Demokrasi dan Partisipasi Publik

PendahuluanDewasa ini istilah demokrasi sering muncul di media massa Indonesia menjelang diadakannya pemilihan legilatif maupun kepala daerah (PILKADA). Tidak berbeda dengan pemilihan yang akan terjadi di lingkungan Rukun Tetangga (RT) 02 Rukun Warga (RW) 19 Dukuh Baturan Desa Trihanggo Gamping Sleman. Meskipun dalam skala dan lingkup yang kecil, tapi pesta demokrasi adalah hak dari warga negara untuk menentukan pimpinan di daerahnya yang dianggap layak dan mampu memegang amanat masyarakat. Secara terminologi, istilah demokrasi berasal dari bahasa Yunani kuno yang terdiri dari kata demos yang artinya adalah rakyat dan kratos/cratein yang berarti pemerintahan . Dalam bahasa Inggris, democracy artinya adalah pemerintahan yang berasal dari rakyat. Sehingga apabila makna dari kedua kata tersebut digabungkan maka demokrasi berarti pemerintahan rakyat. Sedangkan secara umum demokrasi didefinisikan sebagai pemerintahan yang berasal dari rakyat, oleh rakyat, dan untuk rakyat. Pemerintahan dari rakyat artinya adalah pemerintah yang memperoleh amanat merupakan anggota masyarakat yang dipilih dan kemudian diberi amanat oleh rakyat. Oleh rakyat artinya adalah pemerintahan yang dibentuk merupakan hasil dari kesepakatan bersama oleh rakyat sehingga daerahnya memiliki struktur pemerintahan sehingga menjadi teratur. Sedangkan untuk rakyat, memiliki arti bahwa pemerintahan yang dibentuk kemudian bekerja untuk mengabdi dan melayani rakyat tersebut sehingga masyarakat menjadi sejahtera. Inti DemokrasiKekuasaan tertinggi dalam demokrasi ada di tangan rakyat. Rakyat memiliki kedaulatan melalui suara yang digunakan dalam pemungutan suara dalam pemilihan umum. Dengan demikian suara rakyat menjadi penentu dalam pengambilan keputusan pada masyarakat tersebut. Pemilu memberikan kesempatan kepada rakyat

untuk memilih pemimpin yang dianggap paling layak dan mampu untuk mengemban amanat. Kemudian pemimpin yang terpilih akan memperoleh mandat dari rakyat untuk mengelola pemerintah melalui lembaga perwakilan rakyat. Lembaga perwakilan berasal dari anggota masyarakat yang bertugas untuk menjaga agar pelaksanaan pemerintahan tidak mengalami pemyimpangan. Lembaga perwakilan merupakan wadah bagi rakyat untuk menyalurkan aspirasi sehingga suara rakyat tersalurkan pada pemerintah. Rakyat juga bisa secara langsung memberikan masukan tidak hanya kepada lembaga perwakilan tetapi juga kepada pemerintah. Tindakan ini disebut dengan partisipasi publik (rakyat). Partisipasi adalah suatu proses dimana sejumlah pelaku bermitra punya pengaruh dan membagi wewenang di dalam prakarsa “pembangunan”, termasuk mengambil keputusan atas sumberdaya . Sedangkan Partisipasi publik secara sederhana diartikan sebagai keikutsertaan dan keterlibatan masyarakat dalam aktivitas kenegaraan. Wujud partisipasi publik bisa beragam, misalnya ikut pemilihan umum (pemilu), membayar pajak, menyampaikan aspirasi, keluhan, mengontrol pemerintah, dan lain-lain. Salah satu contoh nyata dari partisipasi publik adalah keikutsertaan dalam pemilihan umum (pemilu). Istilah lain dari pemilu adalah pesta demokrasi. Disebut demikian karena pemilu merupakan kegiatan besar menyerupai perayaan/pesta dimana rakyat berhak dan menjadi penentu dari perjalanan masyarakatnya. Pemilu pertama kali dilaksanakan pada jama Yunani Kuno untuk memilih anggota senat polis yang memberikan masukan kepada kaisar. Pada jaman tersebut pemilu dilaksanakan secara langsung dengan cara memilih calon anggota senat yang ada. Di samping itu, jumlah penduduk yang memiliki suara dalam suatu polis masih sedikit sehingga pemilihan bisa dilakukan secara langsung. Dewasa ini, jumlah rakyat di suatu negara sangatlah besar sehingga pemilihan secara langsung sering kali memakan waktu sehingga

Ketika memilih seorang pemimpin berarti merelakan hak tersebut dilakukan oleh orang lain. Ketika seseorang memilih calon pemimpin. Demikian halnya dengan rencana pemilihan Ketua RT 02 ini. DPRD. Gubernur. Rakyat memiliki kedaulatan melalui suaranya untuk memilih dan menentukan pemimpin yang paling dipercaya untuk mengemban amanat. Presiden. Rakyat memilih anggota lembaga perwakilan dan lembaga perwakilanlah yang memilih kepada negara tersebut. Bupati/Walikota. Pemimpin adalah individu yang diberi amanat untuk menjalankan pemerintahan.dikenal pemilihan tidak langsung. Amanat dan kekuasaan yang dimiliki oleh pemimpin adalah pemberian rakyat dan bersifat sementara dan bisa dicabut. Hal ini juga berlaku kepada calon Ketua RT yang akan dipilih. Namun demikian hak tersebut tidak diserahkan hanya dipinjamkan dalam bentuk amanat dan rakyat bisa meminta kembali bahkan mencabut amanat/hak dipinjamkan kepada pemimpinnya apabila dianggap gagal atau melakukan penyimpangan. Oleh karena itu seorang pemimpin harus bertanggung jawab kepada rakyatnya dan menjalankan tugasnya untuk melayani rakyat. Pemilihan Presiden. DPR. Kepemimpinan dalam MasyarakatPemimpin adalah individu yang bertugas sebagai kepala pemerintahan. dan kepala desa adalah pemimpin. dan Kepala Desa dilakukan secara langsung. Kepala pemerintahan memiliki tugas untuk mengatur tatanan kehidupan masyarakat sehingga berjalan . yang bersangkutan sebenarnya sama saja dengan mendelegasikan hak untuk menjadi pemimpin dan mengelola daerahnya karena setiap individu memiliki hak yang sama. Mengingat setiap individu memiliki hak yang sama untuk memimpin. Bupati. Namun hal ini mendapat banyak kritik karena lembaga perwakilan seringkali tidak mewakili aspirasi dari rakyatnya sehingga pemilihan langsung tetap digunakan untuk memilih pemimpin masyarakat. Walikota.

pemimpin haruslah memiliki visi yang baik sehingga masyarakat yang dipimpinnya memiliki tujuan. Setiap individu dalam masyarakat memiliki kepentingan yang berbeda-beda. Masyarakat juga harus mematuhi ketentuan pemerintah yang bertujuan untuk kemakmuran masyarakatnya sehingga resiko terjadi konflik dapat dikendalikan. Meskipun tidak memimpin sendiri. . Seorang pemimpin harus menjadi wakil masyarakatnya dalam berhubungan dengan masyarakat yang lain. Kekuasaan yang dimiliki merupakan tanggung jawab yang berasal dari masyarakat. Keseluruhan tugas yang dimiliki oleh pemimpin adalah amanat dari masyarakatnya. Masyarakat juga harus secara aktif melakukan pengawasan terkait pemanfaatan sumber daya daerahnya karena kekayaan daerah pada hakikatnya adalah milik masyarakat dan dipungut dari masyarakat oleh pemerintah meskipun pengelolaan diserahkan pada pemerintahan setempat. Sumber daya tersebut harus dikelola dan dialokasikan secara tepat sehingga sasaran yang dituju mengena dan tidak terjadi pemborosan. Pemimpin harus memiliki pengetahun dan wawasan yang luas sehingga mampu mewakili masyarakatnya untuk berkomunikasi dengan pihak lain. Masyarakat dengan sukarela telah menyerahkan haknya menjadi pemimpin untuk dipimpin oleh orang lain. Pemimpin dalam hal ini harus mengakomodasi kepentingan rakyat banyak sehingga pemenuhan atas kebutuhan yang menjadi hajat hidup orang banyak harus didahulukan. Masyarakat dalam menjalankan kehidupannya juga berhubungan dan berdampingan dengan masyarakat lain. tapi dibantu oleh perangkat organisasi lain. Pemenuhan kebutuhan membutuhkan sumber daya yang dimiliki oleh daerah tersebut.dengan baik. Perbedaan kepentingan memungkinkan terjadinya benturan antar anggota masyarakat dan berakibat pada timbulnya perselisihan. Komunikasi yang baik harus berjalan sehingga menciptakan kedamaian antar wilayah.

