Demokrasi dan Partisipasi Publik

PendahuluanDewasa ini istilah demokrasi sering muncul di media massa Indonesia menjelang diadakannya pemilihan legilatif maupun kepala daerah (PILKADA). Tidak berbeda dengan pemilihan yang akan terjadi di lingkungan Rukun Tetangga (RT) 02 Rukun Warga (RW) 19 Dukuh Baturan Desa Trihanggo Gamping Sleman. Meskipun dalam skala dan lingkup yang kecil, tapi pesta demokrasi adalah hak dari warga negara untuk menentukan pimpinan di daerahnya yang dianggap layak dan mampu memegang amanat masyarakat. Secara terminologi, istilah demokrasi berasal dari bahasa Yunani kuno yang terdiri dari kata demos yang artinya adalah rakyat dan kratos/cratein yang berarti pemerintahan . Dalam bahasa Inggris, democracy artinya adalah pemerintahan yang berasal dari rakyat. Sehingga apabila makna dari kedua kata tersebut digabungkan maka demokrasi berarti pemerintahan rakyat. Sedangkan secara umum demokrasi didefinisikan sebagai pemerintahan yang berasal dari rakyat, oleh rakyat, dan untuk rakyat. Pemerintahan dari rakyat artinya adalah pemerintah yang memperoleh amanat merupakan anggota masyarakat yang dipilih dan kemudian diberi amanat oleh rakyat. Oleh rakyat artinya adalah pemerintahan yang dibentuk merupakan hasil dari kesepakatan bersama oleh rakyat sehingga daerahnya memiliki struktur pemerintahan sehingga menjadi teratur. Sedangkan untuk rakyat, memiliki arti bahwa pemerintahan yang dibentuk kemudian bekerja untuk mengabdi dan melayani rakyat tersebut sehingga masyarakat menjadi sejahtera. Inti DemokrasiKekuasaan tertinggi dalam demokrasi ada di tangan rakyat. Rakyat memiliki kedaulatan melalui suara yang digunakan dalam pemungutan suara dalam pemilihan umum. Dengan demikian suara rakyat menjadi penentu dalam pengambilan keputusan pada masyarakat tersebut. Pemilu memberikan kesempatan kepada rakyat

untuk memilih pemimpin yang dianggap paling layak dan mampu untuk mengemban amanat. Kemudian pemimpin yang terpilih akan memperoleh mandat dari rakyat untuk mengelola pemerintah melalui lembaga perwakilan rakyat. Lembaga perwakilan berasal dari anggota masyarakat yang bertugas untuk menjaga agar pelaksanaan pemerintahan tidak mengalami pemyimpangan. Lembaga perwakilan merupakan wadah bagi rakyat untuk menyalurkan aspirasi sehingga suara rakyat tersalurkan pada pemerintah. Rakyat juga bisa secara langsung memberikan masukan tidak hanya kepada lembaga perwakilan tetapi juga kepada pemerintah. Tindakan ini disebut dengan partisipasi publik (rakyat). Partisipasi adalah suatu proses dimana sejumlah pelaku bermitra punya pengaruh dan membagi wewenang di dalam prakarsa “pembangunan”, termasuk mengambil keputusan atas sumberdaya . Sedangkan Partisipasi publik secara sederhana diartikan sebagai keikutsertaan dan keterlibatan masyarakat dalam aktivitas kenegaraan. Wujud partisipasi publik bisa beragam, misalnya ikut pemilihan umum (pemilu), membayar pajak, menyampaikan aspirasi, keluhan, mengontrol pemerintah, dan lain-lain. Salah satu contoh nyata dari partisipasi publik adalah keikutsertaan dalam pemilihan umum (pemilu). Istilah lain dari pemilu adalah pesta demokrasi. Disebut demikian karena pemilu merupakan kegiatan besar menyerupai perayaan/pesta dimana rakyat berhak dan menjadi penentu dari perjalanan masyarakatnya. Pemilu pertama kali dilaksanakan pada jama Yunani Kuno untuk memilih anggota senat polis yang memberikan masukan kepada kaisar. Pada jaman tersebut pemilu dilaksanakan secara langsung dengan cara memilih calon anggota senat yang ada. Di samping itu, jumlah penduduk yang memiliki suara dalam suatu polis masih sedikit sehingga pemilihan bisa dilakukan secara langsung. Dewasa ini, jumlah rakyat di suatu negara sangatlah besar sehingga pemilihan secara langsung sering kali memakan waktu sehingga

Kepemimpinan dalam MasyarakatPemimpin adalah individu yang bertugas sebagai kepala pemerintahan. Walikota. Bupati. Gubernur. yang bersangkutan sebenarnya sama saja dengan mendelegasikan hak untuk menjadi pemimpin dan mengelola daerahnya karena setiap individu memiliki hak yang sama. Namun hal ini mendapat banyak kritik karena lembaga perwakilan seringkali tidak mewakili aspirasi dari rakyatnya sehingga pemilihan langsung tetap digunakan untuk memilih pemimpin masyarakat. DPR. Presiden. Pemilihan Presiden. Demikian halnya dengan rencana pemilihan Ketua RT 02 ini. Namun demikian hak tersebut tidak diserahkan hanya dipinjamkan dalam bentuk amanat dan rakyat bisa meminta kembali bahkan mencabut amanat/hak dipinjamkan kepada pemimpinnya apabila dianggap gagal atau melakukan penyimpangan. Rakyat memiliki kedaulatan melalui suaranya untuk memilih dan menentukan pemimpin yang paling dipercaya untuk mengemban amanat. Hal ini juga berlaku kepada calon Ketua RT yang akan dipilih. dan Kepala Desa dilakukan secara langsung. Kepala pemerintahan memiliki tugas untuk mengatur tatanan kehidupan masyarakat sehingga berjalan . Ketika memilih seorang pemimpin berarti merelakan hak tersebut dilakukan oleh orang lain. Pemimpin adalah individu yang diberi amanat untuk menjalankan pemerintahan.dikenal pemilihan tidak langsung. dan kepala desa adalah pemimpin. Rakyat memilih anggota lembaga perwakilan dan lembaga perwakilanlah yang memilih kepada negara tersebut. Bupati/Walikota. Mengingat setiap individu memiliki hak yang sama untuk memimpin. Amanat dan kekuasaan yang dimiliki oleh pemimpin adalah pemberian rakyat dan bersifat sementara dan bisa dicabut. Oleh karena itu seorang pemimpin harus bertanggung jawab kepada rakyatnya dan menjalankan tugasnya untuk melayani rakyat. Ketika seseorang memilih calon pemimpin. DPRD.

