Demokrasi dan Partisipasi Publik

PendahuluanDewasa ini istilah demokrasi sering muncul di media massa Indonesia menjelang diadakannya pemilihan legilatif maupun kepala daerah (PILKADA). Tidak berbeda dengan pemilihan yang akan terjadi di lingkungan Rukun Tetangga (RT) 02 Rukun Warga (RW) 19 Dukuh Baturan Desa Trihanggo Gamping Sleman. Meskipun dalam skala dan lingkup yang kecil, tapi pesta demokrasi adalah hak dari warga negara untuk menentukan pimpinan di daerahnya yang dianggap layak dan mampu memegang amanat masyarakat. Secara terminologi, istilah demokrasi berasal dari bahasa Yunani kuno yang terdiri dari kata demos yang artinya adalah rakyat dan kratos/cratein yang berarti pemerintahan . Dalam bahasa Inggris, democracy artinya adalah pemerintahan yang berasal dari rakyat. Sehingga apabila makna dari kedua kata tersebut digabungkan maka demokrasi berarti pemerintahan rakyat. Sedangkan secara umum demokrasi didefinisikan sebagai pemerintahan yang berasal dari rakyat, oleh rakyat, dan untuk rakyat. Pemerintahan dari rakyat artinya adalah pemerintah yang memperoleh amanat merupakan anggota masyarakat yang dipilih dan kemudian diberi amanat oleh rakyat. Oleh rakyat artinya adalah pemerintahan yang dibentuk merupakan hasil dari kesepakatan bersama oleh rakyat sehingga daerahnya memiliki struktur pemerintahan sehingga menjadi teratur. Sedangkan untuk rakyat, memiliki arti bahwa pemerintahan yang dibentuk kemudian bekerja untuk mengabdi dan melayani rakyat tersebut sehingga masyarakat menjadi sejahtera. Inti DemokrasiKekuasaan tertinggi dalam demokrasi ada di tangan rakyat. Rakyat memiliki kedaulatan melalui suara yang digunakan dalam pemungutan suara dalam pemilihan umum. Dengan demikian suara rakyat menjadi penentu dalam pengambilan keputusan pada masyarakat tersebut. Pemilu memberikan kesempatan kepada rakyat

untuk memilih pemimpin yang dianggap paling layak dan mampu untuk mengemban amanat. Kemudian pemimpin yang terpilih akan memperoleh mandat dari rakyat untuk mengelola pemerintah melalui lembaga perwakilan rakyat. Lembaga perwakilan berasal dari anggota masyarakat yang bertugas untuk menjaga agar pelaksanaan pemerintahan tidak mengalami pemyimpangan. Lembaga perwakilan merupakan wadah bagi rakyat untuk menyalurkan aspirasi sehingga suara rakyat tersalurkan pada pemerintah. Rakyat juga bisa secara langsung memberikan masukan tidak hanya kepada lembaga perwakilan tetapi juga kepada pemerintah. Tindakan ini disebut dengan partisipasi publik (rakyat). Partisipasi adalah suatu proses dimana sejumlah pelaku bermitra punya pengaruh dan membagi wewenang di dalam prakarsa “pembangunan”, termasuk mengambil keputusan atas sumberdaya . Sedangkan Partisipasi publik secara sederhana diartikan sebagai keikutsertaan dan keterlibatan masyarakat dalam aktivitas kenegaraan. Wujud partisipasi publik bisa beragam, misalnya ikut pemilihan umum (pemilu), membayar pajak, menyampaikan aspirasi, keluhan, mengontrol pemerintah, dan lain-lain. Salah satu contoh nyata dari partisipasi publik adalah keikutsertaan dalam pemilihan umum (pemilu). Istilah lain dari pemilu adalah pesta demokrasi. Disebut demikian karena pemilu merupakan kegiatan besar menyerupai perayaan/pesta dimana rakyat berhak dan menjadi penentu dari perjalanan masyarakatnya. Pemilu pertama kali dilaksanakan pada jama Yunani Kuno untuk memilih anggota senat polis yang memberikan masukan kepada kaisar. Pada jaman tersebut pemilu dilaksanakan secara langsung dengan cara memilih calon anggota senat yang ada. Di samping itu, jumlah penduduk yang memiliki suara dalam suatu polis masih sedikit sehingga pemilihan bisa dilakukan secara langsung. Dewasa ini, jumlah rakyat di suatu negara sangatlah besar sehingga pemilihan secara langsung sering kali memakan waktu sehingga

dan Kepala Desa dilakukan secara langsung. Presiden. Ketika memilih seorang pemimpin berarti merelakan hak tersebut dilakukan oleh orang lain. Ketika seseorang memilih calon pemimpin. Pemimpin adalah individu yang diberi amanat untuk menjalankan pemerintahan. Gubernur. Namun demikian hak tersebut tidak diserahkan hanya dipinjamkan dalam bentuk amanat dan rakyat bisa meminta kembali bahkan mencabut amanat/hak dipinjamkan kepada pemimpinnya apabila dianggap gagal atau melakukan penyimpangan. Mengingat setiap individu memiliki hak yang sama untuk memimpin. Bupati/Walikota. Kepemimpinan dalam MasyarakatPemimpin adalah individu yang bertugas sebagai kepala pemerintahan. yang bersangkutan sebenarnya sama saja dengan mendelegasikan hak untuk menjadi pemimpin dan mengelola daerahnya karena setiap individu memiliki hak yang sama. DPR. Namun hal ini mendapat banyak kritik karena lembaga perwakilan seringkali tidak mewakili aspirasi dari rakyatnya sehingga pemilihan langsung tetap digunakan untuk memilih pemimpin masyarakat. Walikota. Rakyat memilih anggota lembaga perwakilan dan lembaga perwakilanlah yang memilih kepada negara tersebut. Oleh karena itu seorang pemimpin harus bertanggung jawab kepada rakyatnya dan menjalankan tugasnya untuk melayani rakyat. Hal ini juga berlaku kepada calon Ketua RT yang akan dipilih. dan kepala desa adalah pemimpin. Bupati. DPRD.dikenal pemilihan tidak langsung. Amanat dan kekuasaan yang dimiliki oleh pemimpin adalah pemberian rakyat dan bersifat sementara dan bisa dicabut. Pemilihan Presiden. Demikian halnya dengan rencana pemilihan Ketua RT 02 ini. Rakyat memiliki kedaulatan melalui suaranya untuk memilih dan menentukan pemimpin yang paling dipercaya untuk mengemban amanat. Kepala pemerintahan memiliki tugas untuk mengatur tatanan kehidupan masyarakat sehingga berjalan .

Komunikasi yang baik harus berjalan sehingga menciptakan kedamaian antar wilayah. Perbedaan kepentingan memungkinkan terjadinya benturan antar anggota masyarakat dan berakibat pada timbulnya perselisihan. Pemimpin harus memiliki pengetahun dan wawasan yang luas sehingga mampu mewakili masyarakatnya untuk berkomunikasi dengan pihak lain. Masyarakat juga harus mematuhi ketentuan pemerintah yang bertujuan untuk kemakmuran masyarakatnya sehingga resiko terjadi konflik dapat dikendalikan. . tapi dibantu oleh perangkat organisasi lain. Masyarakat dalam menjalankan kehidupannya juga berhubungan dan berdampingan dengan masyarakat lain. Pemimpin dalam hal ini harus mengakomodasi kepentingan rakyat banyak sehingga pemenuhan atas kebutuhan yang menjadi hajat hidup orang banyak harus didahulukan. Masyarakat dengan sukarela telah menyerahkan haknya menjadi pemimpin untuk dipimpin oleh orang lain. Masyarakat juga harus secara aktif melakukan pengawasan terkait pemanfaatan sumber daya daerahnya karena kekayaan daerah pada hakikatnya adalah milik masyarakat dan dipungut dari masyarakat oleh pemerintah meskipun pengelolaan diserahkan pada pemerintahan setempat. Pemenuhan kebutuhan membutuhkan sumber daya yang dimiliki oleh daerah tersebut. Setiap individu dalam masyarakat memiliki kepentingan yang berbeda-beda. pemimpin haruslah memiliki visi yang baik sehingga masyarakat yang dipimpinnya memiliki tujuan. Meskipun tidak memimpin sendiri. Sumber daya tersebut harus dikelola dan dialokasikan secara tepat sehingga sasaran yang dituju mengena dan tidak terjadi pemborosan. Seorang pemimpin harus menjadi wakil masyarakatnya dalam berhubungan dengan masyarakat yang lain. Kekuasaan yang dimiliki merupakan tanggung jawab yang berasal dari masyarakat. Keseluruhan tugas yang dimiliki oleh pemimpin adalah amanat dari masyarakatnya.dengan baik.