Ini adalah wujud dari akuntabilitas pemimpin kepada warganya. Akuntabilitas adalah kewajiban untuk menyampaikan pertanggungjawaban atau untuk menjawab dan menerangkan kinerja dan tindakan seseorang/badan hukum/pimpinan kolektif suatu organisasi dalam penggunaan sumber daya yang ada. Hati nurani yang baik seharusnya bisa mengantarkan pemilihan pada seorang pemimpin yang terbaik di mata masyarakat. Oleh karena itu diperlukan kriteria pemimpin yang ideal. Terdapat beberapa kriteria untuk memilih pemimpin ideal. dan apa saja yang telah dicapai dengan penggunaan wewenang dan sumberdaya tersebut kepada pihak yang memiliki hak atau kewenangan untuk meminta keterangan atau pertanggungjawaban . 2) Transparan (terpercaya): pengelolaan sumber daya bisa diketahui oleh masyarakat. 3) Partisipasif: melibatkan masyarakat dalam musyawarah. Keterlibatan warga sangat . Dengan demikian masyarakat sebagai pihak yang memiliki sumber daya dan melimpahkannya pada pemimpin akan menilai keberhasilan pelaksanaan tugas yang diamanatkan.Oleh karena itu. Tugas masyarakat setelah seorang pemimpin berhasil dipilih adalah mematuhi dan menjalankan kebijakan serta peraturan yang dibuat untuk kepentingan masyarakat. Masyarakat berhak untuk memilih pemimpin sesuai dengan hati nurani yang dimiliki. calon pemimpin diharapkan bisa mengemban tugas yang akan diletakkan di pundaknya. Setiap warga juga wajib untuk melibatkan diri dalam berbagai kegiatan yang diselenggarakan oleh organisasi masyarakat di lingkungannya. yaitu: 1) Terbuka (jujur): bisa berkomunikasi dengan semua pihak. dan 4) Akuntabel (bertanggung jawab): menjalankan kegiatan yang bermanfaat untuk masyarakat. seorang pemimpin harus mempertanggungjawabkan tugasnya kembali kepada masyarakat. Hal ini bertujuan agar tugas-tugas yang dibebankan pada seorang pemimpin bisa berjalan dan berhasil. Dengan kriteria tersebut.

Yang bersangkutan harus legawa dan siap menjalankan tugas. dan mengawasi ketua baru demi RT 02 semakin maju di masa datang. Sedangkan warga yang lain harus menerima. Selanjutnya. membantu. . Dengan demikian kegiatan yang dilaksanakan benar-benar dibutuhkan dan mampu dirasakan manfaatnya secara luas. Dengan demikian semua orang yang menjadi warga di lingkungan tersebut memiliki hak yang sama. setiap individu harus siap menjadi ketua apabila dipilih oleh warga yang lain. warga juga harus berpartisipasi secara aktif dalam melakukan pengawasan dan kontrol atas kegiatan yang diselenggarakan di wilayahnya. mematuhi. oleh warga. PenutupPemilihan Ketua RT 02 di Padukuhan Baturan merupakan kegiatan dari warga. Oleh karena itu. Hak tersebut adalah untuk memilih dan dipilih menjadi Ketua RT berdasarkan kriteria yang telah disepakati. dan untuk warga.penting dan tidak hanya pada pelaksanaannya tapi juga dalam perencanaan kegiatan. Ini adalah wujud dari tanggung jawab moral warga terhadap pemimpin yang dipilihnya.

Sedangkan menurut kamus bahasa Jerman edisi 1813. boleh dikatakan artinya canggung.Levine.982: 241). kaku. Oleh karena itu lebih baik dijelaskan terlebih dahulu apa birokrasi dan demokrasi itu Bagaimana kontribusinya terhadap demokrasi Bagaimana posisi birokrasi dengan demokrasi melalui rekonstruksi bagaimana situasi problematik yang terjadi di Indonesia dan strategi seperti apa yang dapat diterapkan di Indonesia sehingga antara birokrasi dan demokrasi bisa direkonstruksi. karena organisasi birokrasi punya struktur yang jelas tentang kekuasaan clan orang yang punya kekuasaan mempunyai pengaruh sehingga dapat memberi perintah untuk mendistribusikan tugas kepada orang lain (Robert Denhard.Levine. Masyarakat didominasi oleh para birokrat. lisensi dalam perekonomian dan masalah-masalah profesional.HUBUNGAN BIROKRASI DENGAN DEMOKRASI Dra. dan tidak ada pemisahan yang tajam antara kelompok manajerial clan pejabat politik (Martin Albrow. tidak imaginatif. karir yang panjang. birokrasi kadang-kadang digunakan dalam suatu hal yang diremehkan.usaha paling penting berupa implementasi Undang-Undang. dan para administrator pemerintah yang tidak efisien (Herbert M. prosedur yang panjang dan memakan waktu yang lama. Hal ini akan menjadi lebih transparan apabila kita memantau birokrasi yang berhubungan atau berurusan dengan organisasi formal. 1989 : 100) Berdasarkan tulisan tersebut James memberi persamaan antara . Cita-cita utama dari sistem birokrasi adalah mencapai efisiensi kerja yang seoptimal mungkin. persiapan proposal legislatif. kemajuan dan perkembangan suatu sistem politik khususnya memperkecil ruang gerak demokrasi. pokoknya selalu mendapat “tanda” negatif dari pendengarnya. Ciri organisasi yang mengikuti sistem birokrasi ini ciri.Si Jurusan Ilmu Adminisrasi Negara Fakultas Ilmu Sosial dan Ilmu Politik Universitas Sumatera Utara Berbicara tentang birokrasi sering kali kita asumsikan dengan urusan yang berbelitbelit. negeri maupun swasta. DARA AISYAH.” Birokrasi sebagai suatu sistem organisasi formal dimunculkan pertama sekali oleh Max Weber pada tahun 1947. orientasi impersonal. Tulisan ini mencoba menjabarkan birokrasi berkaitan dengan demokrasi dan melihat posisi itu melalui Rekonstruksi. Menurut Herbert M. 1982 : 240). dan membagi pelayanan kesejahteraan (Herbert M. kekuasaan hirarkis. peraturan-peraturan. menurutnya birokrasi merupakan tipe ideal bagi semua organisasi formal.pengaruh dan para kepala dan star biro pemerintahan. Menurut Weber organisasi birokrasi dapat digunakan sebagai pendekatan efektif untuk mengontrol pekerjaan manusia sehingga sampai pada sasarannya. birokrasi di definisikan sebagai:"wewenang atau kekuasaan dari berbagai departemen pemerintahan.32). Pembahasan birokrasi selalu menarik untuk dibicarakan baik sebagai bahan diskusi maupun sebagai bahan kajian ilmiah untuk diperdebatkan dengan tujuan mencari solusinya. Apalagi topik yang akan dikaji ada hubungannya dengan demokrasi sehingga memerlukan suatu pemikiran yang serius untuk menelaah dan menilai akibat-akibat yang terjadi dan yang ditimbulkan oleh aksi birokrat dalam konteks demokrasi yang perlu diperbaiki. ditulis oleh James Burnham tahun 1941 yang menekankan pentingnya kelompok manajerial di dalam perekonomian.Levine. Konsep Birokrasi Dalam kamus Akademi Perancis tahun 1798. diantaranya usaha. M. Organissasi mengopcrasikan prinsip-prinsip dasar hirarki kantor dimana ada garis-garis yang jelas dari atasan dan bawahan. islam maupun non islam. Birokrasi diartikan :"kekuasaan. dan efisiensi.cirinya adalah pembagian kerja dan spesialisasi. peraturan ekonomi. Birokrasi memainkan peranan aktif di dalam proses politik di kebanyakan negara dan birokrasi menggunakan banyak aktifitas-aktifitas. ©2003 Digitized by USU digital library 11984 : 26. Namun apakah sudah menjadi hal yang sulit direform bahwa birokrasi selalu menghambat kemudahan. 1. a.