Masyarakat juga harus secara aktif melakukan pengawasan terkait pemanfaatan sumber daya daerahnya karena kekayaan daerah pada hakikatnya adalah milik masyarakat dan dipungut dari masyarakat oleh pemerintah meskipun pengelolaan diserahkan pada pemerintahan setempat. Meskipun tidak memimpin sendiri. Seorang pemimpin harus menjadi wakil masyarakatnya dalam berhubungan dengan masyarakat yang lain. Perbedaan kepentingan memungkinkan terjadinya benturan antar anggota masyarakat dan berakibat pada timbulnya perselisihan. Kekuasaan yang dimiliki merupakan tanggung jawab yang berasal dari masyarakat. Masyarakat juga harus mematuhi ketentuan pemerintah yang bertujuan untuk kemakmuran masyarakatnya sehingga resiko terjadi konflik dapat dikendalikan. Pemenuhan kebutuhan membutuhkan sumber daya yang dimiliki oleh daerah tersebut. Pemimpin dalam hal ini harus mengakomodasi kepentingan rakyat banyak sehingga pemenuhan atas kebutuhan yang menjadi hajat hidup orang banyak harus didahulukan. Pemimpin harus memiliki pengetahun dan wawasan yang luas sehingga mampu mewakili masyarakatnya untuk berkomunikasi dengan pihak lain. Masyarakat dengan sukarela telah menyerahkan haknya menjadi pemimpin untuk dipimpin oleh orang lain. pemimpin haruslah memiliki visi yang baik sehingga masyarakat yang dipimpinnya memiliki tujuan.dengan baik. Komunikasi yang baik harus berjalan sehingga menciptakan kedamaian antar wilayah. Keseluruhan tugas yang dimiliki oleh pemimpin adalah amanat dari masyarakatnya. . Masyarakat dalam menjalankan kehidupannya juga berhubungan dan berdampingan dengan masyarakat lain. Sumber daya tersebut harus dikelola dan dialokasikan secara tepat sehingga sasaran yang dituju mengena dan tidak terjadi pemborosan. Setiap individu dalam masyarakat memiliki kepentingan yang berbeda-beda. tapi dibantu oleh perangkat organisasi lain.

Masyarakat berhak untuk memilih pemimpin sesuai dengan hati nurani yang dimiliki. Dengan kriteria tersebut. 3) Partisipasif: melibatkan masyarakat dalam musyawarah. 2) Transparan (terpercaya): pengelolaan sumber daya bisa diketahui oleh masyarakat. Terdapat beberapa kriteria untuk memilih pemimpin ideal. Keterlibatan warga sangat . yaitu: 1) Terbuka (jujur): bisa berkomunikasi dengan semua pihak. Oleh karena itu diperlukan kriteria pemimpin yang ideal. Akuntabilitas adalah kewajiban untuk menyampaikan pertanggungjawaban atau untuk menjawab dan menerangkan kinerja dan tindakan seseorang/badan hukum/pimpinan kolektif suatu organisasi dalam penggunaan sumber daya yang ada. Dengan demikian masyarakat sebagai pihak yang memiliki sumber daya dan melimpahkannya pada pemimpin akan menilai keberhasilan pelaksanaan tugas yang diamanatkan. dan apa saja yang telah dicapai dengan penggunaan wewenang dan sumberdaya tersebut kepada pihak yang memiliki hak atau kewenangan untuk meminta keterangan atau pertanggungjawaban . seorang pemimpin harus mempertanggungjawabkan tugasnya kembali kepada masyarakat. Tugas masyarakat setelah seorang pemimpin berhasil dipilih adalah mematuhi dan menjalankan kebijakan serta peraturan yang dibuat untuk kepentingan masyarakat. calon pemimpin diharapkan bisa mengemban tugas yang akan diletakkan di pundaknya. Setiap warga juga wajib untuk melibatkan diri dalam berbagai kegiatan yang diselenggarakan oleh organisasi masyarakat di lingkungannya. Ini adalah wujud dari akuntabilitas pemimpin kepada warganya. Hati nurani yang baik seharusnya bisa mengantarkan pemilihan pada seorang pemimpin yang terbaik di mata masyarakat. Hal ini bertujuan agar tugas-tugas yang dibebankan pada seorang pemimpin bisa berjalan dan berhasil. dan 4) Akuntabel (bertanggung jawab): menjalankan kegiatan yang bermanfaat untuk masyarakat.Oleh karena itu.

mematuhi. Ini adalah wujud dari tanggung jawab moral warga terhadap pemimpin yang dipilihnya. dan untuk warga. Oleh karena itu. Sedangkan warga yang lain harus menerima. setiap individu harus siap menjadi ketua apabila dipilih oleh warga yang lain. membantu. dan mengawasi ketua baru demi RT 02 semakin maju di masa datang. Dengan demikian semua orang yang menjadi warga di lingkungan tersebut memiliki hak yang sama.penting dan tidak hanya pada pelaksanaannya tapi juga dalam perencanaan kegiatan. oleh warga. Dengan demikian kegiatan yang dilaksanakan benar-benar dibutuhkan dan mampu dirasakan manfaatnya secara luas. Hak tersebut adalah untuk memilih dan dipilih menjadi Ketua RT berdasarkan kriteria yang telah disepakati. PenutupPemilihan Ketua RT 02 di Padukuhan Baturan merupakan kegiatan dari warga. Yang bersangkutan harus legawa dan siap menjalankan tugas. Selanjutnya. . warga juga harus berpartisipasi secara aktif dalam melakukan pengawasan dan kontrol atas kegiatan yang diselenggarakan di wilayahnya.