calon pemimpin diharapkan bisa mengemban tugas yang akan diletakkan di pundaknya. dan 4) Akuntabel (bertanggung jawab): menjalankan kegiatan yang bermanfaat untuk masyarakat. 3) Partisipasif: melibatkan masyarakat dalam musyawarah. Hati nurani yang baik seharusnya bisa mengantarkan pemilihan pada seorang pemimpin yang terbaik di mata masyarakat. Masyarakat berhak untuk memilih pemimpin sesuai dengan hati nurani yang dimiliki. seorang pemimpin harus mempertanggungjawabkan tugasnya kembali kepada masyarakat. Hal ini bertujuan agar tugas-tugas yang dibebankan pada seorang pemimpin bisa berjalan dan berhasil. Ini adalah wujud dari akuntabilitas pemimpin kepada warganya. 2) Transparan (terpercaya): pengelolaan sumber daya bisa diketahui oleh masyarakat. Oleh karena itu diperlukan kriteria pemimpin yang ideal. Keterlibatan warga sangat . dan apa saja yang telah dicapai dengan penggunaan wewenang dan sumberdaya tersebut kepada pihak yang memiliki hak atau kewenangan untuk meminta keterangan atau pertanggungjawaban .Oleh karena itu. Tugas masyarakat setelah seorang pemimpin berhasil dipilih adalah mematuhi dan menjalankan kebijakan serta peraturan yang dibuat untuk kepentingan masyarakat. Akuntabilitas adalah kewajiban untuk menyampaikan pertanggungjawaban atau untuk menjawab dan menerangkan kinerja dan tindakan seseorang/badan hukum/pimpinan kolektif suatu organisasi dalam penggunaan sumber daya yang ada. Dengan demikian masyarakat sebagai pihak yang memiliki sumber daya dan melimpahkannya pada pemimpin akan menilai keberhasilan pelaksanaan tugas yang diamanatkan. Setiap warga juga wajib untuk melibatkan diri dalam berbagai kegiatan yang diselenggarakan oleh organisasi masyarakat di lingkungannya. yaitu: 1) Terbuka (jujur): bisa berkomunikasi dengan semua pihak. Dengan kriteria tersebut. Terdapat beberapa kriteria untuk memilih pemimpin ideal.

dan untuk warga. warga juga harus berpartisipasi secara aktif dalam melakukan pengawasan dan kontrol atas kegiatan yang diselenggarakan di wilayahnya. . Oleh karena itu. Yang bersangkutan harus legawa dan siap menjalankan tugas. oleh warga. PenutupPemilihan Ketua RT 02 di Padukuhan Baturan merupakan kegiatan dari warga. Dengan demikian semua orang yang menjadi warga di lingkungan tersebut memiliki hak yang sama. mematuhi. Dengan demikian kegiatan yang dilaksanakan benar-benar dibutuhkan dan mampu dirasakan manfaatnya secara luas.penting dan tidak hanya pada pelaksanaannya tapi juga dalam perencanaan kegiatan. Sedangkan warga yang lain harus menerima. membantu. Selanjutnya. Hak tersebut adalah untuk memilih dan dipilih menjadi Ketua RT berdasarkan kriteria yang telah disepakati. Ini adalah wujud dari tanggung jawab moral warga terhadap pemimpin yang dipilihnya. dan mengawasi ketua baru demi RT 02 semakin maju di masa datang. setiap individu harus siap menjadi ketua apabila dipilih oleh warga yang lain.

32). M. kaku. menurutnya birokrasi merupakan tipe ideal bagi semua organisasi formal. Pembahasan birokrasi selalu menarik untuk dibicarakan baik sebagai bahan diskusi maupun sebagai bahan kajian ilmiah untuk diperdebatkan dengan tujuan mencari solusinya. a. Masyarakat didominasi oleh para birokrat. Ciri organisasi yang mengikuti sistem birokrasi ini ciri. dan efisiensi. prosedur yang panjang dan memakan waktu yang lama. orientasi impersonal. persiapan proposal legislatif.Levine. karir yang panjang.Si Jurusan Ilmu Adminisrasi Negara Fakultas Ilmu Sosial dan Ilmu Politik Universitas Sumatera Utara Berbicara tentang birokrasi sering kali kita asumsikan dengan urusan yang berbelitbelit. kemajuan dan perkembangan suatu sistem politik khususnya memperkecil ruang gerak demokrasi. peraturan-peraturan. Menurut Herbert M. pokoknya selalu mendapat “tanda” negatif dari pendengarnya. ditulis oleh James Burnham tahun 1941 yang menekankan pentingnya kelompok manajerial di dalam perekonomian. Menurut Weber organisasi birokrasi dapat digunakan sebagai pendekatan efektif untuk mengontrol pekerjaan manusia sehingga sampai pada sasarannya. lisensi dalam perekonomian dan masalah-masalah profesional. Organissasi mengopcrasikan prinsip-prinsip dasar hirarki kantor dimana ada garis-garis yang jelas dari atasan dan bawahan.982: 241). Birokrasi memainkan peranan aktif di dalam proses politik di kebanyakan negara dan birokrasi menggunakan banyak aktifitas-aktifitas. Tulisan ini mencoba menjabarkan birokrasi berkaitan dengan demokrasi dan melihat posisi itu melalui Rekonstruksi. diantaranya usaha. 1982 : 240).Levine.HUBUNGAN BIROKRASI DENGAN DEMOKRASI Dra. ©2003 Digitized by USU digital library 11984 : 26. Cita-cita utama dari sistem birokrasi adalah mencapai efisiensi kerja yang seoptimal mungkin. DARA AISYAH.pengaruh dan para kepala dan star biro pemerintahan. tidak imaginatif. Konsep Birokrasi Dalam kamus Akademi Perancis tahun 1798. kekuasaan hirarkis.cirinya adalah pembagian kerja dan spesialisasi. Birokrasi diartikan :"kekuasaan. 1989 : 100) Berdasarkan tulisan tersebut James memberi persamaan antara . boleh dikatakan artinya canggung. Hal ini akan menjadi lebih transparan apabila kita memantau birokrasi yang berhubungan atau berurusan dengan organisasi formal. negeri maupun swasta. peraturan ekonomi. birokrasi di definisikan sebagai:"wewenang atau kekuasaan dari berbagai departemen pemerintahan. birokrasi kadang-kadang digunakan dalam suatu hal yang diremehkan.” Birokrasi sebagai suatu sistem organisasi formal dimunculkan pertama sekali oleh Max Weber pada tahun 1947. Apalagi topik yang akan dikaji ada hubungannya dengan demokrasi sehingga memerlukan suatu pemikiran yang serius untuk menelaah dan menilai akibat-akibat yang terjadi dan yang ditimbulkan oleh aksi birokrat dalam konteks demokrasi yang perlu diperbaiki. Namun apakah sudah menjadi hal yang sulit direform bahwa birokrasi selalu menghambat kemudahan. karena organisasi birokrasi punya struktur yang jelas tentang kekuasaan clan orang yang punya kekuasaan mempunyai pengaruh sehingga dapat memberi perintah untuk mendistribusikan tugas kepada orang lain (Robert Denhard.usaha paling penting berupa implementasi Undang-Undang. Oleh karena itu lebih baik dijelaskan terlebih dahulu apa birokrasi dan demokrasi itu Bagaimana kontribusinya terhadap demokrasi Bagaimana posisi birokrasi dengan demokrasi melalui rekonstruksi bagaimana situasi problematik yang terjadi di Indonesia dan strategi seperti apa yang dapat diterapkan di Indonesia sehingga antara birokrasi dan demokrasi bisa direkonstruksi. dan membagi pelayanan kesejahteraan (Herbert M. dan tidak ada pemisahan yang tajam antara kelompok manajerial clan pejabat politik (Martin Albrow. Sedangkan menurut kamus bahasa Jerman edisi 1813. 1.Levine. dan para administrator pemerintah yang tidak efisien (Herbert M. islam maupun non islam.