maka untuk kasus negara berkembang seperti Indonesia demokrasi yang muncul sangat bergantung kepada perilaku elit politik dan struktur budaya. definisi yang paling singkat tentang demokrasi adalah apa yang diucapkan oleh Abraham Lincoln di Gettysburg. Kalau kita amati model demokrasi David Held diatas. 6. menurut bahasa Yunani. Kata demokrasi berasal dari bahasa Yunani. masyarakat secara perseorangan harus terlibat dalam pembuatan keputusan yang penting dalam arti memutuskan hukum-hukum publik dan masalah. dimana ada kontrol yang efektif. 4. Basis kultural dalam pemerintahan Orde Baru di Indonesia itu dapat dilihat dari bagaimana hubungan antara elit politik dengan warga negara sebagai hubungan antara kawulo dan gusti. 3. (prisma No. 5. Demokrasi berarti liberte. maupun nilai masyarakatnya sendiri dalam memaksimalkan upaya yang ada menuju iklim demokratisasi yang diidam-idamkan. masyarakat harus memerintah dalam arti semua harus terlibat dalam membuat undang-undang. ©2003 Digitized by USU digital library 2 2. fraternite. Huntington. untuk rakyat Esensi dari demokrasi adalah bahwa rakyat memerintah atau melakukan pemerintahan oleh dirinya (government by the people) (majalah Koridor. karena adanya perubahan sikap dari masyarakat akan bergantung kepada pengaruh para birokrat. c. 1992 : 32). para penguasa berkewajiban untuk mempertanggungjawabkan tindakantindakannya kepada masyarakat .masalah kebijaksanaan umum. mencakup aplikasi kriteria evaluatif dan spesifikasi sifat . oleh warga negara terhadap kebijakan pemerintah. demokrasi magandung dua dimensi kontes dan partisipasi yang menurut Robert Dahl merupakan hal menentukan bagi demokrasi. yang dibutuhkan bagi perdebatan politik dan pelaksanaan kampanye-kampanye pemilihan itu (Samuel P. egalite. Arnerika Serikat tahun 1863 yaitu pemerintahan dari rakyat. 1995 : 6).4).4 tahun XXI. parapenguasadipilihmelaluirepresentatif/perwakilandarimasyarakatdan 7. Demokrasi yang dapat menghambat nilai-nilai kultural menurut seorang Indonesianist Benedict R. Usaha demokratisasi masih memerlukan rentang waktu yang cukup panjang bagi lembaga-lembaga politik. Masyarakat yang dibentuk dan diperintah oleh para birokrat akan menjadi masyarakat -masyarakat birokratis yang nantinya masyarakat tersebut akan menjadi birokrasi-birokrasi masyarakat yang patuh dan tunduk pada pengaruh sikap-sikap dan nilai-nilai para birokrat. berkumpul dan berorganisasi. khususnya dalam cara pandang terhadap pembangunan politik. oleh rakyat. parapenguasaharusdipiliholehmasyarakat. maka masalah birokrasi dan demokrasi tidak akan pernah berhenti. 1994: 3. Demokrasi juga mengimplikasikan adanya kebebasan sipil dan politik yaitu kebebasan berbicara. menerbitkan. David Held menyatakan ada 7 prinsip utama penyelenggaraan negara berdasarkan demokrasi yaitu: 1. rezim yang memerintah. ekonomi dan ideologi yang menjadi anutan.O'G Anderson yaitu prinsip ajaran demokrasi pandangan Jawa yang sangat mempengaruhi sistem politik dan proses demokratisasi Indonesia. Hal ini akan cepat menjerat masyarakat akan runtuhya nilai-nilai demokrasi sehingga ada suatu pertentangan dengan nilainilai tersebut yang dianggap sebagai suatu problema yang memerlukan pemecahan. Pensylvania. memutuskan kebijaksanaan umum dan melaksanakan hukum dan administrasi pemerintahan.kekuasaan kelas para manajer dengan kelas para birokrasi negara. b. Selama masih ada tipe-tipe pejabat negara dan seperangkat nilai yang dianggap sebagai bagian inheren dalam demokrasi yang sebenamya. antara kekuasaan di kalangan "wong ghede dan wong cilik”. Cara pandang tentang demokrasi dari waktu ke waktu mengalami perkembangan sejalan dengan semakin kompleksnya hubungan antar warga. Konsep Demokrasi Pada tulisan ini perhatian kita tertuju pada masalah birokrasi dan hubungannya dengan demokrasi. Kontribusi birokrasi dengan Demokrasi Kebanyakan orang menganggap bahwa konsep birokrasi sebagai administrasi yang tidak efisien dan rasional. parapenguasaharusbertanggungjawabkepadaperwakilandarimasyarakat. para penguasa harus bertindak sesuai dengan kepentingan masyarakat.

untuk itu perlu dilihat bagaimana masing-masing karakteristik antara birokrasi dan demokrasi digunakan dalam usaha mendiagnosis dan menyembuhkan masalah yang terjadi. dalam jurnal Bestari.1989 : 1 07). dan kelompok kepentingan semuanya lemah dan tidak mampu melakukan kontrol terhadap birokrasi. lembaga–lembaga politik lainnya. Konsep birokrasi cendrung dianggap sebagai suatu aspek ancaman terhadap demokrasi. seperti parlamenter. januari-april 1995 : 27. proses parkinsonisasi yaitu proses dimana birokrasi cendrung menuju kedalam keadaan patologis sebagaimana pernah diduga kuat oleh C. yaitu 1. 2. apalagi konsep birokrasi sebagai kekuasaan yang dijalankan oleh pejabat. ©2003 Digitized by USU digital library 3 Problema yang harus dipecahkan untuk dapat menumbuh kembangkan demokrasi dengan menempatkan birokrasi secara konsisten di dalam sistem politik. karena mereka percaya bahwa bukan kekuasaan yang dijalankan pejabat yang menimbulkan masalah tetap cara menggunakan kekuasaan itulah yang menjadi masalahnya.X tertanggal 3 November 1945. yaitu pertama proses weberisasi.28 ).Northcote Parkinson Ketiga. Dalam sistem politik demokrasi liberal yang berawal dari Maklumat Wakil Presiden No. pejabatbenar-benarmernilikikekuasaandantugasyangsemakinbesarsehingga jabatan tersebut harus dijalankan secara bijaksana . lembagapolitikyangdominanadalahaparatbirokrasi 2.terutama pembangunan yang mampu mengantisipasi dan menahan gejolak-gejolak eksternal sehingga bisa mencapai tingkat pertumbuhan yang memadai. yaitu kecendrungan birokrasi semakin menguasai masyarakat. konsepkapitalismebirokratikyangdirumuskanolehWittfogel(1957). sedangkan parameter birokrasi “ sehat “ yang dijadikan sandaran adalah konsep birokrasi weber . Menurut teori. di Indonesia terlebih dahulu didekatkan melalui 2 konsep yaitu : 1. konsep masyarakat politik birokratik yang dikembangkan pertama sekali oleh Fred Riggs (1966) dan digunakan oleh Karl D. menciptakan suatu sosok sistem politik bureau-nomia (Moeljarto Tjokrowinoto. konsep ini diamati secara serius karena mendiskusikan tentang pejabat-pejabat negara yang menjalankan tujuan-tujuan demokrasi. Friedrich dan Finer prihatin terhadap masalah kesesuaian praktek-praktek administrasi negara modem dengan nilai-nilai demokrasi.Kedua. kekuaasaan perlu bagi para pejabat sehingga harus dicari metode-metode pelayanan yang dapat disalurkan bersama-sama. dimana politik yang ikut menentukan sosok administrasi pemerintah pada waktu itu. yang dapat mendistribusikan secara merata hasil dari perjuangan masyarakat tersebut. 2.Muhadjir Darwin yang menyimpulkan bahwa birokrasi di Indonesia sedang “sakit” dengan titik tekanannya berdasarkan hukum Parkinson. pejabat menuntut kekuasaan terlalu besar dan perlu dikembalikan pada fungsinya semula.(Muhadjir Effendy. 3.Jackson (1978) dalam konteks Indonesia. Bertitik tolak dari ciri-ciri tersebut maka dapat kita simpulkan bahwa birokrasi di Indonesia cendrung mendekati ke tiga ciri tersebut. Menurut analisa Dr. Ada tiga kecendrungan yang dialami oleh setiap birokrasi.nilai-nilai tersebut (Martin Albrow. untuk birokrasi di Indonesia agaknya cendrung ke arah parkinsonisasi dan orwelisasi ketimbang ke arah weberisasi. Posisi infrastruktur politlk vis-a-vis suprastruktur politik secara relatif lebih kuat. partai politik. 3. agar dapat memahami birokratisasi dalam pembangunan nasional. proses orwelisasi. sehingga perlu dipertanyakan kemampuan masyarakat politik birokratik ini untuk melaksanakan pembangunan . yaitu suatu proses dimana suatu biroksasisemakin mendekati tipe ideal sebagaimana dikemukakan oleh Max Weber. 1996: 159). Berdasarkan konsep Jackson tersebut maka ciri-ciri pokok masyarakat politik birokratik adalah : 1. masa diluar birokrasi secara politis dan ekonomis pasif. Perlu dipertanyakan apakah tindakan tergantung pada bagaimana nilainilai demokrasl Itu ditafsirkan dan mana diantara penafsiran itu yang dipandang salah. sehingga menyebabkan lemahnya peranan partai politik dan dampaknya semakin memperkuat peranan birokrasi. Martin Albrow membedakan tiga posisi dasar tentang fungsi-fungsi pejabat di negara demokrasi. terwujud konfirmasi.

