional. Dan yang terkhir adalah dalam konteks interaksi publik dan private. para pejabat tersebut lebih mementingkan kepentingan golongan atau partainya. daripada kepentingan rakyat. Para elit politik tersebut mendapatkan ruang yang lebih luas dalam wilayah birokrasi. Global Governance juga berkembang melalui level hubungan internasilonal. yaitu Governance. governance telah di gunakan untuk penelitian-penelitian tentang peran pemerintah dalam melakukan koordinasi di sektor .Model birokrasi yang dibahas disini adalah model Bureaucratic Government. dan aktivitas operasional antar beberapa institusi. Model ini juga sangat cocok dengan model Birokrasi Indonesia saat ini. Dalam konteks urban politics. pemanfaatan konsep melalui Local Governance. Sebagai contohnya adalah pemanfaatan konsep oleh IMF dan World Bank dalam rangka good governance. Dalam model ini terjadi kompleksitas politik yang cukup tinggi pada tingkatan organisasi. Hampir semua pejabat di Indonesia dipilih berdasarkan politik. Ide ini di kemas dalam konsep yang telah menjadi Political Catchword di seluruh dunia. Sehingga kesannya. mengapa banyak kebijakan publik di Indonesia sekarang ini memiliki kecenderungan yang mungkin saja berpotensi menyesengsarakan rakyat. Reformasi administrasi terjadi melalui tahapan yang kompleks dan melibabtkan banyak kepentingan. regulasi. Multi lever mengembangkannya dalam konteks interaksi antara lembaga lokal. Sedangkan dalam konteks policy analisis. Reformasi akan merubah tatanan yang telah ada sebelumnya dengan meredefinisi dan resistensi untuk menuju keberhasialn. di kembangkan melalui konsep tentang governance framework.dimana birokrasi negara kita sedang mengalami himpitan permainan elit politik. Karena model birokrasi yang seperti itulah. dan transnasional. Secara umum konsep ini telah di gunakan karena terkait dengan fokus kapabilitas dari pemeerintah dengan interaksinya dan interaksinya antara pemerintah dengan masyarakat. regional.

Selebihnya. namun dalam intervensi global dan demokrasi telah membuka ruang yang lebih besar bagi politisi untuk bermainm dalam wilayah birokrasi ini. Dalam kasus BBm. Peluang ini telah terbaca oleh politisi karena memanng organisasi publik sedang mengalami kesulitan untuk menggunakan instrumen baru ini. yang bisa juga di katakan merupakan gagalnya suatu administrasi negara yang di terapkan dalam konteks global yang terjadi di negara transisi seperti Indonesia ini. tetapi belum sepenuhnya berubah. Perkembangan ini terkait dengan krisis yang dialami oleh nega5a. ada proses perubahan internal organisasi dan juga lingkup eksternal pada suatu negara yang memungkinkan terjadinya reformasi tersebut. Kasus BBM ini merupakan kebijakn yang sarat dengan tuntutan responsibilitas dari organisasipublik yang mendelivernya dan nilai-nilai kolektif yang lebih luas yang menyangkut masyarakat miskin. Ini merupakan permasalahan transfer nilai dari organissai privat ke organisasi publik. Seharusnya reformasi menghendaki pengelolaan yang sistematis. Dalam penerapan reformasi administrasi ini seringkali di manfaatkan oleh politisi untuk mengambil keuntungan. Sebagai contoh adalah NPM dan kasus BBM. yakni pada adopsi instrumen administratif tertentu yang kelihatan tehnis. Komlpeksitas politik pada transisi demokrasi yang belum matang telah memutuskan link yang seharusnya terjadi atau di lakukan. Dari awal kebijakan ini memang di kendalikan secara politis. Kenyataan yang seperti ini bisa mengakibatkan kegagalan. analisis lebih di fokuskan pada interaksi politik dan birokrasi. Dengan kenyataan lemahnya proses reformasi. Intervensi Paradigma ini lebih di fokuskan pada konteks reformasi administrasi saja. Kenaikan harga BBM yang terus di paksakan dengan berbagai .ekonomi. Intervensi paradigma ini juga akan mempengaruhi interaksi kekuasaan antara birokrasi yang di lakukan oleh pelatyan publik dengan politisi pada berbagai tahapan. maka politisi lebih leluasa memanfaatkan instrumen responsibilitas untuk kepentingan kekuasaan jangka pendek.