khususnya dalam cara pandang terhadap pembangunan politik. Basis kultural dalam pemerintahan Orde Baru di Indonesia itu dapat dilihat dari bagaimana hubungan antara elit politik dengan warga negara sebagai hubungan antara kawulo dan gusti. egalite. parapenguasaharusdipiliholehmasyarakat. 4. memutuskan kebijaksanaan umum dan melaksanakan hukum dan administrasi pemerintahan. karena adanya perubahan sikap dari masyarakat akan bergantung kepada pengaruh para birokrat.kekuasaan kelas para manajer dengan kelas para birokrasi negara. fraternite. demokrasi magandung dua dimensi kontes dan partisipasi yang menurut Robert Dahl merupakan hal menentukan bagi demokrasi. David Held menyatakan ada 7 prinsip utama penyelenggaraan negara berdasarkan demokrasi yaitu: 1. c. Kata demokrasi berasal dari bahasa Yunani. oleh rakyat. Demokrasi juga mengimplikasikan adanya kebebasan sipil dan politik yaitu kebebasan berbicara. definisi yang paling singkat tentang demokrasi adalah apa yang diucapkan oleh Abraham Lincoln di Gettysburg. Pensylvania. masyarakat secara perseorangan harus terlibat dalam pembuatan keputusan yang penting dalam arti memutuskan hukum-hukum publik dan masalah. para penguasa berkewajiban untuk mempertanggungjawabkan tindakantindakannya kepada masyarakat . untuk rakyat Esensi dari demokrasi adalah bahwa rakyat memerintah atau melakukan pemerintahan oleh dirinya (government by the people) (majalah Koridor. Masyarakat yang dibentuk dan diperintah oleh para birokrat akan menjadi masyarakat -masyarakat birokratis yang nantinya masyarakat tersebut akan menjadi birokrasi-birokrasi masyarakat yang patuh dan tunduk pada pengaruh sikap-sikap dan nilai-nilai para birokrat. menerbitkan. Hal ini akan cepat menjerat masyarakat akan runtuhya nilai-nilai demokrasi sehingga ada suatu pertentangan dengan nilainilai tersebut yang dianggap sebagai suatu problema yang memerlukan pemecahan. dimana ada kontrol yang efektif. Arnerika Serikat tahun 1863 yaitu pemerintahan dari rakyat. Cara pandang tentang demokrasi dari waktu ke waktu mengalami perkembangan sejalan dengan semakin kompleksnya hubungan antar warga. Kalau kita amati model demokrasi David Held diatas. para penguasa harus bertindak sesuai dengan kepentingan masyarakat. Kontribusi birokrasi dengan Demokrasi Kebanyakan orang menganggap bahwa konsep birokrasi sebagai administrasi yang tidak efisien dan rasional. Huntington.masalah kebijaksanaan umum. ekonomi dan ideologi yang menjadi anutan. (prisma No.4 tahun XXI. 5. rezim yang memerintah. masyarakat harus memerintah dalam arti semua harus terlibat dalam membuat undang-undang. parapenguasadipilihmelaluirepresentatif/perwakilandarimasyarakatdan 7. 6. maka masalah birokrasi dan demokrasi tidak akan pernah berhenti. maupun nilai masyarakatnya sendiri dalam memaksimalkan upaya yang ada menuju iklim demokratisasi yang diidam-idamkan. Demokrasi yang dapat menghambat nilai-nilai kultural menurut seorang Indonesianist Benedict R. parapenguasaharusbertanggungjawabkepadaperwakilandarimasyarakat. 1994: 3.4). Selama masih ada tipe-tipe pejabat negara dan seperangkat nilai yang dianggap sebagai bagian inheren dalam demokrasi yang sebenamya. yang dibutuhkan bagi perdebatan politik dan pelaksanaan kampanye-kampanye pemilihan itu (Samuel P. berkumpul dan berorganisasi. 3. ©2003 Digitized by USU digital library 2 2. Usaha demokratisasi masih memerlukan rentang waktu yang cukup panjang bagi lembaga-lembaga politik. mencakup aplikasi kriteria evaluatif dan spesifikasi sifat . b. 1995 : 6).O'G Anderson yaitu prinsip ajaran demokrasi pandangan Jawa yang sangat mempengaruhi sistem politik dan proses demokratisasi Indonesia. oleh warga negara terhadap kebijakan pemerintah. 1992 : 32). maka untuk kasus negara berkembang seperti Indonesia demokrasi yang muncul sangat bergantung kepada perilaku elit politik dan struktur budaya. Konsep Demokrasi Pada tulisan ini perhatian kita tertuju pada masalah birokrasi dan hubungannya dengan demokrasi. antara kekuasaan di kalangan "wong ghede dan wong cilik”. Demokrasi berarti liberte. menurut bahasa Yunani.

nilai-nilai tersebut (Martin Albrow. agar dapat memahami birokratisasi dalam pembangunan nasional. dan kelompok kepentingan semuanya lemah dan tidak mampu melakukan kontrol terhadap birokrasi. Bertitik tolak dari ciri-ciri tersebut maka dapat kita simpulkan bahwa birokrasi di Indonesia cendrung mendekati ke tiga ciri tersebut.(Muhadjir Effendy. menciptakan suatu sosok sistem politik bureau-nomia (Moeljarto Tjokrowinoto. Martin Albrow membedakan tiga posisi dasar tentang fungsi-fungsi pejabat di negara demokrasi. 2. konsepkapitalismebirokratikyangdirumuskanolehWittfogel(1957).terutama pembangunan yang mampu mengantisipasi dan menahan gejolak-gejolak eksternal sehingga bisa mencapai tingkat pertumbuhan yang memadai.1989 : 1 07). 3.Kedua. pejabat menuntut kekuasaan terlalu besar dan perlu dikembalikan pada fungsinya semula. sehingga perlu dipertanyakan kemampuan masyarakat politik birokratik ini untuk melaksanakan pembangunan . masa diluar birokrasi secara politis dan ekonomis pasif. karena mereka percaya bahwa bukan kekuasaan yang dijalankan pejabat yang menimbulkan masalah tetap cara menggunakan kekuasaan itulah yang menjadi masalahnya.X tertanggal 3 November 1945. lembagapolitikyangdominanadalahaparatbirokrasi 2.28 ). dimana politik yang ikut menentukan sosok administrasi pemerintah pada waktu itu. ©2003 Digitized by USU digital library 3 Problema yang harus dipecahkan untuk dapat menumbuh kembangkan demokrasi dengan menempatkan birokrasi secara konsisten di dalam sistem politik. yang dapat mendistribusikan secara merata hasil dari perjuangan masyarakat tersebut. Menurut teori. kekuaasaan perlu bagi para pejabat sehingga harus dicari metode-metode pelayanan yang dapat disalurkan bersama-sama. partai politik. sedangkan parameter birokrasi “ sehat “ yang dijadikan sandaran adalah konsep birokrasi weber . yaitu kecendrungan birokrasi semakin menguasai masyarakat. 1996: 159). yaitu 1. pejabatbenar-benarmernilikikekuasaandantugasyangsemakinbesarsehingga jabatan tersebut harus dijalankan secara bijaksana . 3. konsep ini diamati secara serius karena mendiskusikan tentang pejabat-pejabat negara yang menjalankan tujuan-tujuan demokrasi. Ada tiga kecendrungan yang dialami oleh setiap birokrasi. januari-april 1995 : 27.Northcote Parkinson Ketiga. Perlu dipertanyakan apakah tindakan tergantung pada bagaimana nilainilai demokrasl Itu ditafsirkan dan mana diantara penafsiran itu yang dipandang salah. Berdasarkan konsep Jackson tersebut maka ciri-ciri pokok masyarakat politik birokratik adalah : 1. di Indonesia terlebih dahulu didekatkan melalui 2 konsep yaitu : 1. untuk birokrasi di Indonesia agaknya cendrung ke arah parkinsonisasi dan orwelisasi ketimbang ke arah weberisasi. konsep masyarakat politik birokratik yang dikembangkan pertama sekali oleh Fred Riggs (1966) dan digunakan oleh Karl D. terwujud konfirmasi. sehingga menyebabkan lemahnya peranan partai politik dan dampaknya semakin memperkuat peranan birokrasi. apalagi konsep birokrasi sebagai kekuasaan yang dijalankan oleh pejabat. Menurut analisa Dr. yaitu pertama proses weberisasi.Muhadjir Darwin yang menyimpulkan bahwa birokrasi di Indonesia sedang “sakit” dengan titik tekanannya berdasarkan hukum Parkinson. yaitu suatu proses dimana suatu biroksasisemakin mendekati tipe ideal sebagaimana dikemukakan oleh Max Weber. seperti parlamenter. Konsep birokrasi cendrung dianggap sebagai suatu aspek ancaman terhadap demokrasi. Dalam sistem politik demokrasi liberal yang berawal dari Maklumat Wakil Presiden No. 2. Friedrich dan Finer prihatin terhadap masalah kesesuaian praktek-praktek administrasi negara modem dengan nilai-nilai demokrasi.Jackson (1978) dalam konteks Indonesia. untuk itu perlu dilihat bagaimana masing-masing karakteristik antara birokrasi dan demokrasi digunakan dalam usaha mendiagnosis dan menyembuhkan masalah yang terjadi. dalam jurnal Bestari. proses parkinsonisasi yaitu proses dimana birokrasi cendrung menuju kedalam keadaan patologis sebagaimana pernah diduga kuat oleh C. Posisi infrastruktur politlk vis-a-vis suprastruktur politik secara relatif lebih kuat. proses orwelisasi. lembaga–lembaga politik lainnya.