Bila kita lihat contoh di Indonesia.1987: 202. untuk dapat berfungsi. yaitu : tuntutan dari rnasyarakat sehingga membuat birokrasi menjadi lebih besar peranannya. setidak-tidaknya masyarakat harus memberikan pengertiannya karena pada kenyataannya jumlah polisi tidak cukup banyak di dalam melakukan kontrol atas penerapan hukum. Keberadaan birokrasi-birokrasi semacam itu tidak merusak nilai. 3. sehingga ada kesan terpaksa untuk memenuhi kewajiban perpajakan.. adanya tuntutan negara semakin berkembang terus. ©2003 Digitized by USU digital library 4 d. dorongan yang bersifat sosial.Blau. Apabila kita menunggu sampai suasana itu benar-benar terjadi. inilah yang disebut antitesis demokrasi.Dampak Kekuasaan Birokrasi Terhadap Kondisi Demokrasi kekuasaan birokrasi menimbulkan pertanyaan yang menyebabkan para ilmuan mulai berpikir. bahwa masyarakat wajib pajaknya sudah lelah dengan seabrek peraturan yang harus dipatuhi. Bila pemerintah harus memaksa kepatuhan yang sepenuhnya.Kepatuhan tanpa syarat pada hakikatnya menghindari kritik dan ketidaksepakatan yang menjadi inti demokrasi (Peter M. sehingga sulit untuk mencapai tahap masyarakat yang "marginal detterence". kerelaan yang pertama-tama bersifat pasif pada akhimya membangkitkan rasa ketidakberdayaan. Jika birokrasi berlebihan maka masyarakat dirugikan karena masyarakat punya otonomi yang terbatas. 2. Adil dan perlakuan yang sama bagi seluruh penduduk ternyata membutuhkan seperangkat hukum yang kompleks da peraturan-peraturan administratif. Ibarat seorang pencuri bertobat untuk tidak akan mengulangi perbuatannya karena dia takut kepada Allah (sadar bahwa mencuri itu perbuatan dosa).tetapi pada kenyataanya selalu menimbulkan masalah. daripada takut karena adanya ganjaran hukuman yang menantinya..ciri organisasi yang diharapkan terlalu ideal sehingga kadang kala belum tentu cocok dengan kondisi atau situasi di suatu negara. dan W. Birokrasi sulit untuk direm karena ada dorongan dari dalam (birokrat itu sendiri) ataupun dari luar seperti : 1. doronganekonomi. yakni dengan memantapkan organisasi-organisasi sifatnya yang lebih birokratis daripada berupa pengaturan secara demokratis. dorongan politik. ada pandangan bahwa negara ©2003 Digitized by USU digital library 5 sebagai penggerak pembanggunanan nasional dan negara diasumsikan sebagai fungsi yang strategis.nilai demokrasi. tentu saja birokrasi dapat memerintah masyarakat tanpa Menimbulkan perlawanan mereka Namun sebagaimana kita juga pemah belajar dari masa lampau. Hal ini kemudian dicetuskan dalam bentuk protes yang mengacaukan suasana.203). baik juga untuk rnasyarakat. Dalam jangka pendek. dan sulit menciptakan masyarakat yang sadar pajak dalam sistem yang diterapkan untuk meningkatkan penerimaan negara. kalau mentalnya masih mental pencuri. Sedikit kepatuhan sudah merupakan suatu kondisi bagi demokrasi. yaitu pemberian tanggungjawab pada negara untuk melakukan sesuatu pada masyarakat. yang meminta negara untuk menyelesaikannya dan meminta negara melayani hal tersebut sebagai contoh yaitu negara yang demokratis. karena freewill terbatas untuk masyarakat. Marshall. karena ciri. dengan demikian keadaan menjadi sulit bila masyarakat cendrung tidak mematuhi hukum. tetapi juga bahwa tujuan-tujuan tadi diterapkan melalui metode-metode efektif yang ada. Demokrasi dan birokrasi sesungguhnya sangat diperlukan dalam proses pembangunan suatu negara .Meyer . Pada dasamya masyarakat lebih menginginkan terciptanya kesadaran daripada kepatuhan. Nilai-nilai demokratis tidak saja berarti tujuan-tujuan masyarakat yang ditentukan oleh keputusan mayoritas. Gejala tumbuhnya birokrasi yang terlarnpau kuat diungkapkan oleh Fred W Rigg ketika ia rnelakukan penelitiam modernisasi di Thailand yang kemudian muncul . hal ini berarti mengurangi demokrasi. karena belum tentu yang dilakukan birokrat baik.. akan tetapi semakin kuat birokrasi dalam negara maka akan semakin rendah demokrasi dan sebaliknya semakin lemah birokrasi maka akan semakin tinggi demokrasi.

Sementara demokrasi merupakan keinginan dari sebagian besar rnasyarakat untuk rnendapatkan keberdayaan sehingga proses tawar menawar antara state dan sipil society dapat berkembang dengan baik khususnya dalam kerangka pengembalian keputusan politik sebagaimana prinsip-prinsip dasar dari demokrasi itu sendiri. berkolaborasi dengan kekuasaan pemerintah. Studi Fred W Rigg tentang Bureaucratic Polity dan GuelermO'Donnel tentang Bureaucratic Authoritarian nampaknya menggarisbawahi bahwa dalam masyarakat tertentu posisi birokrasi sudah berada di bawah kontrol politik kekuasaan dalam rangka mendapatkan sumber legitimasi politik melalui sarana birokrasi. hat ini menandakan bahwa birokrasi bukan pemerintahan rakyat tetapi mengembalikan peran negara sebagai arbiter (perantara). Otoritarian Birokratik memang diciptakan untuk melakukan pengawasan yang kuat terhadap masyarakat sipil.Pye. maka model O'Donnell birokrasi itu tidak hanya berkolaborasi dengan kekuasan tetapi juga melibatkan diri hampir di semua bidang kegiatan. AIPI LIPI Jakarta 1991: 68). adanya kesadaran para aktor dalam birokrasi sehingga mengambil nilai tertentu yang siap dimaksimalkan pemerintah. dalam Karl D. merupakan kebijakan yang mencari tujuan yang pasti. Model Incremental. 1990 : 82) . apa yang menjadi tantangan masa depan. Model Garbage Can. Berdasarkan studi Guelermo O'Donnel bahwa negara telah muncul sebagai kekuatan politik yang tidak hanya relatif mandiri berhadapan dengan faksi-faksi elit pendukungnya serta masyaraklu sipil. Proses kebijakannnya sering kali tidak dimulai dari titik nol karena selalu dimulai dengan kebijakan yang ada sehingga standard operating procedurenya terlalu kuat.8. Jika dalam studi Rigg birokrasi. menurut model ini hasil pembuatan keputusan secara kebetulan dipengaruhi 4 komponen yaitu : para partisipan. Synoptic Model. solusi. Birokrasi merupakan salah satu sarana bagi kekuasaan negara untuk memperkuat posisi politik dan merupakan sumber legitirnasi politiknya. Dalam hal ini birokrasi tidak hanya penerima kebijakan dari pejabat-pejabat politik. terutama dalam upaya mencegah massa rakyat di bawah keterlibatan politik yang terlampau aktif agar proses akselerasi industrialisasi tidak tergangggu (Guelermo O'Donnel dalam Muhammad AS Hikam. contohnya : kebijakan pengentasan kemiskinan. akan tetapi keduanya justru menunjukkan tingkat perbedaan yang mendasar dan kalaupun memungkinkan dapat dipertemukan satu sama lain melalui rekonstruksi antara keduanya. birokrasi dan demokrasi sangat diperlukan dalam kegiatan negara dan masyarakat.Para aktor politik bisa menilai konsekuensi-konsekuensi positif dan negatif. 1987:4). tetapi ia telah menjadi kekuatan dominan yang marnpu mengatasi keduanya. 3. yang menempatkan birokrasi melalui pemasukan nilai budaya masyarakat yang dominan sebagai suatu kekuatan tersendiri dalam mempengaruhi sistem politik dan perilaku politik elit kekuasaan (Karl D. e. Allison mendeskripsikan 4 model kebijakan yaitu : 1.Jackson untuk studinya tentang birokrasi di Indonesia. tetapi turut melakukan kebijakan berupa tindakan membela si miskin sebagai suatu pertanda merekonstruksi demokrasi. namun menjalar sampai kepada kegiatan ekonomi sosial budaya termasuk juga ideologi. dalam konsep yang sama Karl D. Frank J. ©2003 Digitized by USU digital library 6 Modal kebijakan merupakan pendekatan yang akan dipakai dalam merekonstruksi birokrasi dan demokrasi.Jackson dan Lucian W.jackson. B.Rekonstruksi Birokrasi dan Demokrasi Melalui Beberapa Pendekatan. Pendekatan ini sering juga disebut organisasi anarki. masalah-masalah dan kesempatan untuk memilih (Charles . apa perlu kebijakan direvisi atau direform. Birokrasi dan Demokrasi melalui penjelasan tersebut ibarat dua sisi dari mata uang yang sama. 2. Jurnal IImu Politik No.Guy Peters. Thompson.dengan konsep "Bureaucratic Polity" yang menggambarkan betapa birokrasi di Thailand telah memasuki suatu jaringan kehidupan politik dan ekonomi yang sangat kuat yang dilakukan oleh negara terhadap kehidupan masyarakat. akan tetapi hubungan antara tujuan dan kebijakan-kebijakan utama tidak selalu jelas. Keterlibatan negara tidak hanya dalam bidang poitik formal. merupakan kebijakan yang dimulai dengan melihat kebijakan yang ada. merupakan model yang ideal dengan melihat proses kebijakan sebagai suatu proses yang sangat rasional dimana policy maker atau aktor-aktor yang terlibat dalam proses kebijakan dianggap memiliki persepsi yang jelas tentang tujuan yang akan dicapai (Charles H Levine.