Organissasi mengopcrasikan prinsip-prinsip dasar hirarki kantor dimana ada garis-garis yang jelas dari atasan dan bawahan.Levine. Hal ini akan menjadi lebih transparan apabila kita memantau birokrasi yang berhubungan atau berurusan dengan organisasi formal. Cita-cita utama dari sistem birokrasi adalah mencapai efisiensi kerja yang seoptimal mungkin. boleh dikatakan artinya canggung. karir yang panjang. negeri maupun swasta. kekuasaan hirarkis. tidak imaginatif.Si Jurusan Ilmu Adminisrasi Negara Fakultas Ilmu Sosial dan Ilmu Politik Universitas Sumatera Utara Berbicara tentang birokrasi sering kali kita asumsikan dengan urusan yang berbelitbelit. Konsep Birokrasi Dalam kamus Akademi Perancis tahun 1798. 1982 : 240).” Birokrasi sebagai suatu sistem organisasi formal dimunculkan pertama sekali oleh Max Weber pada tahun 1947. kemajuan dan perkembangan suatu sistem politik khususnya memperkecil ruang gerak demokrasi. kaku. Apalagi topik yang akan dikaji ada hubungannya dengan demokrasi sehingga memerlukan suatu pemikiran yang serius untuk menelaah dan menilai akibat-akibat yang terjadi dan yang ditimbulkan oleh aksi birokrat dalam konteks demokrasi yang perlu diperbaiki.982: 241). Pembahasan birokrasi selalu menarik untuk dibicarakan baik sebagai bahan diskusi maupun sebagai bahan kajian ilmiah untuk diperdebatkan dengan tujuan mencari solusinya.usaha paling penting berupa implementasi Undang-Undang. karena organisasi birokrasi punya struktur yang jelas tentang kekuasaan clan orang yang punya kekuasaan mempunyai pengaruh sehingga dapat memberi perintah untuk mendistribusikan tugas kepada orang lain (Robert Denhard.HUBUNGAN BIROKRASI DENGAN DEMOKRASI Dra. lisensi dalam perekonomian dan masalah-masalah profesional. diantaranya usaha. M.Levine. prosedur yang panjang dan memakan waktu yang lama. dan efisiensi. birokrasi di definisikan sebagai:"wewenang atau kekuasaan dari berbagai departemen pemerintahan. 1989 : 100) Berdasarkan tulisan tersebut James memberi persamaan antara . Masyarakat didominasi oleh para birokrat. menurutnya birokrasi merupakan tipe ideal bagi semua organisasi formal.32). birokrasi kadang-kadang digunakan dalam suatu hal yang diremehkan. persiapan proposal legislatif. 1. peraturan-peraturan. Tulisan ini mencoba menjabarkan birokrasi berkaitan dengan demokrasi dan melihat posisi itu melalui Rekonstruksi. Sedangkan menurut kamus bahasa Jerman edisi 1813. Namun apakah sudah menjadi hal yang sulit direform bahwa birokrasi selalu menghambat kemudahan. Ciri organisasi yang mengikuti sistem birokrasi ini ciri.pengaruh dan para kepala dan star biro pemerintahan. Birokrasi diartikan :"kekuasaan.cirinya adalah pembagian kerja dan spesialisasi. Menurut Weber organisasi birokrasi dapat digunakan sebagai pendekatan efektif untuk mengontrol pekerjaan manusia sehingga sampai pada sasarannya. peraturan ekonomi. orientasi impersonal.Levine. islam maupun non islam. ditulis oleh James Burnham tahun 1941 yang menekankan pentingnya kelompok manajerial di dalam perekonomian. DARA AISYAH. Menurut Herbert M. ©2003 Digitized by USU digital library 11984 : 26. pokoknya selalu mendapat “tanda” negatif dari pendengarnya. Birokrasi memainkan peranan aktif di dalam proses politik di kebanyakan negara dan birokrasi menggunakan banyak aktifitas-aktifitas. Oleh karena itu lebih baik dijelaskan terlebih dahulu apa birokrasi dan demokrasi itu Bagaimana kontribusinya terhadap demokrasi Bagaimana posisi birokrasi dengan demokrasi melalui rekonstruksi bagaimana situasi problematik yang terjadi di Indonesia dan strategi seperti apa yang dapat diterapkan di Indonesia sehingga antara birokrasi dan demokrasi bisa direkonstruksi. dan tidak ada pemisahan yang tajam antara kelompok manajerial clan pejabat politik (Martin Albrow. dan para administrator pemerintah yang tidak efisien (Herbert M. a. dan membagi pelayanan kesejahteraan (Herbert M.

Demokrasi berarti liberte. mencakup aplikasi kriteria evaluatif dan spesifikasi sifat .kekuasaan kelas para manajer dengan kelas para birokrasi negara. Kontribusi birokrasi dengan Demokrasi Kebanyakan orang menganggap bahwa konsep birokrasi sebagai administrasi yang tidak efisien dan rasional. menerbitkan. dimana ada kontrol yang efektif. maupun nilai masyarakatnya sendiri dalam memaksimalkan upaya yang ada menuju iklim demokratisasi yang diidam-idamkan. antara kekuasaan di kalangan "wong ghede dan wong cilik”. Kata demokrasi berasal dari bahasa Yunani. para penguasa berkewajiban untuk mempertanggungjawabkan tindakantindakannya kepada masyarakat . untuk rakyat Esensi dari demokrasi adalah bahwa rakyat memerintah atau melakukan pemerintahan oleh dirinya (government by the people) (majalah Koridor. rezim yang memerintah.4 tahun XXI. Pensylvania. parapenguasaharusdipiliholehmasyarakat. Basis kultural dalam pemerintahan Orde Baru di Indonesia itu dapat dilihat dari bagaimana hubungan antara elit politik dengan warga negara sebagai hubungan antara kawulo dan gusti. parapenguasadipilihmelaluirepresentatif/perwakilandarimasyarakatdan 7. fraternite. Masyarakat yang dibentuk dan diperintah oleh para birokrat akan menjadi masyarakat -masyarakat birokratis yang nantinya masyarakat tersebut akan menjadi birokrasi-birokrasi masyarakat yang patuh dan tunduk pada pengaruh sikap-sikap dan nilai-nilai para birokrat. ekonomi dan ideologi yang menjadi anutan. Usaha demokratisasi masih memerlukan rentang waktu yang cukup panjang bagi lembaga-lembaga politik. Demokrasi juga mengimplikasikan adanya kebebasan sipil dan politik yaitu kebebasan berbicara. 1992 : 32). para penguasa harus bertindak sesuai dengan kepentingan masyarakat. Demokrasi yang dapat menghambat nilai-nilai kultural menurut seorang Indonesianist Benedict R. memutuskan kebijaksanaan umum dan melaksanakan hukum dan administrasi pemerintahan. masyarakat secara perseorangan harus terlibat dalam pembuatan keputusan yang penting dalam arti memutuskan hukum-hukum publik dan masalah. (prisma No. khususnya dalam cara pandang terhadap pembangunan politik. 1995 : 6). David Held menyatakan ada 7 prinsip utama penyelenggaraan negara berdasarkan demokrasi yaitu: 1. demokrasi magandung dua dimensi kontes dan partisipasi yang menurut Robert Dahl merupakan hal menentukan bagi demokrasi. masyarakat harus memerintah dalam arti semua harus terlibat dalam membuat undang-undang. maka masalah birokrasi dan demokrasi tidak akan pernah berhenti.masalah kebijaksanaan umum. egalite. Huntington. 4. oleh rakyat. menurut bahasa Yunani. Kalau kita amati model demokrasi David Held diatas. c. berkumpul dan berorganisasi. Selama masih ada tipe-tipe pejabat negara dan seperangkat nilai yang dianggap sebagai bagian inheren dalam demokrasi yang sebenamya. definisi yang paling singkat tentang demokrasi adalah apa yang diucapkan oleh Abraham Lincoln di Gettysburg. 3. 6. oleh warga negara terhadap kebijakan pemerintah. Konsep Demokrasi Pada tulisan ini perhatian kita tertuju pada masalah birokrasi dan hubungannya dengan demokrasi.4). parapenguasaharusbertanggungjawabkepadaperwakilandarimasyarakat. ©2003 Digitized by USU digital library 2 2. Arnerika Serikat tahun 1863 yaitu pemerintahan dari rakyat. b.O'G Anderson yaitu prinsip ajaran demokrasi pandangan Jawa yang sangat mempengaruhi sistem politik dan proses demokratisasi Indonesia. 5. karena adanya perubahan sikap dari masyarakat akan bergantung kepada pengaruh para birokrat. 1994: 3. Hal ini akan cepat menjerat masyarakat akan runtuhya nilai-nilai demokrasi sehingga ada suatu pertentangan dengan nilainilai tersebut yang dianggap sebagai suatu problema yang memerlukan pemecahan. maka untuk kasus negara berkembang seperti Indonesia demokrasi yang muncul sangat bergantung kepada perilaku elit politik dan struktur budaya. yang dibutuhkan bagi perdebatan politik dan pelaksanaan kampanye-kampanye pemilihan itu (Samuel P. Cara pandang tentang demokrasi dari waktu ke waktu mengalami perkembangan sejalan dengan semakin kompleksnya hubungan antar warga.