setidak-tidaknya masyarakat harus memberikan pengertiannya karena pada kenyataannya jumlah polisi tidak cukup banyak di dalam melakukan kontrol atas penerapan hukum. adanya tuntutan negara semakin berkembang terus. hal ini berarti mengurangi demokrasi. Bila kita lihat contoh di Indonesia. dan sulit menciptakan masyarakat yang sadar pajak dalam sistem yang diterapkan untuk meningkatkan penerimaan negara. bahwa masyarakat wajib pajaknya sudah lelah dengan seabrek peraturan yang harus dipatuhi.nilai demokrasi.tetapi pada kenyataanya selalu menimbulkan masalah. 3. yakni dengan memantapkan organisasi-organisasi sifatnya yang lebih birokratis daripada berupa pengaturan secara demokratis. Nilai-nilai demokratis tidak saja berarti tujuan-tujuan masyarakat yang ditentukan oleh keputusan mayoritas. baik juga untuk rnasyarakat.ciri organisasi yang diharapkan terlalu ideal sehingga kadang kala belum tentu cocok dengan kondisi atau situasi di suatu negara.. karena freewill terbatas untuk masyarakat. karena ciri.Dampak Kekuasaan Birokrasi Terhadap Kondisi Demokrasi kekuasaan birokrasi menimbulkan pertanyaan yang menyebabkan para ilmuan mulai berpikir. Pada dasamya masyarakat lebih menginginkan terciptanya kesadaran daripada kepatuhan.203). ©2003 Digitized by USU digital library 4 d. kerelaan yang pertama-tama bersifat pasif pada akhimya membangkitkan rasa ketidakberdayaan. 2. Dalam jangka pendek. sehingga sulit untuk mencapai tahap masyarakat yang "marginal detterence". Marshall. tentu saja birokrasi dapat memerintah masyarakat tanpa Menimbulkan perlawanan mereka Namun sebagaimana kita juga pemah belajar dari masa lampau.Kepatuhan tanpa syarat pada hakikatnya menghindari kritik dan ketidaksepakatan yang menjadi inti demokrasi (Peter M. tetapi juga bahwa tujuan-tujuan tadi diterapkan melalui metode-metode efektif yang ada. akan tetapi semakin kuat birokrasi dalam negara maka akan semakin rendah demokrasi dan sebaliknya semakin lemah birokrasi maka akan semakin tinggi demokrasi. Hal ini kemudian dicetuskan dalam bentuk protes yang mengacaukan suasana. Keberadaan birokrasi-birokrasi semacam itu tidak merusak nilai. yaitu pemberian tanggungjawab pada negara untuk melakukan sesuatu pada masyarakat. untuk dapat berfungsi.Blau. Sedikit kepatuhan sudah merupakan suatu kondisi bagi demokrasi. Gejala tumbuhnya birokrasi yang terlarnpau kuat diungkapkan oleh Fred W Rigg ketika ia rnelakukan penelitiam modernisasi di Thailand yang kemudian muncul . Apabila kita menunggu sampai suasana itu benar-benar terjadi. yaitu : tuntutan dari rnasyarakat sehingga membuat birokrasi menjadi lebih besar peranannya..Meyer . doronganekonomi.. Birokrasi sulit untuk direm karena ada dorongan dari dalam (birokrat itu sendiri) ataupun dari luar seperti : 1. karena belum tentu yang dilakukan birokrat baik. dorongan yang bersifat sosial. Demokrasi dan birokrasi sesungguhnya sangat diperlukan dalam proses pembangunan suatu negara . ada pandangan bahwa negara ©2003 Digitized by USU digital library 5 sebagai penggerak pembanggunanan nasional dan negara diasumsikan sebagai fungsi yang strategis. inilah yang disebut antitesis demokrasi. Bila pemerintah harus memaksa kepatuhan yang sepenuhnya. daripada takut karena adanya ganjaran hukuman yang menantinya. Jika birokrasi berlebihan maka masyarakat dirugikan karena masyarakat punya otonomi yang terbatas. Ibarat seorang pencuri bertobat untuk tidak akan mengulangi perbuatannya karena dia takut kepada Allah (sadar bahwa mencuri itu perbuatan dosa). dorongan politik. kalau mentalnya masih mental pencuri. dan W.1987: 202. sehingga ada kesan terpaksa untuk memenuhi kewajiban perpajakan. yang meminta negara untuk menyelesaikannya dan meminta negara melayani hal tersebut sebagai contoh yaitu negara yang demokratis. Adil dan perlakuan yang sama bagi seluruh penduduk ternyata membutuhkan seperangkat hukum yang kompleks da peraturan-peraturan administratif. dengan demikian keadaan menjadi sulit bila masyarakat cendrung tidak mematuhi hukum.

terutama dalam upaya mencegah massa rakyat di bawah keterlibatan politik yang terlampau aktif agar proses akselerasi industrialisasi tidak tergangggu (Guelermo O'Donnel dalam Muhammad AS Hikam. Sementara demokrasi merupakan keinginan dari sebagian besar rnasyarakat untuk rnendapatkan keberdayaan sehingga proses tawar menawar antara state dan sipil society dapat berkembang dengan baik khususnya dalam kerangka pengembalian keputusan politik sebagaimana prinsip-prinsip dasar dari demokrasi itu sendiri. tetapi ia telah menjadi kekuatan dominan yang marnpu mengatasi keduanya. Pendekatan ini sering juga disebut organisasi anarki.Jackson dan Lucian W. Proses kebijakannnya sering kali tidak dimulai dari titik nol karena selalu dimulai dengan kebijakan yang ada sehingga standard operating procedurenya terlalu kuat. merupakan kebijakan yang mencari tujuan yang pasti. merupakan kebijakan yang dimulai dengan melihat kebijakan yang ada. e. Otoritarian Birokratik memang diciptakan untuk melakukan pengawasan yang kuat terhadap masyarakat sipil. Model Garbage Can. namun menjalar sampai kepada kegiatan ekonomi sosial budaya termasuk juga ideologi. akan tetapi hubungan antara tujuan dan kebijakan-kebijakan utama tidak selalu jelas. menurut model ini hasil pembuatan keputusan secara kebetulan dipengaruhi 4 komponen yaitu : para partisipan. Birokrasi dan Demokrasi melalui penjelasan tersebut ibarat dua sisi dari mata uang yang sama. Keterlibatan negara tidak hanya dalam bidang poitik formal. Jika dalam studi Rigg birokrasi. solusi. hat ini menandakan bahwa birokrasi bukan pemerintahan rakyat tetapi mengembalikan peran negara sebagai arbiter (perantara). apa yang menjadi tantangan masa depan. Jurnal IImu Politik No.Rekonstruksi Birokrasi dan Demokrasi Melalui Beberapa Pendekatan.jackson. ©2003 Digitized by USU digital library 6 Modal kebijakan merupakan pendekatan yang akan dipakai dalam merekonstruksi birokrasi dan demokrasi. dalam Karl D. Synoptic Model. yang menempatkan birokrasi melalui pemasukan nilai budaya masyarakat yang dominan sebagai suatu kekuatan tersendiri dalam mempengaruhi sistem politik dan perilaku politik elit kekuasaan (Karl D.8. masalah-masalah dan kesempatan untuk memilih (Charles . maka model O'Donnell birokrasi itu tidak hanya berkolaborasi dengan kekuasan tetapi juga melibatkan diri hampir di semua bidang kegiatan. akan tetapi keduanya justru menunjukkan tingkat perbedaan yang mendasar dan kalaupun memungkinkan dapat dipertemukan satu sama lain melalui rekonstruksi antara keduanya. contohnya : kebijakan pengentasan kemiskinan.Pye. merupakan model yang ideal dengan melihat proses kebijakan sebagai suatu proses yang sangat rasional dimana policy maker atau aktor-aktor yang terlibat dalam proses kebijakan dianggap memiliki persepsi yang jelas tentang tujuan yang akan dicapai (Charles H Levine. B.Jackson untuk studinya tentang birokrasi di Indonesia. Birokrasi merupakan salah satu sarana bagi kekuasaan negara untuk memperkuat posisi politik dan merupakan sumber legitirnasi politiknya. AIPI LIPI Jakarta 1991: 68). adanya kesadaran para aktor dalam birokrasi sehingga mengambil nilai tertentu yang siap dimaksimalkan pemerintah. Frank J. Allison mendeskripsikan 4 model kebijakan yaitu : 1.Para aktor politik bisa menilai konsekuensi-konsekuensi positif dan negatif. 3. Studi Fred W Rigg tentang Bureaucratic Polity dan GuelermO'Donnel tentang Bureaucratic Authoritarian nampaknya menggarisbawahi bahwa dalam masyarakat tertentu posisi birokrasi sudah berada di bawah kontrol politik kekuasaan dalam rangka mendapatkan sumber legitimasi politik melalui sarana birokrasi. 1990 : 82) . Model Incremental. birokrasi dan demokrasi sangat diperlukan dalam kegiatan negara dan masyarakat.dengan konsep "Bureaucratic Polity" yang menggambarkan betapa birokrasi di Thailand telah memasuki suatu jaringan kehidupan politik dan ekonomi yang sangat kuat yang dilakukan oleh negara terhadap kehidupan masyarakat. tetapi turut melakukan kebijakan berupa tindakan membela si miskin sebagai suatu pertanda merekonstruksi demokrasi. dalam konsep yang sama Karl D.Guy Peters. Thompson. Dalam hal ini birokrasi tidak hanya penerima kebijakan dari pejabat-pejabat politik. 2. apa perlu kebijakan direvisi atau direform. berkolaborasi dengan kekuasaan pemerintah. 1987:4). Berdasarkan studi Guelermo O'Donnel bahwa negara telah muncul sebagai kekuatan politik yang tidak hanya relatif mandiri berhadapan dengan faksi-faksi elit pendukungnya serta masyaraklu sipil.