maka ada dua hal yang penting yaitu : reformasi administrasi yang menggunakan beberapa instrumen yang memiliki nilai kontradiktif satu sama lain dalam dirinya sendiri karena nilai dari organisasi publik dan privat yang digeneralisasikan ternyata telah membuka peluang permainan politik.penolakan melalui demonstrasi-demontrasi menunjukan rendahnya akuntabilitas organisasi publik. Yang kedua yaitu adanya kenyataan bahwa demokrasi yang diinternalisasikan masih dalam tahapan demokrasi formal. Di indonesia antara politisi dan public servant tidak terjadi kerjasama yang baik dalam pemecahan masalah publik yang seharusnya secara demokratis dalam perumusan kebijakan dalam perumusan kebijakan dan responsivitas dalam implementasinya namun disini terjadi penipuan yang dilakukan publik servant dalam pelayanan publik. Padahal rezim seharusnya menentukan peraturan dasar dan kualitas dari interaksi antara bermacam-macam lembaga melalui kebenaran proses kebijakan dan gabungan nilai untuk mengelola masalah publik. Dan lebih di tekankan lagi bahwa proses internalisasi instrument yang lemah akan memberikan peluang yang besar bagi politisi untuk memberikan suatu perfomance dari kebijakan tertentu. Birokrasi kita sekarang ini masih sangat mengecewakan di dalam pelaksanaannya. Sementara akuntabilitas dalam reformasi administrasi merupakan instrumen yang penting. Melihat kenyataan tersebut. Hal ini ditandai dengan banyaknya lobi yang dilakukan eksekutif untuk kepentingan kebijakan. Dalam reformasi ini di manfaatkan oleh politisi melalui cara yang tidak demokratis.kasus kenaikan harga BBM yang didukung oleh . Contohnya. bureaucratic goverment di Indonesia merupakan birokrasi publik yang mengalami kebingungan arah dan ini terjadi di tengah perubahan ke arah demokrasi. karena birokrasi tidak siap untuk berubah. Rezim kita sekarang ini telah gagal menentukan kualitas yang tinggi dalam mengelola masalah publik.prosedural yang memberikan ruang pada elit politik untuk memberi instrument pada organisasi publik.

Seharusnya reformasi administrasi di pahami sebagai sistem administrasi yang lebih efektif untuk perubahan sosial. Kedua partai tersebut setuju dengan kenaikan BBM karena untuk mempertahankan kekuasaan mereka yaitu demi pertimbangan kadernya yang mendapatkan posisi sebagai menteri. reformasi administrasi yang terbungkus dengan paradigma besar seperti demokratisasi dan globalisasi. maka instrumen yang digunakan akan sangat mungkin bernuansa dan di terjemahkan oleh kepentingan elit yakni politik. dan rakyat. Dengan demikian birokrasi kita sekarang ini di bawah kontrol politisi. Keempat. Semua ini terungkap ketika negara kita melakukan pemilu secara langsung. . politisi. Hal ini dapat merugikan reformasi administrasi kita. pertama ide reformasi selalu datang dari kepentingan eksternal dan bahkan global. serta pasar menjadi bagian stakeholder dalam reformasi administrasi. adalah reformasi pastilah produk keputusan politik dan bukannya administratif belaka. Ketiga. Jadi Reformasi administyrasi akan mempertemukan birokrasi. Jadi reformasi itu bukan sekedar masalah tehnis administratif. kedua kepentingan global tersebut tidak selamanya berdimensi tunggal.partai PKS dan PPP padahal dulunya menolak kenaikan BBM. keadilan sosial dan pertumbuhan ekonomi. demokrasidan kesejahteraan rakyat miskin. di mana instrument membawa persamaan politik. Karena apabila reformasi hanya pada tahapan tehnis. lanngsung maupun tidak langsung mewarnai nilai kebijakan melalui lembaga presiden atau wakil presiden yang secara langsung berhadapan dengan rakyat. Logika tersebut di kembangkan dengan beberapa alasan. politisi memainkan perannya untuk tidak melakukan perannya untuk tidak melakukan reaksi sama sekali terhadap resistensi yang di berikan oleh publik.

Padahal dulu pada jaman pemerintahan Soeharto pelayanan publik lebih baik.Komentar: Indonesia adalah negara yang menganut model pemerintahan Demokrasi. Para pejabat sekarang lebih mementingkan kepentingan pribadi dan golongannya daripada kepentingan publik atau rakyat. Justru pelayanan publik berjalan ketika demokrasi di singkirkan. model pemerintahan demokrasi adalah model pemerintahan yang bebas mengeluarkan pendapat dan pemerintah mengutamakan suara rakyatnya di banding kepentingan pimpinannya. Tetapi pada kenyataanya di Indonesia tidak berjalan seperti teorinya. Hal itu di karenakan adanya pengawasan dan kontrol langsung oleh pemerintah pusat. . dulu jika perintah itu tidak di laksanakan maka akan di tindak langsung.

Sign up to vote on this title
UsefulNot useful