kuatnya dominasi ekonomi perencanaan pembangunan nasional. terutama melalui pengaruh jalur-jalur A dan B di Golkar. dalam orasi ilmiah yang disampaikan pada kuliah perdana program MAP UNT AG.Thompson. Bila aparatur administrasi mampu mendukung pembangunan nasional. maka dapat tercipta sistem tersebut sehingga mampu mendukung demokratisasi politik.Levine. Reformasi administrasi perlu dilancarkan sebagai bagian dari pembangunan politik. punya agenda masing-masing. merupakan proses pengambilan keputusan dalam melibatkan banyak aktor/kelompok-kelompok kepcntingan yang masing-masing punya nilai atau kepentingan sendiri. merupakan bagian yang tidak dapat terpisahkan dari upaya mencari wilayah dinamika dari studi pembangunan politik yang akan meningkatkan kehidupan politik ideal yang demokratis. Padahal seharusnya birokrasi bekerja untuk rakyat. yang menimbulkan dorongan yang kuat pada birokrasi yang cendrung lebih mempertahankan status-Quo daripada reformasi. Posisi saling berhadapan antara birokrasi yang mewakili lembaga negara dengan civil society yang berada pada posisi masyarakat. Strategi Birokrasi yang Diterapkan Di Indonesia melalui Contoh kasus Reformasi Perpajakan. Kurang berhasilnya reformasi administrasi di Indonesia selama kurun waktu PJPT-1 ini nampaknya dipengaruhi paling tidak oleh 2 faktor : 1. telah menimbulkan politisasi birokrasi yang berlebihan. Model Birokratik Politik. Problema birokrasi yang melanda negara Indonesia dengan adanya pelaksanaan peraturan dan juga yang semakin banyak. .84) 4. 1994 :3). 2. ©2003 Digitized by USU digital library 7 Sumarlin dan Saleh Affif ketika beliau-beliau tersebut menjadi Menteri Penertiban Aparatur Negara pada Kabinet Pembangunan I. jika kita mengacu ke negeri sendiri yaitu Indonesia. 1990 :83. dan Menteri Saleh Affif mengadakan reformasi untuk menggairahkan kegiatan ekonorni melalui serangkaian kebijakan deregulasi. Thompson. Situasi Problematis yang teriadi di Indonesia.1990: 84).B. aliansi yang kuat antara birokrasi dan organisasi politik. Menteri Emil Salim berhasil mengadakan reformasi pada organisasi dan tala kerja departemen.H. Sepertinya mendengar kata reformasi. Pada waktu yang lalu. liberalisasi dan industrialisasi ekonomi Indonesia.Guy Peters.(Charles H. para birokrat agak alergi karena daya inovasi kaum birokrat dipengaruhi oleh advokasi dari para pimpinan politik yang harus diyakini melalui reformasi tersebut. Berdasarkan beberapa model yang ditawarkan. beberapa teknokrat dalam birokrasi mencoba mengadakan upaya-upaya reformasi .evine. belum nampak adanya minat yang cukup besar dikalangan para pimpinan organisasi politik mengenai reformasi administrasi. Reformasi tersebut dapat dilaksanakan walaupun pada kurun waktu tersebut birokrasi Indonesia secara umum masih konservatif dan belum terbuka terhadap perubahan. sehingga reformasi administrasi tidak pernah menjadi fokus perhatian tetapi hanya sebagai pendukung pembangunan ekonomi . maka ada kecendrungan kita memakai model Incremental. f.B Guy Peters. Namun. memperjungkan atau membangun strategi-strategi sendiri dengan koalisi.Frank J. Menteri Sumarlin mengadakan reformasi pada sistem remunerasi pegawai negeri. dimana terlalu banyak prosedur dan standard operating procedure terlalu dinomorsatukan atau dijadikan sebagai salah satu instrumen yang digunakan oleh pemerintah pusat. Pembuatan keputusan-keputusan poitik nasional amat didominasi oleh pemerintah dan kesan seperti itu sukar dibantah.Frank J. g. bergaining atau kompromi sesuai dengan tujuan yang ia miliki. kurang mampu mendorong empowering masyarakat karena birokrasi melihat masyarakat dari kaca mata bagaimana masyarakat melaksanakan peraturan dan bukan melihat bagaimana inisiatif masyarakat itu sendiri sehingga ada kesan pemaksaan yang dapat menimbulkan benih-benih konflik yang mengakibatkan rakyat sebagai lawan dari birokrasi. seperti yang dilakukan oleh Emil Salim. reformasi tersebut belum mampu menciptakan suatu snow ball reformasi administrasi yang terus sustainable dan akhirnya mampu menciptakan sistem adrninistrasi yang handal dan dapat bargaining mendukung pembangunan ekonomi politik (Sofian Effendi. J. karena hidupnya dari gaji yang diperoleh dari pajak rakyat dan bukan malah menjadi alat untuk menekan rakyat.II dan III.