para birokrat agak alergi karena daya inovasi kaum birokrat dipengaruhi oleh advokasi dari para pimpinan politik yang harus diyakini melalui reformasi tersebut. dimana terlalu banyak prosedur dan standard operating procedure terlalu dinomorsatukan atau dijadikan sebagai salah satu instrumen yang digunakan oleh pemerintah pusat. ©2003 Digitized by USU digital library 7 Sumarlin dan Saleh Affif ketika beliau-beliau tersebut menjadi Menteri Penertiban Aparatur Negara pada Kabinet Pembangunan I. Reformasi tersebut dapat dilaksanakan walaupun pada kurun waktu tersebut birokrasi Indonesia secara umum masih konservatif dan belum terbuka terhadap perubahan.evine. kurang mampu mendorong empowering masyarakat karena birokrasi melihat masyarakat dari kaca mata bagaimana masyarakat melaksanakan peraturan dan bukan melihat bagaimana inisiatif masyarakat itu sendiri sehingga ada kesan pemaksaan yang dapat menimbulkan benih-benih konflik yang mengakibatkan rakyat sebagai lawan dari birokrasi. memperjungkan atau membangun strategi-strategi sendiri dengan koalisi. aliansi yang kuat antara birokrasi dan organisasi politik. Padahal seharusnya birokrasi bekerja untuk rakyat. seperti yang dilakukan oleh Emil Salim.Thompson. Kurang berhasilnya reformasi administrasi di Indonesia selama kurun waktu PJPT-1 ini nampaknya dipengaruhi paling tidak oleh 2 faktor : 1. dan Menteri Saleh Affif mengadakan reformasi untuk menggairahkan kegiatan ekonorni melalui serangkaian kebijakan deregulasi. Problema birokrasi yang melanda negara Indonesia dengan adanya pelaksanaan peraturan dan juga yang semakin banyak.(Charles H. .H. J. Berdasarkan beberapa model yang ditawarkan. Strategi Birokrasi yang Diterapkan Di Indonesia melalui Contoh kasus Reformasi Perpajakan. dalam orasi ilmiah yang disampaikan pada kuliah perdana program MAP UNT AG. karena hidupnya dari gaji yang diperoleh dari pajak rakyat dan bukan malah menjadi alat untuk menekan rakyat.84) 4. telah menimbulkan politisasi birokrasi yang berlebihan. kuatnya dominasi ekonomi perencanaan pembangunan nasional. merupakan bagian yang tidak dapat terpisahkan dari upaya mencari wilayah dinamika dari studi pembangunan politik yang akan meningkatkan kehidupan politik ideal yang demokratis. Model Birokratik Politik. sehingga reformasi administrasi tidak pernah menjadi fokus perhatian tetapi hanya sebagai pendukung pembangunan ekonomi . Reformasi administrasi perlu dilancarkan sebagai bagian dari pembangunan politik.1990: 84). belum nampak adanya minat yang cukup besar dikalangan para pimpinan organisasi politik mengenai reformasi administrasi. Namun. merupakan proses pengambilan keputusan dalam melibatkan banyak aktor/kelompok-kelompok kepcntingan yang masing-masing punya nilai atau kepentingan sendiri. terutama melalui pengaruh jalur-jalur A dan B di Golkar. Menteri Sumarlin mengadakan reformasi pada sistem remunerasi pegawai negeri.B Guy Peters. Posisi saling berhadapan antara birokrasi yang mewakili lembaga negara dengan civil society yang berada pada posisi masyarakat. 1990 :83. Thompson.Levine. beberapa teknokrat dalam birokrasi mencoba mengadakan upaya-upaya reformasi . 2. bergaining atau kompromi sesuai dengan tujuan yang ia miliki. Situasi Problematis yang teriadi di Indonesia. reformasi tersebut belum mampu menciptakan suatu snow ball reformasi administrasi yang terus sustainable dan akhirnya mampu menciptakan sistem adrninistrasi yang handal dan dapat bargaining mendukung pembangunan ekonomi politik (Sofian Effendi. g. liberalisasi dan industrialisasi ekonomi Indonesia. Pada waktu yang lalu.Frank J.B. Pembuatan keputusan-keputusan poitik nasional amat didominasi oleh pemerintah dan kesan seperti itu sukar dibantah. f. Sepertinya mendengar kata reformasi. jika kita mengacu ke negeri sendiri yaitu Indonesia. maka ada kecendrungan kita memakai model Incremental. yang menimbulkan dorongan yang kuat pada birokrasi yang cendrung lebih mempertahankan status-Quo daripada reformasi. Menteri Emil Salim berhasil mengadakan reformasi pada organisasi dan tala kerja departemen. maka dapat tercipta sistem tersebut sehingga mampu mendukung demokratisasi politik. punya agenda masing-masing.Frank J. Bila aparatur administrasi mampu mendukung pembangunan nasional.II dan III. 1994 :3).Guy Peters.