karena mereka percaya bahwa bukan kekuasaan yang dijalankan pejabat yang menimbulkan masalah tetap cara menggunakan kekuasaan itulah yang menjadi masalahnya. Konsep birokrasi cendrung dianggap sebagai suatu aspek ancaman terhadap demokrasi. Dalam sistem politik demokrasi liberal yang berawal dari Maklumat Wakil Presiden No. yaitu pertama proses weberisasi. Martin Albrow membedakan tiga posisi dasar tentang fungsi-fungsi pejabat di negara demokrasi.Northcote Parkinson Ketiga. dimana politik yang ikut menentukan sosok administrasi pemerintah pada waktu itu. Bertitik tolak dari ciri-ciri tersebut maka dapat kita simpulkan bahwa birokrasi di Indonesia cendrung mendekati ke tiga ciri tersebut. untuk itu perlu dilihat bagaimana masing-masing karakteristik antara birokrasi dan demokrasi digunakan dalam usaha mendiagnosis dan menyembuhkan masalah yang terjadi. Berdasarkan konsep Jackson tersebut maka ciri-ciri pokok masyarakat politik birokratik adalah : 1. yaitu 1. lembagapolitikyangdominanadalahaparatbirokrasi 2. untuk birokrasi di Indonesia agaknya cendrung ke arah parkinsonisasi dan orwelisasi ketimbang ke arah weberisasi. sehingga menyebabkan lemahnya peranan partai politik dan dampaknya semakin memperkuat peranan birokrasi. 3. partai politik.28 ).1989 : 1 07). januari-april 1995 : 27. Menurut analisa Dr.nilai-nilai tersebut (Martin Albrow.X tertanggal 3 November 1945. konsepkapitalismebirokratikyangdirumuskanolehWittfogel(1957). 1996: 159). 2. yaitu suatu proses dimana suatu biroksasisemakin mendekati tipe ideal sebagaimana dikemukakan oleh Max Weber. ©2003 Digitized by USU digital library 3 Problema yang harus dipecahkan untuk dapat menumbuh kembangkan demokrasi dengan menempatkan birokrasi secara konsisten di dalam sistem politik.terutama pembangunan yang mampu mengantisipasi dan menahan gejolak-gejolak eksternal sehingga bisa mencapai tingkat pertumbuhan yang memadai. di Indonesia terlebih dahulu didekatkan melalui 2 konsep yaitu : 1. seperti parlamenter. Friedrich dan Finer prihatin terhadap masalah kesesuaian praktek-praktek administrasi negara modem dengan nilai-nilai demokrasi. agar dapat memahami birokratisasi dalam pembangunan nasional. sehingga perlu dipertanyakan kemampuan masyarakat politik birokratik ini untuk melaksanakan pembangunan . kekuaasaan perlu bagi para pejabat sehingga harus dicari metode-metode pelayanan yang dapat disalurkan bersama-sama. dalam jurnal Bestari. Ada tiga kecendrungan yang dialami oleh setiap birokrasi. lembaga–lembaga politik lainnya. menciptakan suatu sosok sistem politik bureau-nomia (Moeljarto Tjokrowinoto. 3.Jackson (1978) dalam konteks Indonesia. yaitu kecendrungan birokrasi semakin menguasai masyarakat. konsep ini diamati secara serius karena mendiskusikan tentang pejabat-pejabat negara yang menjalankan tujuan-tujuan demokrasi. Posisi infrastruktur politlk vis-a-vis suprastruktur politik secara relatif lebih kuat. apalagi konsep birokrasi sebagai kekuasaan yang dijalankan oleh pejabat.Muhadjir Darwin yang menyimpulkan bahwa birokrasi di Indonesia sedang “sakit” dengan titik tekanannya berdasarkan hukum Parkinson. yang dapat mendistribusikan secara merata hasil dari perjuangan masyarakat tersebut. konsep masyarakat politik birokratik yang dikembangkan pertama sekali oleh Fred Riggs (1966) dan digunakan oleh Karl D.Kedua. dan kelompok kepentingan semuanya lemah dan tidak mampu melakukan kontrol terhadap birokrasi. sedangkan parameter birokrasi “ sehat “ yang dijadikan sandaran adalah konsep birokrasi weber . proses parkinsonisasi yaitu proses dimana birokrasi cendrung menuju kedalam keadaan patologis sebagaimana pernah diduga kuat oleh C. pejabatbenar-benarmernilikikekuasaandantugasyangsemakinbesarsehingga jabatan tersebut harus dijalankan secara bijaksana . terwujud konfirmasi. pejabat menuntut kekuasaan terlalu besar dan perlu dikembalikan pada fungsinya semula. Menurut teori. proses orwelisasi. 2.(Muhadjir Effendy. Perlu dipertanyakan apakah tindakan tergantung pada bagaimana nilainilai demokrasl Itu ditafsirkan dan mana diantara penafsiran itu yang dipandang salah. masa diluar birokrasi secara politis dan ekonomis pasif.