Pada awal tahun 1981. bernegara dan berpemerintahan. adalah hukum pajak atau hukum fiskal yaitu keseluruhan peraturan yang meliputi wewenang pemerintah untuk mengambil kekayaan seseorang dan menyerahkannya kembali kepada masyarakat melalui Kas Negara.. maupun karena menyusun sistem yang barn tidaklah mudah. termasuk beberapa ©2003 Digitized by USU digital library 9 diantaranya dari jajaran Direktorat Jenderal Pajak.pokok dan hasil dari misi-misi pembaruan perpajakan di beberapa negara. yang dalam banyak hal. tampaklah bahwa sesungguhnya pada masa lalupun telah ada upaya-upaya untuk mengadakan pembaruan sistem perpajakan. maka para pemikir ekonomi Indonesia pada tahun 1980-1981 sudah mengenal pokok. Sebagai bahan kajian bahwa dalam perundang-undangan pajak lama terdapat beberapa permasalahan dan sekaligus kelemahan yang perlu disoroti yaitu: ©2003 Digitized by USU digital library 8 Pertama.. Komisi tersebut berfungsi . sasaran perpajakan semata-mata untuk pemerintah penjajah Belanda dengan berkedok pengisian kas negara tetapi nyata-nyata digunakan untuk kepentingan kolonial. Langkah kedua. menuangkan kebijakan perpajakan ke dalam suatu konsep dalam bentuk perundang-undangan yang ketat. Dari keenam kelemahan yang terjadi pada sistem yang lama.Keempat. Dari paparan di muka . Langkah ketiga. Direktorat jendral Bea dan Cukai serta Direktorat Jendral Moneter. dibentuk Komite atau Panitia Pengarah dengan mengikutsertakan beberapa pejabat dari jajaran Departemen Keuangan.Melalui tulisan ini ada strategi positif yang dapat memperbaiki kelemahan birokrasi menuju demokrasi di Indonesia dengan mengambil contoh yang pemah terjadi di Indonesia yaitu Pelaksanaan Reformasi Perpajakan. sehingga menimbulkan kecendrungan masyarakat wajib pajak kurang turut bertanggung jawab dalam memikul beban negara yang pada hakikatnya untuk kepentingannya sendiri dalarn bermasyarakat.Kedua pelaksanaan kewajiban perpajakan sangat tergantung pada aparat perpajakan.Hal yang kedua. Pada dasarnya pemungutan pajak rnerupakan perwujudan atas kewajiban kenegaraan dan partisipasi anggota masyarakat dalam memenuhi keperluan pengelolaan negara dan pembangunan nasional. diperhatikan saling keterkaitan antara tiga unsur pokok pemungutan pajak. para menteri bidang Ekonomi Keuangan dan lndustri (EKUIN) serta beberapa anggota lembaga perekonomian mempertimbangkan bahwa rencana pembaruan perpajakan di Indonesia dengan menggunakan batasan tahunan dan bukan bulanan. tatacara pemungutan pajak yang berbelit-belit. hanya saja situasi dan kondisinya belum memungkinkan. Kebijaksanaan perpajakan merupakan pemilihan unsurunsur tertentu dari berbagai alternatif yang didasarkan atas sasaran yang ingin dicapai. Sedangkan administarsi perpajakan adalah cara. hukum perpajakan dan administrasi perpajakan. terdapat berbagai jenis pajak sehingga menimbulkan ketidakjelasan bagi masyarakat dalam memenuhi kewajibannya. Dalam rangka memecahkan problematik yang terjadi pada waktu itu. tarif pajak dan prosedur pajak. tingginya tariftarif tersebut sehingga menimbulkan rangsangan untuk menghindari pajak mela1ui berbagai cara.. maka dalam menyusun sistem yang baru. peraturan-peraturan pajak yang beraneka ragam. Ketiga. Kelima. terdapat bermacam-macam tarif pajak baik untuk perorangan maupun untuk perseroan.Keputusan itu dikelompokkan dalam 8 langkah kebijakan sebagai berikut : Langkah pertama.cara dan prosedur pengenaan serta pemungutan pajak. sehingga menimbulkan kesan membingungkan dan bahkan terdapat pembebanan pajak berganda. Keenam. baik karena kemungkinan mendapat tantangan dan antipati dari rakyat yang memang telah lama mengalami trauma dan sindrome pajak pada masa penjajahan. dimana yang bertindak sebagai pelaku administrasi pajak di Indonesia adalah Direktorat Jendral Pajak. keputusankeputusan tersebut menggambarkan pemanfaatan hasil-hasil kegiatan yang sejenis di negara-negara lain. demi tercapainya keadilan sosial dan kemakmuran yang merata. obyek pajak. Pada sistem lama. Ketiga unsur tersebut adalah kebijaksanaan. Pemilihan unsur-unsur tersebut berkenaan dengan subyek pajak. diarnbil Beberapa keputusan tingkat menteri dalam hal strategi dan teknik untuk pembaharuan perpajakan Indonesia.

T. Dari para anggota DPR yang pada umumnya dikenal sebagai tokoh-tokoh masyarakat yang vokal. kalangan masyarakat dan berbagai sudut pandang yang memberikan tanggapan. saran dan juga kritik tajam. baik kalangan pemerintahan. namun tetap rnemperhatikan berbagai pendapat dari kelompok-kelompok yang ada dalam masyarakat. sehingga diharapkan timbul kesadaran. telah terbukti bahwa usaha birokrasi untuk merekonstruksi demokrasi tidak bisa lepas dari politik publik. korupsi. juga membuat kebijakan dan mengimplementasikannya berat sebelah (LV .44. 1993 : 119 -140).(Salamun A. mengawasi dan berperanserta langsung dalam penelitian yang dilakukan oleh tim tenaga ahli asing yang mungkin akan digunakan. disamping tim pengarah ada lagi tim yang dibentuk oleh Departemen Keuangan. Langkah kelima. dan ilmu teknologi komputer dalam pekerjaan studi pembaruan sistem perpajakan di Indonesia. memperluas wawasan pembaharuan sistem perpajakan sehingga mencaku bidang-bidang yang sebelumnya tidak merupakan obyek pajak. Langkah ketujuh. ini tidak akan jadi persoalan bila birokrasi tetap dipandang sebagai instrumen negara. . sehingga kekuasaan kepemimpinan politik mampu membuat birokrasi bertanggung jawab terutama alas dasar kepentingan publik. Langkah keempat. Langkah kedelapan. Meskipun seringkali didengungkan masalah kebersamaan dan demokrasi di dalam organisasi Direktorat Jendral Pajak tapi kenyataannya kekuasaan lebih ditentukan oleh landasan rasional sehingga masalah organisasi harus didahulukan daripada masalah pribadi. sehingga mampu mendorong birokrasi untuk meningkatkan responsivitas mereka terhadap keinginan rakyat . baik itu pendidikan formal maupun pendidikan informal untuk memulai kaderisasi pejabat pajak yang terlatih baik. Keikutsertaan para ahli tersebut baik akademisi maupun para profesional dan pejabat yang berwenang di dalam negeri dimaksudkan untuk memperoleh proses dan pemecahan masalah dalam pengerjaannya. Langkah keenam. di samping tenaga ahli ekonomi dan hukum.mengarahkan. Diperlukan juga tenaga-tenaga ahli dalam bidang-bidang lain seperti ahli administrasi perpajakan akuntan. melibatkan ©2003 Digitized by USU digital library 10 kepentingan pribadi di atas kesejahteraan umum. Responsive terhadap tuntutan rakyat. selama proses pembahasan di DPR banyak pihak dari berbagai disiplin ilmu. mengenai mana yang benar dan mana yang salah. menerapkan langsung hasil dari tiap-formulasi tanpa menunggu laporan hasil keseluruhan paketnya. telah diundang tenaga ahli dan tokoh-tokoh terkemuka yang sangat berpengalaman dan bereputasi Intemasional dalam bidang perpajakan. pengertian dan pemahaman yang tulus. baik dari luar maupun dalam negeri untuk memberikan pengalamannya sekaligus menguji konsep pembaruan sistem perpajakan di Indonesia.Carino. secara jujur harus diakui bahwa sebagian besar menekankan pentingnya mental aparatur pajak mendapat perhatian pemerintah. mana yang haq dan mana yang bathil. Direktorat Jendral Pajak dan Tim dari Luar Departemen Keuangan. Setelah sampai rancangan tersebut ke DPR. kebijaksanaan untuk memulai sistem perpajakanan yang baru secara keseluruhan tanpa sedikitpun mengambil bagian-bagian dari sistem yang lama. Ambisi utama daripada sistem birokrasi adalah tercapainya efisiensi kerja yang seoptimal mungkin tapi bukan malah mempolitisikan birokrasi dengan pilihan. swasta maupun para ilmuwan dari berbagai disiplin ilmu. dimana kekuatan-kekuatan sosial dan negara mengarahkan birokrasi kesana. menyiapkan latihan dan pendidikan bagi para pejabat perpajakan. Seperti telah dijelaskan. mengharuskan agar usaha persiapan ini dilakukan secara biasa saja tanpa publikasi besar-besaran . Berdasarkan pengalaman sejarah. Dalam rangka pengkajian masalah pembaruan sistem perpajakan di Indonesia. Dari banyak tanggapan spontan yang muncul pada hari-hari paertama pengajuan RUU ke DPR..45). 1990 :43.pilihan kebijakan yang memuaskan klien-klien tertentu.Bautista dkk.