menuangkan kebijakan perpajakan ke dalam suatu konsep dalam bentuk perundang-undangan yang ketat. adalah hukum pajak atau hukum fiskal yaitu keseluruhan peraturan yang meliputi wewenang pemerintah untuk mengambil kekayaan seseorang dan menyerahkannya kembali kepada masyarakat melalui Kas Negara. Ketiga unsur tersebut adalah kebijaksanaan. Dari keenam kelemahan yang terjadi pada sistem yang lama.Melalui tulisan ini ada strategi positif yang dapat memperbaiki kelemahan birokrasi menuju demokrasi di Indonesia dengan mengambil contoh yang pemah terjadi di Indonesia yaitu Pelaksanaan Reformasi Perpajakan. termasuk beberapa ©2003 Digitized by USU digital library 9 diantaranya dari jajaran Direktorat Jenderal Pajak. tatacara pemungutan pajak yang berbelit-belit. demi tercapainya keadilan sosial dan kemakmuran yang merata.Kedua pelaksanaan kewajiban perpajakan sangat tergantung pada aparat perpajakan. diperhatikan saling keterkaitan antara tiga unsur pokok pemungutan pajak. Ketiga. Sedangkan administarsi perpajakan adalah cara. Sebagai bahan kajian bahwa dalam perundang-undangan pajak lama terdapat beberapa permasalahan dan sekaligus kelemahan yang perlu disoroti yaitu: ©2003 Digitized by USU digital library 8 Pertama.. maka dalam menyusun sistem yang baru. Direktorat jendral Bea dan Cukai serta Direktorat Jendral Moneter. Pada sistem lama. hukum perpajakan dan administrasi perpajakan. Pada awal tahun 1981. bernegara dan berpemerintahan.. maka para pemikir ekonomi Indonesia pada tahun 1980-1981 sudah mengenal pokok. dibentuk Komite atau Panitia Pengarah dengan mengikutsertakan beberapa pejabat dari jajaran Departemen Keuangan. sehingga menimbulkan kesan membingungkan dan bahkan terdapat pembebanan pajak berganda. dimana yang bertindak sebagai pelaku administrasi pajak di Indonesia adalah Direktorat Jendral Pajak. terdapat bermacam-macam tarif pajak baik untuk perorangan maupun untuk perseroan. Pada dasarnya pemungutan pajak rnerupakan perwujudan atas kewajiban kenegaraan dan partisipasi anggota masyarakat dalam memenuhi keperluan pengelolaan negara dan pembangunan nasional.Keempat. tarif pajak dan prosedur pajak. yang dalam banyak hal. hanya saja situasi dan kondisinya belum memungkinkan. Langkah kedua.Hal yang kedua. keputusankeputusan tersebut menggambarkan pemanfaatan hasil-hasil kegiatan yang sejenis di negara-negara lain. tingginya tariftarif tersebut sehingga menimbulkan rangsangan untuk menghindari pajak mela1ui berbagai cara. Langkah ketiga. Komisi tersebut berfungsi .cara dan prosedur pengenaan serta pemungutan pajak. terdapat berbagai jenis pajak sehingga menimbulkan ketidakjelasan bagi masyarakat dalam memenuhi kewajibannya. Keenam.Keputusan itu dikelompokkan dalam 8 langkah kebijakan sebagai berikut : Langkah pertama. obyek pajak. Dari paparan di muka . Kelima. diarnbil Beberapa keputusan tingkat menteri dalam hal strategi dan teknik untuk pembaharuan perpajakan Indonesia. sasaran perpajakan semata-mata untuk pemerintah penjajah Belanda dengan berkedok pengisian kas negara tetapi nyata-nyata digunakan untuk kepentingan kolonial.. maupun karena menyusun sistem yang barn tidaklah mudah. sehingga menimbulkan kecendrungan masyarakat wajib pajak kurang turut bertanggung jawab dalam memikul beban negara yang pada hakikatnya untuk kepentingannya sendiri dalarn bermasyarakat. para menteri bidang Ekonomi Keuangan dan lndustri (EKUIN) serta beberapa anggota lembaga perekonomian mempertimbangkan bahwa rencana pembaruan perpajakan di Indonesia dengan menggunakan batasan tahunan dan bukan bulanan. Kebijaksanaan perpajakan merupakan pemilihan unsurunsur tertentu dari berbagai alternatif yang didasarkan atas sasaran yang ingin dicapai.pokok dan hasil dari misi-misi pembaruan perpajakan di beberapa negara. tampaklah bahwa sesungguhnya pada masa lalupun telah ada upaya-upaya untuk mengadakan pembaruan sistem perpajakan. baik karena kemungkinan mendapat tantangan dan antipati dari rakyat yang memang telah lama mengalami trauma dan sindrome pajak pada masa penjajahan. peraturan-peraturan pajak yang beraneka ragam. Dalam rangka memecahkan problematik yang terjadi pada waktu itu. Pemilihan unsur-unsur tersebut berkenaan dengan subyek pajak.

pengertian dan pemahaman yang tulus. kebijaksanaan untuk memulai sistem perpajakanan yang baru secara keseluruhan tanpa sedikitpun mengambil bagian-bagian dari sistem yang lama. Meskipun seringkali didengungkan masalah kebersamaan dan demokrasi di dalam organisasi Direktorat Jendral Pajak tapi kenyataannya kekuasaan lebih ditentukan oleh landasan rasional sehingga masalah organisasi harus didahulukan daripada masalah pribadi. . korupsi. dimana kekuatan-kekuatan sosial dan negara mengarahkan birokrasi kesana. Dalam rangka pengkajian masalah pembaruan sistem perpajakan di Indonesia. saran dan juga kritik tajam. Setelah sampai rancangan tersebut ke DPR. menyiapkan latihan dan pendidikan bagi para pejabat perpajakan. 1990 :43.(Salamun A. T. Berdasarkan pengalaman sejarah. secara jujur harus diakui bahwa sebagian besar menekankan pentingnya mental aparatur pajak mendapat perhatian pemerintah. disamping tim pengarah ada lagi tim yang dibentuk oleh Departemen Keuangan. sehingga mampu mendorong birokrasi untuk meningkatkan responsivitas mereka terhadap keinginan rakyat . Ambisi utama daripada sistem birokrasi adalah tercapainya efisiensi kerja yang seoptimal mungkin tapi bukan malah mempolitisikan birokrasi dengan pilihan. selama proses pembahasan di DPR banyak pihak dari berbagai disiplin ilmu. mengenai mana yang benar dan mana yang salah. ini tidak akan jadi persoalan bila birokrasi tetap dipandang sebagai instrumen negara. Keikutsertaan para ahli tersebut baik akademisi maupun para profesional dan pejabat yang berwenang di dalam negeri dimaksudkan untuk memperoleh proses dan pemecahan masalah dalam pengerjaannya. Dari para anggota DPR yang pada umumnya dikenal sebagai tokoh-tokoh masyarakat yang vokal. telah terbukti bahwa usaha birokrasi untuk merekonstruksi demokrasi tidak bisa lepas dari politik publik.45).pilihan kebijakan yang memuaskan klien-klien tertentu.. namun tetap rnemperhatikan berbagai pendapat dari kelompok-kelompok yang ada dalam masyarakat. sehingga kekuasaan kepemimpinan politik mampu membuat birokrasi bertanggung jawab terutama alas dasar kepentingan publik. Langkah keenam. baik kalangan pemerintahan. dan ilmu teknologi komputer dalam pekerjaan studi pembaruan sistem perpajakan di Indonesia. kalangan masyarakat dan berbagai sudut pandang yang memberikan tanggapan. memperluas wawasan pembaharuan sistem perpajakan sehingga mencaku bidang-bidang yang sebelumnya tidak merupakan obyek pajak. Langkah kedelapan. mengawasi dan berperanserta langsung dalam penelitian yang dilakukan oleh tim tenaga ahli asing yang mungkin akan digunakan. telah diundang tenaga ahli dan tokoh-tokoh terkemuka yang sangat berpengalaman dan bereputasi Intemasional dalam bidang perpajakan.mengarahkan. mengharuskan agar usaha persiapan ini dilakukan secara biasa saja tanpa publikasi besar-besaran . Responsive terhadap tuntutan rakyat. sehingga diharapkan timbul kesadaran. menerapkan langsung hasil dari tiap-formulasi tanpa menunggu laporan hasil keseluruhan paketnya. swasta maupun para ilmuwan dari berbagai disiplin ilmu.Bautista dkk. baik dari luar maupun dalam negeri untuk memberikan pengalamannya sekaligus menguji konsep pembaruan sistem perpajakan di Indonesia. Direktorat Jendral Pajak dan Tim dari Luar Departemen Keuangan. 1993 : 119 -140). Langkah keempat. baik itu pendidikan formal maupun pendidikan informal untuk memulai kaderisasi pejabat pajak yang terlatih baik.Carino. Langkah ketujuh. di samping tenaga ahli ekonomi dan hukum. Langkah kelima. Diperlukan juga tenaga-tenaga ahli dalam bidang-bidang lain seperti ahli administrasi perpajakan akuntan. Seperti telah dijelaskan. Dari banyak tanggapan spontan yang muncul pada hari-hari paertama pengajuan RUU ke DPR. juga membuat kebijakan dan mengimplementasikannya berat sebelah (LV . melibatkan ©2003 Digitized by USU digital library 10 kepentingan pribadi di atas kesejahteraan umum. mana yang haq dan mana yang bathil.44.