Keberadaan birokrasi-birokrasi semacam itu tidak merusak nilai.203). yang meminta negara untuk menyelesaikannya dan meminta negara melayani hal tersebut sebagai contoh yaitu negara yang demokratis.. adanya tuntutan negara semakin berkembang terus. Sedikit kepatuhan sudah merupakan suatu kondisi bagi demokrasi. dorongan yang bersifat sosial. yakni dengan memantapkan organisasi-organisasi sifatnya yang lebih birokratis daripada berupa pengaturan secara demokratis. ©2003 Digitized by USU digital library 4 d.nilai demokrasi.Meyer . baik juga untuk rnasyarakat. yaitu : tuntutan dari rnasyarakat sehingga membuat birokrasi menjadi lebih besar peranannya. hal ini berarti mengurangi demokrasi. Demokrasi dan birokrasi sesungguhnya sangat diperlukan dalam proses pembangunan suatu negara . Adil dan perlakuan yang sama bagi seluruh penduduk ternyata membutuhkan seperangkat hukum yang kompleks da peraturan-peraturan administratif. yaitu pemberian tanggungjawab pada negara untuk melakukan sesuatu pada masyarakat. inilah yang disebut antitesis demokrasi. dengan demikian keadaan menjadi sulit bila masyarakat cendrung tidak mematuhi hukum. ada pandangan bahwa negara ©2003 Digitized by USU digital library 5 sebagai penggerak pembanggunanan nasional dan negara diasumsikan sebagai fungsi yang strategis. setidak-tidaknya masyarakat harus memberikan pengertiannya karena pada kenyataannya jumlah polisi tidak cukup banyak di dalam melakukan kontrol atas penerapan hukum. dan W. karena belum tentu yang dilakukan birokrat baik. sehingga ada kesan terpaksa untuk memenuhi kewajiban perpajakan. tentu saja birokrasi dapat memerintah masyarakat tanpa Menimbulkan perlawanan mereka Namun sebagaimana kita juga pemah belajar dari masa lampau. Dalam jangka pendek. untuk dapat berfungsi. karena freewill terbatas untuk masyarakat. sehingga sulit untuk mencapai tahap masyarakat yang "marginal detterence". Nilai-nilai demokratis tidak saja berarti tujuan-tujuan masyarakat yang ditentukan oleh keputusan mayoritas.. Gejala tumbuhnya birokrasi yang terlarnpau kuat diungkapkan oleh Fred W Rigg ketika ia rnelakukan penelitiam modernisasi di Thailand yang kemudian muncul . dan sulit menciptakan masyarakat yang sadar pajak dalam sistem yang diterapkan untuk meningkatkan penerimaan negara. karena ciri. Ibarat seorang pencuri bertobat untuk tidak akan mengulangi perbuatannya karena dia takut kepada Allah (sadar bahwa mencuri itu perbuatan dosa).tetapi pada kenyataanya selalu menimbulkan masalah. Pada dasamya masyarakat lebih menginginkan terciptanya kesadaran daripada kepatuhan. kerelaan yang pertama-tama bersifat pasif pada akhimya membangkitkan rasa ketidakberdayaan.Blau. doronganekonomi.1987: 202.Kepatuhan tanpa syarat pada hakikatnya menghindari kritik dan ketidaksepakatan yang menjadi inti demokrasi (Peter M. 3. 2. dorongan politik. Birokrasi sulit untuk direm karena ada dorongan dari dalam (birokrat itu sendiri) ataupun dari luar seperti : 1.. Hal ini kemudian dicetuskan dalam bentuk protes yang mengacaukan suasana. Marshall.Dampak Kekuasaan Birokrasi Terhadap Kondisi Demokrasi kekuasaan birokrasi menimbulkan pertanyaan yang menyebabkan para ilmuan mulai berpikir. daripada takut karena adanya ganjaran hukuman yang menantinya. Bila kita lihat contoh di Indonesia. Apabila kita menunggu sampai suasana itu benar-benar terjadi. Jika birokrasi berlebihan maka masyarakat dirugikan karena masyarakat punya otonomi yang terbatas. Bila pemerintah harus memaksa kepatuhan yang sepenuhnya. kalau mentalnya masih mental pencuri. bahwa masyarakat wajib pajaknya sudah lelah dengan seabrek peraturan yang harus dipatuhi. tetapi juga bahwa tujuan-tujuan tadi diterapkan melalui metode-metode efektif yang ada.ciri organisasi yang diharapkan terlalu ideal sehingga kadang kala belum tentu cocok dengan kondisi atau situasi di suatu negara. akan tetapi semakin kuat birokrasi dalam negara maka akan semakin rendah demokrasi dan sebaliknya semakin lemah birokrasi maka akan semakin tinggi demokrasi.