Di sisi berhadapan birokrat begitu kuat menjaga motif nilai manajer departemen. Dilema yang muncul adalah birokrasi harus professional dan responsive tapi. tekanan kekuasaan dan dinamika dibangun sistematis di dalam menjalankan. Reformasi politik. telah dimanfaatkan oleh kepentingan politik ditengah arus demokratisasi. yakni DPR. pada sisi lain otonominya sebenarnya sedang ditekan oleh politisi melalui paradigma baru.ORMASI ADMINISTRASI DAN PARADOKS DEMOKRASI Ini menjelaskan tentang perselingkuhan antara birokrasi dengan elit politik yang semakin inten. Dua hal penting model bureaucratic polity eksis: . Birokrasi dan jebakan politik Orde baru melalui bureaucratic polity. sepert terwujudnya good governance. Melalui institusi Presiden dan Wakil Presiden dengan Wakil Rakyat. Birokrasi sebenarnya tidak akan bisa netral. hanya karena adanya keberadaan symbol institusi dari demokrasi. Disini demokrasi dikesampingkan. Dugaan bahwa dinamika komplek terpotret melalui bargaining dalam sector public yang memungkunkan terjadi manipulasi dalam pengelolaan sector public. Kebijakan yang dirumuskan dianggap sah dan demokratis. eksekutif melalui birokrasinya terbawa tuntutan reformasi administrasi melalui paradigma pasar. Pada konteks organisasi public. karena reformasi administrasi sering direduksi pada tatanan tehnis. DPR. Ini dilakukan untuk menghindari kegagalan implementasi dan kritik keras terhadap birokrasi.

1. daerah utama untuk kompetisi politik tidak di negara yang besar dan kekuatan tidak dicapai terus memperbaiki bagi banyak gerakan. 1. bureaucratic polity tidad jauh beda dari bentuk pemerintahan olek derajat untuk decision making nasional daerah kekuatan sosial dan politik keluar pejabat tidak tinggi bagi modal kota. Pada sisi yang lain. Tulisan ini tidak menjelaskan jarak antara birokrasi dengan elit politik dalam dinamika administrasi publik di Indonesia. Pertautan keduanya terjalin dengan bungkus rapi dibalik mekanisme demokrasi. Birokrasi sebagai komponen dari suatu pemerintah dari pusat sampai dengan daerah politik. Struktur dikotomi dilihat dari sisi struktur formal. Daripada kekuatan penuh dicapai meluli kompetisi interpersonal di lingkaran elite di fisik yang tertutup dekat presiden.tanpa memperdulikan rakyat yang akan terkena dampak langsung. Birokrasi yang selalu dituntut responsif sesungguhnya sedang mengalami tekanan elit politik. . namun bersifat informal di sekitar presiden. Justru tulisan ini akan menjelaskan adanya kedekatan elit politik dengan birokrasi. komponen actor. tiga komponen dinamika politik terkait dengan birokrasi menggejala: komponen political competition. Birokrasi melalui aparat negara begitu kuat menjaga nilai manajer yang diinternalisasikan dari nilai politiknya pada kebijakan tersebut. Actor inilah komponen yang pertama. demokratisasi yang diusung dan diyakini akan membawa perubahan yang besar di Indonesia justru telah memanipulasi sektor publik melalui instrumen reformai administrasi yang sedang populer. para pejabat yang memiliki kewenangan formal. Dinamika interaksi politik dengan birokrasi pada pemerintahan hasil pemilihan secara lansung. 2. Proses politik pada tingkat ini bisa sangat kompleks. 2. Sehingga yang tersisa di mata rakyat hanyalah kekuasaan dari birokrasi. Setiap kebijakan yang dirumuskan dianggap sah dan demokratis oleh DPR yang dianggap simbol institusi dan demokrasi. Adanya dikotomi administrasi dan politik dijelaskan dengan konteks yang spesifik. Decision making benarbenar diperankan oleh arena inti proses kompetisi politik yang dibangun diluar birokrasi sesungguhnya. Namun.

Birokrasi Pemerintahan (Bureaucratic Government) Interaksi politik dan birokrasi terjadi begitu inten dalam dinamika pemerintahan kita. perubahan dari partai attachment menjadi personal attachment dan terjadinya transformasi kepentingan elit menjadi kepentingan publik sehingga dapat menyebabkan pemerintah lamban dan tidak responsif. para ekskutif melalui birokrasinya terbawa tuntutan reformasi administrasi seperti terwujudnya good governance. termasuk tekanan global (IMF. Reformasi birokrasi dimanfaatkan oleh kepentingan politik ditengah arus demokratisasi. contoh konkritnya dapat dilihat dari Pilkada secara langsung. setiap kebijakan yang dibuat selalu bias dengan kepentingan politik. Hal ini dilakukan agar terhindar dari kegagalan implementasi dan nilai negatif birokrasi. Hal tersebut dapat terjadi di pusat maupun daerah (pemilihan kepala daerah secara langsung). bahwa pada sisi birokrasi dituntut untuk selalu profesional dan responsif. Dinamika komplek tersebut terlihat melalui politik bargaining dalam sektor publik yang memungkinkan terjadinya manipulasi dalam pengelolaan publim sektor. memberikan implikasi pada ricuhnya kebijakan publik.Pada konteks organisasi publik. sehingga kemungkinan adanya bargaining dan cheating ada meski dalam era demokratisasi dan kampanye good-governance.Oleh karena itu. tapi eksekutif dan birokrasinya menghendaki hal tersebut sebagai bagian dari balas jasa kampanye pemilihan presiden langsung dan untuk mengamankan kekuasaannya dan hal . Sistem pemilu secara langsung yang diterapkan. Interaksi yang terjadi bukan saja politisi memanfaatkan eksekutif. birokrasi ditekan oleh politisi melalui nilai-nilai dari paradigma baru tersebut. Namun disisi lain. World bank). Dilema yang terjadi adalah.

Pada sisi yang ekstrim. Posisi ini sama dengan yang pertama. . Executive ascendancy seperti bentuk dikotomi politik administrasi yang murni (Carino. Value normatif pada kategori ini adalah value yang memiliki orientasi pada efektivitas dan produktivitas lembaga. Menurut Carino. Kategori Village Life Menjelaskan bahwa baik aparat atau elit politik memiliki latar belakang sosial ekonomi. ada kemungkinan penyalahgunaan posisi. sehingga negara yang sedang melakukan konsolidasi demokrasi memungkinkan elit eksekutif memiliki akses dalam memainkan informasi dalam birokrasi. pola interaksi tersebut secara teoritis akan menempatkan siapa dimana/dominasi birokrasi ataukah birokrasi sederajat dengan politisi. Model birokrasi yang berada pada posisi intermediate ada 2 kategori. mereka memetakan interaksi kedunya dalam bentuk tumpang tindih karena internalisasi nilai-nilai demokrasi. sedangkan Peters dan Pierrs (2001:5) memahami pola interaksi politisi dengan birokrasi lebih mendalam (intensitas terinternalisasinya nilainilai demokrasi) dan terkesan overlapping (birokrasi dan politisi). dan pengalaman yang sama. b.1992:4). yaitu : a. yaitu:1. or co-quality with the executive. kepentingan. tetapi ada cara-cara yang tidak demokratis yang berakibat pada implikasi pemerintahan yang otoriter. sesungguhnya pemerintahan yang demikian sedang berusaha tampil secara demokratis. Menurut kerangka yang dikembangkan Carino. padahal didalamya terdapat manipulasi kepentingan rakyat yang berarti kepentingan demokrasi. ada 2 bentuk model.yang mengakibatkan birokrasi yang awalnya sama akan ada posisi yang lebih tinggi sehingga perlu dikontrol. 2. Bureaucratic sublation of.tersebut dianggap hal yang normal. Kategori Functional Village Dari perumusan kebijakan / policy sampai dengan implementasinya / pelaksanaannya semuanya tertata rapi.