Dilema yang muncul adalah birokrasi harus professional dan responsive tapi. Di sisi berhadapan birokrat begitu kuat menjaga motif nilai manajer departemen. sepert terwujudnya good governance. eksekutif melalui birokrasinya terbawa tuntutan reformasi administrasi melalui paradigma pasar. DPR. hanya karena adanya keberadaan symbol institusi dari demokrasi. tekanan kekuasaan dan dinamika dibangun sistematis di dalam menjalankan. telah dimanfaatkan oleh kepentingan politik ditengah arus demokratisasi. pada sisi lain otonominya sebenarnya sedang ditekan oleh politisi melalui paradigma baru. Dua hal penting model bureaucratic polity eksis: . yakni DPR. Birokrasi sebenarnya tidak akan bisa netral. Birokrasi dan jebakan politik Orde baru melalui bureaucratic polity. Dugaan bahwa dinamika komplek terpotret melalui bargaining dalam sector public yang memungkunkan terjadi manipulasi dalam pengelolaan sector public. Reformasi politik.ORMASI ADMINISTRASI DAN PARADOKS DEMOKRASI Ini menjelaskan tentang perselingkuhan antara birokrasi dengan elit politik yang semakin inten. Kebijakan yang dirumuskan dianggap sah dan demokratis. karena reformasi administrasi sering direduksi pada tatanan tehnis. Disini demokrasi dikesampingkan. Ini dilakukan untuk menghindari kegagalan implementasi dan kritik keras terhadap birokrasi. Melalui institusi Presiden dan Wakil Presiden dengan Wakil Rakyat. Pada konteks organisasi public.

Birokrasi sebagai komponen dari suatu pemerintah dari pusat sampai dengan daerah politik. Actor inilah komponen yang pertama. para pejabat yang memiliki kewenangan formal. Birokrasi yang selalu dituntut responsif sesungguhnya sedang mengalami tekanan elit politik.tanpa memperdulikan rakyat yang akan terkena dampak langsung. Justru tulisan ini akan menjelaskan adanya kedekatan elit politik dengan birokrasi. Struktur dikotomi dilihat dari sisi struktur formal. Birokrasi melalui aparat negara begitu kuat menjaga nilai manajer yang diinternalisasikan dari nilai politiknya pada kebijakan tersebut. Decision making benarbenar diperankan oleh arena inti proses kompetisi politik yang dibangun diluar birokrasi sesungguhnya. Sehingga yang tersisa di mata rakyat hanyalah kekuasaan dari birokrasi. Proses politik pada tingkat ini bisa sangat kompleks. Dinamika interaksi politik dengan birokrasi pada pemerintahan hasil pemilihan secara lansung. daerah utama untuk kompetisi politik tidak di negara yang besar dan kekuatan tidak dicapai terus memperbaiki bagi banyak gerakan. namun bersifat informal di sekitar presiden. . Adanya dikotomi administrasi dan politik dijelaskan dengan konteks yang spesifik. tiga komponen dinamika politik terkait dengan birokrasi menggejala: komponen political competition. Setiap kebijakan yang dirumuskan dianggap sah dan demokratis oleh DPR yang dianggap simbol institusi dan demokrasi. 1. Tulisan ini tidak menjelaskan jarak antara birokrasi dengan elit politik dalam dinamika administrasi publik di Indonesia. 2. Pada sisi yang lain. Pertautan keduanya terjalin dengan bungkus rapi dibalik mekanisme demokrasi. komponen actor. demokratisasi yang diusung dan diyakini akan membawa perubahan yang besar di Indonesia justru telah memanipulasi sektor publik melalui instrumen reformai administrasi yang sedang populer. Namun. Daripada kekuatan penuh dicapai meluli kompetisi interpersonal di lingkaran elite di fisik yang tertutup dekat presiden.1. 2. bureaucratic polity tidad jauh beda dari bentuk pemerintahan olek derajat untuk decision making nasional daerah kekuatan sosial dan politik keluar pejabat tidak tinggi bagi modal kota.

Sistem pemilu secara langsung yang diterapkan. bahwa pada sisi birokrasi dituntut untuk selalu profesional dan responsif. sehingga kemungkinan adanya bargaining dan cheating ada meski dalam era demokratisasi dan kampanye good-governance. contoh konkritnya dapat dilihat dari Pilkada secara langsung. perubahan dari partai attachment menjadi personal attachment dan terjadinya transformasi kepentingan elit menjadi kepentingan publik sehingga dapat menyebabkan pemerintah lamban dan tidak responsif.Pada konteks organisasi publik.Oleh karena itu. termasuk tekanan global (IMF. World bank). Birokrasi Pemerintahan (Bureaucratic Government) Interaksi politik dan birokrasi terjadi begitu inten dalam dinamika pemerintahan kita. birokrasi ditekan oleh politisi melalui nilai-nilai dari paradigma baru tersebut. Interaksi yang terjadi bukan saja politisi memanfaatkan eksekutif. Dilema yang terjadi adalah. para ekskutif melalui birokrasinya terbawa tuntutan reformasi administrasi seperti terwujudnya good governance. memberikan implikasi pada ricuhnya kebijakan publik. tapi eksekutif dan birokrasinya menghendaki hal tersebut sebagai bagian dari balas jasa kampanye pemilihan presiden langsung dan untuk mengamankan kekuasaannya dan hal . Reformasi birokrasi dimanfaatkan oleh kepentingan politik ditengah arus demokratisasi. Namun disisi lain. Dinamika komplek tersebut terlihat melalui politik bargaining dalam sektor publik yang memungkinkan terjadinya manipulasi dalam pengelolaan publim sektor. setiap kebijakan yang dibuat selalu bias dengan kepentingan politik. Hal tersebut dapat terjadi di pusat maupun daerah (pemilihan kepala daerah secara langsung). Hal ini dilakukan agar terhindar dari kegagalan implementasi dan nilai negatif birokrasi.

pola interaksi tersebut secara teoritis akan menempatkan siapa dimana/dominasi birokrasi ataukah birokrasi sederajat dengan politisi. b.1992:4). ada kemungkinan penyalahgunaan posisi. padahal didalamya terdapat manipulasi kepentingan rakyat yang berarti kepentingan demokrasi. Executive ascendancy seperti bentuk dikotomi politik administrasi yang murni (Carino. yaitu:1. Kategori Functional Village Dari perumusan kebijakan / policy sampai dengan implementasinya / pelaksanaannya semuanya tertata rapi.yang mengakibatkan birokrasi yang awalnya sama akan ada posisi yang lebih tinggi sehingga perlu dikontrol. ada 2 bentuk model. Menurut Carino. Value normatif pada kategori ini adalah value yang memiliki orientasi pada efektivitas dan produktivitas lembaga. Pada sisi yang ekstrim. mereka memetakan interaksi kedunya dalam bentuk tumpang tindih karena internalisasi nilai-nilai demokrasi. . Kategori Village Life Menjelaskan bahwa baik aparat atau elit politik memiliki latar belakang sosial ekonomi.tersebut dianggap hal yang normal. Model birokrasi yang berada pada posisi intermediate ada 2 kategori. tetapi ada cara-cara yang tidak demokratis yang berakibat pada implikasi pemerintahan yang otoriter. Menurut kerangka yang dikembangkan Carino. Posisi ini sama dengan yang pertama. 2. yaitu : a. Bureaucratic sublation of. dan pengalaman yang sama. or co-quality with the executive. kepentingan. sehingga negara yang sedang melakukan konsolidasi demokrasi memungkinkan elit eksekutif memiliki akses dalam memainkan informasi dalam birokrasi. sesungguhnya pemerintahan yang demikian sedang berusaha tampil secara demokratis. sedangkan Peters dan Pierrs (2001:5) memahami pola interaksi politisi dengan birokrasi lebih mendalam (intensitas terinternalisasinya nilainilai demokrasi) dan terkesan overlapping (birokrasi dan politisi).