apa yang menjadi tantangan masa depan. Birokrasi merupakan salah satu sarana bagi kekuasaan negara untuk memperkuat posisi politik dan merupakan sumber legitirnasi politiknya. Allison mendeskripsikan 4 model kebijakan yaitu : 1. yang menempatkan birokrasi melalui pemasukan nilai budaya masyarakat yang dominan sebagai suatu kekuatan tersendiri dalam mempengaruhi sistem politik dan perilaku politik elit kekuasaan (Karl D. Model Incremental. masalah-masalah dan kesempatan untuk memilih (Charles . menurut model ini hasil pembuatan keputusan secara kebetulan dipengaruhi 4 komponen yaitu : para partisipan. ©2003 Digitized by USU digital library 6 Modal kebijakan merupakan pendekatan yang akan dipakai dalam merekonstruksi birokrasi dan demokrasi. 3.Para aktor politik bisa menilai konsekuensi-konsekuensi positif dan negatif. Model Garbage Can. akan tetapi hubungan antara tujuan dan kebijakan-kebijakan utama tidak selalu jelas. Birokrasi dan Demokrasi melalui penjelasan tersebut ibarat dua sisi dari mata uang yang sama. dalam Karl D. B. contohnya : kebijakan pengentasan kemiskinan. apa perlu kebijakan direvisi atau direform. merupakan kebijakan yang mencari tujuan yang pasti. birokrasi dan demokrasi sangat diperlukan dalam kegiatan negara dan masyarakat. hat ini menandakan bahwa birokrasi bukan pemerintahan rakyat tetapi mengembalikan peran negara sebagai arbiter (perantara). namun menjalar sampai kepada kegiatan ekonomi sosial budaya termasuk juga ideologi. Berdasarkan studi Guelermo O'Donnel bahwa negara telah muncul sebagai kekuatan politik yang tidak hanya relatif mandiri berhadapan dengan faksi-faksi elit pendukungnya serta masyaraklu sipil. merupakan kebijakan yang dimulai dengan melihat kebijakan yang ada. Frank J. Sementara demokrasi merupakan keinginan dari sebagian besar rnasyarakat untuk rnendapatkan keberdayaan sehingga proses tawar menawar antara state dan sipil society dapat berkembang dengan baik khususnya dalam kerangka pengembalian keputusan politik sebagaimana prinsip-prinsip dasar dari demokrasi itu sendiri. 1990 : 82) . AIPI LIPI Jakarta 1991: 68). Pendekatan ini sering juga disebut organisasi anarki.Rekonstruksi Birokrasi dan Demokrasi Melalui Beberapa Pendekatan. merupakan model yang ideal dengan melihat proses kebijakan sebagai suatu proses yang sangat rasional dimana policy maker atau aktor-aktor yang terlibat dalam proses kebijakan dianggap memiliki persepsi yang jelas tentang tujuan yang akan dicapai (Charles H Levine. Keterlibatan negara tidak hanya dalam bidang poitik formal. Studi Fred W Rigg tentang Bureaucratic Polity dan GuelermO'Donnel tentang Bureaucratic Authoritarian nampaknya menggarisbawahi bahwa dalam masyarakat tertentu posisi birokrasi sudah berada di bawah kontrol politik kekuasaan dalam rangka mendapatkan sumber legitimasi politik melalui sarana birokrasi.Guy Peters. Thompson.jackson. Proses kebijakannnya sering kali tidak dimulai dari titik nol karena selalu dimulai dengan kebijakan yang ada sehingga standard operating procedurenya terlalu kuat. 2. 1987:4). berkolaborasi dengan kekuasaan pemerintah. tetapi turut melakukan kebijakan berupa tindakan membela si miskin sebagai suatu pertanda merekonstruksi demokrasi.dengan konsep "Bureaucratic Polity" yang menggambarkan betapa birokrasi di Thailand telah memasuki suatu jaringan kehidupan politik dan ekonomi yang sangat kuat yang dilakukan oleh negara terhadap kehidupan masyarakat. solusi. adanya kesadaran para aktor dalam birokrasi sehingga mengambil nilai tertentu yang siap dimaksimalkan pemerintah. e. Jurnal IImu Politik No.Pye. terutama dalam upaya mencegah massa rakyat di bawah keterlibatan politik yang terlampau aktif agar proses akselerasi industrialisasi tidak tergangggu (Guelermo O'Donnel dalam Muhammad AS Hikam. Synoptic Model. Dalam hal ini birokrasi tidak hanya penerima kebijakan dari pejabat-pejabat politik. Otoritarian Birokratik memang diciptakan untuk melakukan pengawasan yang kuat terhadap masyarakat sipil. akan tetapi keduanya justru menunjukkan tingkat perbedaan yang mendasar dan kalaupun memungkinkan dapat dipertemukan satu sama lain melalui rekonstruksi antara keduanya.8.Jackson dan Lucian W. maka model O'Donnell birokrasi itu tidak hanya berkolaborasi dengan kekuasan tetapi juga melibatkan diri hampir di semua bidang kegiatan.Jackson untuk studinya tentang birokrasi di Indonesia. dalam konsep yang sama Karl D. tetapi ia telah menjadi kekuatan dominan yang marnpu mengatasi keduanya. Jika dalam studi Rigg birokrasi.

belum nampak adanya minat yang cukup besar dikalangan para pimpinan organisasi politik mengenai reformasi administrasi. dalam orasi ilmiah yang disampaikan pada kuliah perdana program MAP UNT AG. Strategi Birokrasi yang Diterapkan Di Indonesia melalui Contoh kasus Reformasi Perpajakan. 1990 :83. karena hidupnya dari gaji yang diperoleh dari pajak rakyat dan bukan malah menjadi alat untuk menekan rakyat. Menteri Sumarlin mengadakan reformasi pada sistem remunerasi pegawai negeri. yang menimbulkan dorongan yang kuat pada birokrasi yang cendrung lebih mempertahankan status-Quo daripada reformasi. memperjungkan atau membangun strategi-strategi sendiri dengan koalisi.84) 4. Reformasi administrasi perlu dilancarkan sebagai bagian dari pembangunan politik. 1994 :3). Thompson.B Guy Peters. maka dapat tercipta sistem tersebut sehingga mampu mendukung demokratisasi politik. J.Frank J. f. sehingga reformasi administrasi tidak pernah menjadi fokus perhatian tetapi hanya sebagai pendukung pembangunan ekonomi . beberapa teknokrat dalam birokrasi mencoba mengadakan upaya-upaya reformasi . . terutama melalui pengaruh jalur-jalur A dan B di Golkar.Guy Peters.H. Model Birokratik Politik. jika kita mengacu ke negeri sendiri yaitu Indonesia. ©2003 Digitized by USU digital library 7 Sumarlin dan Saleh Affif ketika beliau-beliau tersebut menjadi Menteri Penertiban Aparatur Negara pada Kabinet Pembangunan I. Pada waktu yang lalu.Frank J. Berdasarkan beberapa model yang ditawarkan. para birokrat agak alergi karena daya inovasi kaum birokrat dipengaruhi oleh advokasi dari para pimpinan politik yang harus diyakini melalui reformasi tersebut. 2.B. merupakan bagian yang tidak dapat terpisahkan dari upaya mencari wilayah dinamika dari studi pembangunan politik yang akan meningkatkan kehidupan politik ideal yang demokratis. Kurang berhasilnya reformasi administrasi di Indonesia selama kurun waktu PJPT-1 ini nampaknya dipengaruhi paling tidak oleh 2 faktor : 1. Posisi saling berhadapan antara birokrasi yang mewakili lembaga negara dengan civil society yang berada pada posisi masyarakat. reformasi tersebut belum mampu menciptakan suatu snow ball reformasi administrasi yang terus sustainable dan akhirnya mampu menciptakan sistem adrninistrasi yang handal dan dapat bargaining mendukung pembangunan ekonomi politik (Sofian Effendi. Menteri Emil Salim berhasil mengadakan reformasi pada organisasi dan tala kerja departemen. Problema birokrasi yang melanda negara Indonesia dengan adanya pelaksanaan peraturan dan juga yang semakin banyak. Bila aparatur administrasi mampu mendukung pembangunan nasional.Thompson. g. bergaining atau kompromi sesuai dengan tujuan yang ia miliki. Situasi Problematis yang teriadi di Indonesia. liberalisasi dan industrialisasi ekonomi Indonesia. aliansi yang kuat antara birokrasi dan organisasi politik. maka ada kecendrungan kita memakai model Incremental. Pembuatan keputusan-keputusan poitik nasional amat didominasi oleh pemerintah dan kesan seperti itu sukar dibantah.(Charles H. seperti yang dilakukan oleh Emil Salim.1990: 84). Sepertinya mendengar kata reformasi. Namun. telah menimbulkan politisasi birokrasi yang berlebihan. dimana terlalu banyak prosedur dan standard operating procedure terlalu dinomorsatukan atau dijadikan sebagai salah satu instrumen yang digunakan oleh pemerintah pusat. dan Menteri Saleh Affif mengadakan reformasi untuk menggairahkan kegiatan ekonorni melalui serangkaian kebijakan deregulasi. Reformasi tersebut dapat dilaksanakan walaupun pada kurun waktu tersebut birokrasi Indonesia secara umum masih konservatif dan belum terbuka terhadap perubahan.evine. Padahal seharusnya birokrasi bekerja untuk rakyat. punya agenda masing-masing. kuatnya dominasi ekonomi perencanaan pembangunan nasional.Levine. merupakan proses pengambilan keputusan dalam melibatkan banyak aktor/kelompok-kelompok kepcntingan yang masing-masing punya nilai atau kepentingan sendiri. kurang mampu mendorong empowering masyarakat karena birokrasi melihat masyarakat dari kaca mata bagaimana masyarakat melaksanakan peraturan dan bukan melihat bagaimana inisiatif masyarakat itu sendiri sehingga ada kesan pemaksaan yang dapat menimbulkan benih-benih konflik yang mengakibatkan rakyat sebagai lawan dari birokrasi.II dan III.