nasional. para pejabat tersebut lebih mementingkan kepentingan golongan atau partainya. Dalam konteks urban politics. Global Governance juga berkembang melalui level hubungan internasilonal.Model birokrasi yang dibahas disini adalah model Bureaucratic Government. di kembangkan melalui konsep tentang governance framework. Sebagai contohnya adalah pemanfaatan konsep oleh IMF dan World Bank dalam rangka good governance. Dan yang terkhir adalah dalam konteks interaksi publik dan private. regulasi. Secara umum konsep ini telah di gunakan karena terkait dengan fokus kapabilitas dari pemeerintah dengan interaksinya dan interaksinya antara pemerintah dengan masyarakat. dan transnasional. daripada kepentingan rakyat. Reformasi administrasi terjadi melalui tahapan yang kompleks dan melibabtkan banyak kepentingan. pemanfaatan konsep melalui Local Governance. dan aktivitas operasional antar beberapa institusi. Model ini juga sangat cocok dengan model Birokrasi Indonesia saat ini. Dalam model ini terjadi kompleksitas politik yang cukup tinggi pada tingkatan organisasi. yaitu Governance. Multi lever mengembangkannya dalam konteks interaksi antara lembaga lokal. Sehingga kesannya. Sedangkan dalam konteks policy analisis. governance telah di gunakan untuk penelitian-penelitian tentang peran pemerintah dalam melakukan koordinasi di sektor . regional. Hampir semua pejabat di Indonesia dipilih berdasarkan politik.dimana birokrasi negara kita sedang mengalami himpitan permainan elit politik. Karena model birokrasi yang seperti itulah. Para elit politik tersebut mendapatkan ruang yang lebih luas dalam wilayah birokrasi. mengapa banyak kebijakan publik di Indonesia sekarang ini memiliki kecenderungan yang mungkin saja berpotensi menyesengsarakan rakyat. Reformasi akan merubah tatanan yang telah ada sebelumnya dengan meredefinisi dan resistensi untuk menuju keberhasialn. Ide ini di kemas dalam konsep yang telah menjadi Political Catchword di seluruh dunia.

Ini merupakan permasalahan transfer nilai dari organissai privat ke organisasi publik. Komlpeksitas politik pada transisi demokrasi yang belum matang telah memutuskan link yang seharusnya terjadi atau di lakukan. tetapi belum sepenuhnya berubah. Perkembangan ini terkait dengan krisis yang dialami oleh nega5a. analisis lebih di fokuskan pada interaksi politik dan birokrasi. Sebagai contoh adalah NPM dan kasus BBM. Peluang ini telah terbaca oleh politisi karena memanng organisasi publik sedang mengalami kesulitan untuk menggunakan instrumen baru ini. Selebihnya. Dalam penerapan reformasi administrasi ini seringkali di manfaatkan oleh politisi untuk mengambil keuntungan. Kenyataan yang seperti ini bisa mengakibatkan kegagalan. Intervensi Paradigma ini lebih di fokuskan pada konteks reformasi administrasi saja. namun dalam intervensi global dan demokrasi telah membuka ruang yang lebih besar bagi politisi untuk bermainm dalam wilayah birokrasi ini.ekonomi. Kasus BBM ini merupakan kebijakn yang sarat dengan tuntutan responsibilitas dari organisasipublik yang mendelivernya dan nilai-nilai kolektif yang lebih luas yang menyangkut masyarakat miskin. Seharusnya reformasi menghendaki pengelolaan yang sistematis. Dalam kasus BBm. Dengan kenyataan lemahnya proses reformasi. Dari awal kebijakan ini memang di kendalikan secara politis. Kenaikan harga BBM yang terus di paksakan dengan berbagai . yakni pada adopsi instrumen administratif tertentu yang kelihatan tehnis. ada proses perubahan internal organisasi dan juga lingkup eksternal pada suatu negara yang memungkinkan terjadinya reformasi tersebut. maka politisi lebih leluasa memanfaatkan instrumen responsibilitas untuk kepentingan kekuasaan jangka pendek. yang bisa juga di katakan merupakan gagalnya suatu administrasi negara yang di terapkan dalam konteks global yang terjadi di negara transisi seperti Indonesia ini. Intervensi paradigma ini juga akan mempengaruhi interaksi kekuasaan antara birokrasi yang di lakukan oleh pelatyan publik dengan politisi pada berbagai tahapan.

bureaucratic goverment di Indonesia merupakan birokrasi publik yang mengalami kebingungan arah dan ini terjadi di tengah perubahan ke arah demokrasi.penolakan melalui demonstrasi-demontrasi menunjukan rendahnya akuntabilitas organisasi publik. karena birokrasi tidak siap untuk berubah. Contohnya. Di indonesia antara politisi dan public servant tidak terjadi kerjasama yang baik dalam pemecahan masalah publik yang seharusnya secara demokratis dalam perumusan kebijakan dalam perumusan kebijakan dan responsivitas dalam implementasinya namun disini terjadi penipuan yang dilakukan publik servant dalam pelayanan publik. Yang kedua yaitu adanya kenyataan bahwa demokrasi yang diinternalisasikan masih dalam tahapan demokrasi formal. Padahal rezim seharusnya menentukan peraturan dasar dan kualitas dari interaksi antara bermacam-macam lembaga melalui kebenaran proses kebijakan dan gabungan nilai untuk mengelola masalah publik.prosedural yang memberikan ruang pada elit politik untuk memberi instrument pada organisasi publik.kasus kenaikan harga BBM yang didukung oleh . Dan lebih di tekankan lagi bahwa proses internalisasi instrument yang lemah akan memberikan peluang yang besar bagi politisi untuk memberikan suatu perfomance dari kebijakan tertentu. Birokrasi kita sekarang ini masih sangat mengecewakan di dalam pelaksanaannya. Rezim kita sekarang ini telah gagal menentukan kualitas yang tinggi dalam mengelola masalah publik.maka ada dua hal yang penting yaitu : reformasi administrasi yang menggunakan beberapa instrumen yang memiliki nilai kontradiktif satu sama lain dalam dirinya sendiri karena nilai dari organisasi publik dan privat yang digeneralisasikan ternyata telah membuka peluang permainan politik. Sementara akuntabilitas dalam reformasi administrasi merupakan instrumen yang penting. Dalam reformasi ini di manfaatkan oleh politisi melalui cara yang tidak demokratis. Melihat kenyataan tersebut. Hal ini ditandai dengan banyaknya lobi yang dilakukan eksekutif untuk kepentingan kebijakan.

Kedua partai tersebut setuju dengan kenaikan BBM karena untuk mempertahankan kekuasaan mereka yaitu demi pertimbangan kadernya yang mendapatkan posisi sebagai menteri. Jadi reformasi itu bukan sekedar masalah tehnis administratif. Hal ini dapat merugikan reformasi administrasi kita. reformasi administrasi yang terbungkus dengan paradigma besar seperti demokratisasi dan globalisasi. adalah reformasi pastilah produk keputusan politik dan bukannya administratif belaka. lanngsung maupun tidak langsung mewarnai nilai kebijakan melalui lembaga presiden atau wakil presiden yang secara langsung berhadapan dengan rakyat. pertama ide reformasi selalu datang dari kepentingan eksternal dan bahkan global. Karena apabila reformasi hanya pada tahapan tehnis. Seharusnya reformasi administrasi di pahami sebagai sistem administrasi yang lebih efektif untuk perubahan sosial. serta pasar menjadi bagian stakeholder dalam reformasi administrasi. Jadi Reformasi administyrasi akan mempertemukan birokrasi. Dengan demikian birokrasi kita sekarang ini di bawah kontrol politisi. di mana instrument membawa persamaan politik. Logika tersebut di kembangkan dengan beberapa alasan. politisi memainkan perannya untuk tidak melakukan perannya untuk tidak melakukan reaksi sama sekali terhadap resistensi yang di berikan oleh publik. dan rakyat. Semua ini terungkap ketika negara kita melakukan pemilu secara langsung. politisi. Keempat. Ketiga. maka instrumen yang digunakan akan sangat mungkin bernuansa dan di terjemahkan oleh kepentingan elit yakni politik. . kedua kepentingan global tersebut tidak selamanya berdimensi tunggal.partai PKS dan PPP padahal dulunya menolak kenaikan BBM. demokrasidan kesejahteraan rakyat miskin. keadilan sosial dan pertumbuhan ekonomi.

. Tetapi pada kenyataanya di Indonesia tidak berjalan seperti teorinya. Hal itu di karenakan adanya pengawasan dan kontrol langsung oleh pemerintah pusat. dulu jika perintah itu tidak di laksanakan maka akan di tindak langsung. Justru pelayanan publik berjalan ketika demokrasi di singkirkan.Komentar: Indonesia adalah negara yang menganut model pemerintahan Demokrasi. Para pejabat sekarang lebih mementingkan kepentingan pribadi dan golongannya daripada kepentingan publik atau rakyat. Padahal dulu pada jaman pemerintahan Soeharto pelayanan publik lebih baik. model pemerintahan demokrasi adalah model pemerintahan yang bebas mengeluarkan pendapat dan pemerintah mengutamakan suara rakyatnya di banding kepentingan pimpinannya.

Sign up to vote on this title
UsefulNot useful