Model birokrasi yang dibahas disini adalah model Bureaucratic Government. Sedangkan dalam konteks policy analisis. Dalam model ini terjadi kompleksitas politik yang cukup tinggi pada tingkatan organisasi. pemanfaatan konsep melalui Local Governance. Ide ini di kemas dalam konsep yang telah menjadi Political Catchword di seluruh dunia. para pejabat tersebut lebih mementingkan kepentingan golongan atau partainya. Reformasi akan merubah tatanan yang telah ada sebelumnya dengan meredefinisi dan resistensi untuk menuju keberhasialn. daripada kepentingan rakyat. Secara umum konsep ini telah di gunakan karena terkait dengan fokus kapabilitas dari pemeerintah dengan interaksinya dan interaksinya antara pemerintah dengan masyarakat. regulasi. yaitu Governance. nasional. Para elit politik tersebut mendapatkan ruang yang lebih luas dalam wilayah birokrasi. Global Governance juga berkembang melalui level hubungan internasilonal. Reformasi administrasi terjadi melalui tahapan yang kompleks dan melibabtkan banyak kepentingan. Dan yang terkhir adalah dalam konteks interaksi publik dan private. mengapa banyak kebijakan publik di Indonesia sekarang ini memiliki kecenderungan yang mungkin saja berpotensi menyesengsarakan rakyat. Hampir semua pejabat di Indonesia dipilih berdasarkan politik. Sehingga kesannya. dan transnasional. Karena model birokrasi yang seperti itulah.dimana birokrasi negara kita sedang mengalami himpitan permainan elit politik. regional. dan aktivitas operasional antar beberapa institusi. Multi lever mengembangkannya dalam konteks interaksi antara lembaga lokal. di kembangkan melalui konsep tentang governance framework. Sebagai contohnya adalah pemanfaatan konsep oleh IMF dan World Bank dalam rangka good governance. Model ini juga sangat cocok dengan model Birokrasi Indonesia saat ini. Dalam konteks urban politics. governance telah di gunakan untuk penelitian-penelitian tentang peran pemerintah dalam melakukan koordinasi di sektor .

Peluang ini telah terbaca oleh politisi karena memanng organisasi publik sedang mengalami kesulitan untuk menggunakan instrumen baru ini. yakni pada adopsi instrumen administratif tertentu yang kelihatan tehnis. Intervensi Paradigma ini lebih di fokuskan pada konteks reformasi administrasi saja. Ini merupakan permasalahan transfer nilai dari organissai privat ke organisasi publik. Perkembangan ini terkait dengan krisis yang dialami oleh nega5a. Dari awal kebijakan ini memang di kendalikan secara politis. maka politisi lebih leluasa memanfaatkan instrumen responsibilitas untuk kepentingan kekuasaan jangka pendek. Intervensi paradigma ini juga akan mempengaruhi interaksi kekuasaan antara birokrasi yang di lakukan oleh pelatyan publik dengan politisi pada berbagai tahapan. Kenyataan yang seperti ini bisa mengakibatkan kegagalan. yang bisa juga di katakan merupakan gagalnya suatu administrasi negara yang di terapkan dalam konteks global yang terjadi di negara transisi seperti Indonesia ini. Selebihnya. Kasus BBM ini merupakan kebijakn yang sarat dengan tuntutan responsibilitas dari organisasipublik yang mendelivernya dan nilai-nilai kolektif yang lebih luas yang menyangkut masyarakat miskin. tetapi belum sepenuhnya berubah. Dengan kenyataan lemahnya proses reformasi. ada proses perubahan internal organisasi dan juga lingkup eksternal pada suatu negara yang memungkinkan terjadinya reformasi tersebut. namun dalam intervensi global dan demokrasi telah membuka ruang yang lebih besar bagi politisi untuk bermainm dalam wilayah birokrasi ini. Dalam penerapan reformasi administrasi ini seringkali di manfaatkan oleh politisi untuk mengambil keuntungan. Dalam kasus BBm. Sebagai contoh adalah NPM dan kasus BBM. Kenaikan harga BBM yang terus di paksakan dengan berbagai . Komlpeksitas politik pada transisi demokrasi yang belum matang telah memutuskan link yang seharusnya terjadi atau di lakukan.ekonomi. Seharusnya reformasi menghendaki pengelolaan yang sistematis. analisis lebih di fokuskan pada interaksi politik dan birokrasi.

maka ada dua hal yang penting yaitu : reformasi administrasi yang menggunakan beberapa instrumen yang memiliki nilai kontradiktif satu sama lain dalam dirinya sendiri karena nilai dari organisasi publik dan privat yang digeneralisasikan ternyata telah membuka peluang permainan politik. Yang kedua yaitu adanya kenyataan bahwa demokrasi yang diinternalisasikan masih dalam tahapan demokrasi formal. Melihat kenyataan tersebut. Contohnya. Hal ini ditandai dengan banyaknya lobi yang dilakukan eksekutif untuk kepentingan kebijakan. bureaucratic goverment di Indonesia merupakan birokrasi publik yang mengalami kebingungan arah dan ini terjadi di tengah perubahan ke arah demokrasi. Rezim kita sekarang ini telah gagal menentukan kualitas yang tinggi dalam mengelola masalah publik.prosedural yang memberikan ruang pada elit politik untuk memberi instrument pada organisasi publik. Di indonesia antara politisi dan public servant tidak terjadi kerjasama yang baik dalam pemecahan masalah publik yang seharusnya secara demokratis dalam perumusan kebijakan dalam perumusan kebijakan dan responsivitas dalam implementasinya namun disini terjadi penipuan yang dilakukan publik servant dalam pelayanan publik. Padahal rezim seharusnya menentukan peraturan dasar dan kualitas dari interaksi antara bermacam-macam lembaga melalui kebenaran proses kebijakan dan gabungan nilai untuk mengelola masalah publik. Dan lebih di tekankan lagi bahwa proses internalisasi instrument yang lemah akan memberikan peluang yang besar bagi politisi untuk memberikan suatu perfomance dari kebijakan tertentu. Dalam reformasi ini di manfaatkan oleh politisi melalui cara yang tidak demokratis.kasus kenaikan harga BBM yang didukung oleh . Birokrasi kita sekarang ini masih sangat mengecewakan di dalam pelaksanaannya. Sementara akuntabilitas dalam reformasi administrasi merupakan instrumen yang penting.penolakan melalui demonstrasi-demontrasi menunjukan rendahnya akuntabilitas organisasi publik. karena birokrasi tidak siap untuk berubah.

politisi memainkan perannya untuk tidak melakukan perannya untuk tidak melakukan reaksi sama sekali terhadap resistensi yang di berikan oleh publik. serta pasar menjadi bagian stakeholder dalam reformasi administrasi. dan rakyat. Semua ini terungkap ketika negara kita melakukan pemilu secara langsung. Logika tersebut di kembangkan dengan beberapa alasan. keadilan sosial dan pertumbuhan ekonomi. Jadi reformasi itu bukan sekedar masalah tehnis administratif. di mana instrument membawa persamaan politik. Kedua partai tersebut setuju dengan kenaikan BBM karena untuk mempertahankan kekuasaan mereka yaitu demi pertimbangan kadernya yang mendapatkan posisi sebagai menteri. Keempat. adalah reformasi pastilah produk keputusan politik dan bukannya administratif belaka. Dengan demikian birokrasi kita sekarang ini di bawah kontrol politisi. Jadi Reformasi administyrasi akan mempertemukan birokrasi. . Hal ini dapat merugikan reformasi administrasi kita. lanngsung maupun tidak langsung mewarnai nilai kebijakan melalui lembaga presiden atau wakil presiden yang secara langsung berhadapan dengan rakyat. politisi. pertama ide reformasi selalu datang dari kepentingan eksternal dan bahkan global. Seharusnya reformasi administrasi di pahami sebagai sistem administrasi yang lebih efektif untuk perubahan sosial. maka instrumen yang digunakan akan sangat mungkin bernuansa dan di terjemahkan oleh kepentingan elit yakni politik.partai PKS dan PPP padahal dulunya menolak kenaikan BBM. kedua kepentingan global tersebut tidak selamanya berdimensi tunggal. Ketiga. demokrasidan kesejahteraan rakyat miskin. Karena apabila reformasi hanya pada tahapan tehnis. reformasi administrasi yang terbungkus dengan paradigma besar seperti demokratisasi dan globalisasi.

. Hal itu di karenakan adanya pengawasan dan kontrol langsung oleh pemerintah pusat. dulu jika perintah itu tidak di laksanakan maka akan di tindak langsung. Tetapi pada kenyataanya di Indonesia tidak berjalan seperti teorinya. Justru pelayanan publik berjalan ketika demokrasi di singkirkan. Padahal dulu pada jaman pemerintahan Soeharto pelayanan publik lebih baik.Komentar: Indonesia adalah negara yang menganut model pemerintahan Demokrasi. Para pejabat sekarang lebih mementingkan kepentingan pribadi dan golongannya daripada kepentingan publik atau rakyat. model pemerintahan demokrasi adalah model pemerintahan yang bebas mengeluarkan pendapat dan pemerintah mengutamakan suara rakyatnya di banding kepentingan pimpinannya.

Sign up to vote on this title
UsefulNot useful