Pada dasarnya pemungutan pajak rnerupakan perwujudan atas kewajiban kenegaraan dan partisipasi anggota masyarakat dalam memenuhi keperluan pengelolaan negara dan pembangunan nasional. maka dalam menyusun sistem yang baru. Keenam. hanya saja situasi dan kondisinya belum memungkinkan. obyek pajak. tingginya tariftarif tersebut sehingga menimbulkan rangsangan untuk menghindari pajak mela1ui berbagai cara. Ketiga. menuangkan kebijakan perpajakan ke dalam suatu konsep dalam bentuk perundang-undangan yang ketat. peraturan-peraturan pajak yang beraneka ragam.Melalui tulisan ini ada strategi positif yang dapat memperbaiki kelemahan birokrasi menuju demokrasi di Indonesia dengan mengambil contoh yang pemah terjadi di Indonesia yaitu Pelaksanaan Reformasi Perpajakan. Kelima. Sedangkan administarsi perpajakan adalah cara. Kebijaksanaan perpajakan merupakan pemilihan unsurunsur tertentu dari berbagai alternatif yang didasarkan atas sasaran yang ingin dicapai. hukum perpajakan dan administrasi perpajakan.. terdapat bermacam-macam tarif pajak baik untuk perorangan maupun untuk perseroan. Pada awal tahun 1981. bernegara dan berpemerintahan. Pada sistem lama.pokok dan hasil dari misi-misi pembaruan perpajakan di beberapa negara.. sasaran perpajakan semata-mata untuk pemerintah penjajah Belanda dengan berkedok pengisian kas negara tetapi nyata-nyata digunakan untuk kepentingan kolonial. tatacara pemungutan pajak yang berbelit-belit. Langkah kedua. Dari keenam kelemahan yang terjadi pada sistem yang lama. dibentuk Komite atau Panitia Pengarah dengan mengikutsertakan beberapa pejabat dari jajaran Departemen Keuangan. maka para pemikir ekonomi Indonesia pada tahun 1980-1981 sudah mengenal pokok. para menteri bidang Ekonomi Keuangan dan lndustri (EKUIN) serta beberapa anggota lembaga perekonomian mempertimbangkan bahwa rencana pembaruan perpajakan di Indonesia dengan menggunakan batasan tahunan dan bukan bulanan. baik karena kemungkinan mendapat tantangan dan antipati dari rakyat yang memang telah lama mengalami trauma dan sindrome pajak pada masa penjajahan. terdapat berbagai jenis pajak sehingga menimbulkan ketidakjelasan bagi masyarakat dalam memenuhi kewajibannya.. adalah hukum pajak atau hukum fiskal yaitu keseluruhan peraturan yang meliputi wewenang pemerintah untuk mengambil kekayaan seseorang dan menyerahkannya kembali kepada masyarakat melalui Kas Negara. yang dalam banyak hal. diperhatikan saling keterkaitan antara tiga unsur pokok pemungutan pajak. demi tercapainya keadilan sosial dan kemakmuran yang merata.Keempat. Langkah ketiga. Direktorat jendral Bea dan Cukai serta Direktorat Jendral Moneter. dimana yang bertindak sebagai pelaku administrasi pajak di Indonesia adalah Direktorat Jendral Pajak. keputusankeputusan tersebut menggambarkan pemanfaatan hasil-hasil kegiatan yang sejenis di negara-negara lain. sehingga menimbulkan kesan membingungkan dan bahkan terdapat pembebanan pajak berganda. Dari paparan di muka . diarnbil Beberapa keputusan tingkat menteri dalam hal strategi dan teknik untuk pembaharuan perpajakan Indonesia. Komisi tersebut berfungsi . sehingga menimbulkan kecendrungan masyarakat wajib pajak kurang turut bertanggung jawab dalam memikul beban negara yang pada hakikatnya untuk kepentingannya sendiri dalarn bermasyarakat.Kedua pelaksanaan kewajiban perpajakan sangat tergantung pada aparat perpajakan. Sebagai bahan kajian bahwa dalam perundang-undangan pajak lama terdapat beberapa permasalahan dan sekaligus kelemahan yang perlu disoroti yaitu: ©2003 Digitized by USU digital library 8 Pertama. termasuk beberapa ©2003 Digitized by USU digital library 9 diantaranya dari jajaran Direktorat Jenderal Pajak. maupun karena menyusun sistem yang barn tidaklah mudah. tampaklah bahwa sesungguhnya pada masa lalupun telah ada upaya-upaya untuk mengadakan pembaruan sistem perpajakan. Dalam rangka memecahkan problematik yang terjadi pada waktu itu. tarif pajak dan prosedur pajak.Keputusan itu dikelompokkan dalam 8 langkah kebijakan sebagai berikut : Langkah pertama. Ketiga unsur tersebut adalah kebijaksanaan.Hal yang kedua. Pemilihan unsur-unsur tersebut berkenaan dengan subyek pajak.cara dan prosedur pengenaan serta pemungutan pajak.

sehingga kekuasaan kepemimpinan politik mampu membuat birokrasi bertanggung jawab terutama alas dasar kepentingan publik.Bautista dkk.44.. Meskipun seringkali didengungkan masalah kebersamaan dan demokrasi di dalam organisasi Direktorat Jendral Pajak tapi kenyataannya kekuasaan lebih ditentukan oleh landasan rasional sehingga masalah organisasi harus didahulukan daripada masalah pribadi. telah terbukti bahwa usaha birokrasi untuk merekonstruksi demokrasi tidak bisa lepas dari politik publik.mengarahkan. secara jujur harus diakui bahwa sebagian besar menekankan pentingnya mental aparatur pajak mendapat perhatian pemerintah. Berdasarkan pengalaman sejarah. T. telah diundang tenaga ahli dan tokoh-tokoh terkemuka yang sangat berpengalaman dan bereputasi Intemasional dalam bidang perpajakan. melibatkan ©2003 Digitized by USU digital library 10 kepentingan pribadi di atas kesejahteraan umum. Keikutsertaan para ahli tersebut baik akademisi maupun para profesional dan pejabat yang berwenang di dalam negeri dimaksudkan untuk memperoleh proses dan pemecahan masalah dalam pengerjaannya. di samping tenaga ahli ekonomi dan hukum. menerapkan langsung hasil dari tiap-formulasi tanpa menunggu laporan hasil keseluruhan paketnya. Setelah sampai rancangan tersebut ke DPR. Dalam rangka pengkajian masalah pembaruan sistem perpajakan di Indonesia. namun tetap rnemperhatikan berbagai pendapat dari kelompok-kelompok yang ada dalam masyarakat.45). Direktorat Jendral Pajak dan Tim dari Luar Departemen Keuangan. Diperlukan juga tenaga-tenaga ahli dalam bidang-bidang lain seperti ahli administrasi perpajakan akuntan. kalangan masyarakat dan berbagai sudut pandang yang memberikan tanggapan. mengawasi dan berperanserta langsung dalam penelitian yang dilakukan oleh tim tenaga ahli asing yang mungkin akan digunakan. korupsi. mengharuskan agar usaha persiapan ini dilakukan secara biasa saja tanpa publikasi besar-besaran . ini tidak akan jadi persoalan bila birokrasi tetap dipandang sebagai instrumen negara. sehingga diharapkan timbul kesadaran. Langkah ketujuh. swasta maupun para ilmuwan dari berbagai disiplin ilmu. baik itu pendidikan formal maupun pendidikan informal untuk memulai kaderisasi pejabat pajak yang terlatih baik. mengenai mana yang benar dan mana yang salah. pengertian dan pemahaman yang tulus. Langkah keenam.pilihan kebijakan yang memuaskan klien-klien tertentu. mana yang haq dan mana yang bathil. Langkah keempat. Langkah kedelapan. juga membuat kebijakan dan mengimplementasikannya berat sebelah (LV . sehingga mampu mendorong birokrasi untuk meningkatkan responsivitas mereka terhadap keinginan rakyat . Dari para anggota DPR yang pada umumnya dikenal sebagai tokoh-tokoh masyarakat yang vokal. 1993 : 119 -140). kebijaksanaan untuk memulai sistem perpajakanan yang baru secara keseluruhan tanpa sedikitpun mengambil bagian-bagian dari sistem yang lama. Responsive terhadap tuntutan rakyat. baik dari luar maupun dalam negeri untuk memberikan pengalamannya sekaligus menguji konsep pembaruan sistem perpajakan di Indonesia. Dari banyak tanggapan spontan yang muncul pada hari-hari paertama pengajuan RUU ke DPR. baik kalangan pemerintahan.Carino. Ambisi utama daripada sistem birokrasi adalah tercapainya efisiensi kerja yang seoptimal mungkin tapi bukan malah mempolitisikan birokrasi dengan pilihan.(Salamun A. disamping tim pengarah ada lagi tim yang dibentuk oleh Departemen Keuangan. menyiapkan latihan dan pendidikan bagi para pejabat perpajakan. dimana kekuatan-kekuatan sosial dan negara mengarahkan birokrasi kesana. Langkah kelima. dan ilmu teknologi komputer dalam pekerjaan studi pembaruan sistem perpajakan di Indonesia. . Seperti telah dijelaskan. selama proses pembahasan di DPR banyak pihak dari berbagai disiplin ilmu. saran dan juga kritik tajam. 1990 :43. memperluas wawasan pembaharuan sistem perpajakan sehingga mencaku bidang-bidang yang sebelumnya tidak merupakan obyek pajak.

hanya karena adanya keberadaan symbol institusi dari demokrasi. Dugaan bahwa dinamika komplek terpotret melalui bargaining dalam sector public yang memungkunkan terjadi manipulasi dalam pengelolaan sector public. Ini dilakukan untuk menghindari kegagalan implementasi dan kritik keras terhadap birokrasi. pada sisi lain otonominya sebenarnya sedang ditekan oleh politisi melalui paradigma baru. Dilema yang muncul adalah birokrasi harus professional dan responsive tapi. Pada konteks organisasi public. tekanan kekuasaan dan dinamika dibangun sistematis di dalam menjalankan. sepert terwujudnya good governance. DPR. telah dimanfaatkan oleh kepentingan politik ditengah arus demokratisasi. Melalui institusi Presiden dan Wakil Presiden dengan Wakil Rakyat. Di sisi berhadapan birokrat begitu kuat menjaga motif nilai manajer departemen. Reformasi politik. karena reformasi administrasi sering direduksi pada tatanan tehnis. Birokrasi dan jebakan politik Orde baru melalui bureaucratic polity. yakni DPR.ORMASI ADMINISTRASI DAN PARADOKS DEMOKRASI Ini menjelaskan tentang perselingkuhan antara birokrasi dengan elit politik yang semakin inten. Kebijakan yang dirumuskan dianggap sah dan demokratis. Birokrasi sebenarnya tidak akan bisa netral. eksekutif melalui birokrasinya terbawa tuntutan reformasi administrasi melalui paradigma pasar. Dua hal penting model bureaucratic polity eksis: . Disini demokrasi dikesampingkan.

Tulisan ini tidak menjelaskan jarak antara birokrasi dengan elit politik dalam dinamika administrasi publik di Indonesia. Adanya dikotomi administrasi dan politik dijelaskan dengan konteks yang spesifik. 1. 2. Decision making benarbenar diperankan oleh arena inti proses kompetisi politik yang dibangun diluar birokrasi sesungguhnya. tiga komponen dinamika politik terkait dengan birokrasi menggejala: komponen political competition. Struktur dikotomi dilihat dari sisi struktur formal. Birokrasi yang selalu dituntut responsif sesungguhnya sedang mengalami tekanan elit politik. namun bersifat informal di sekitar presiden.tanpa memperdulikan rakyat yang akan terkena dampak langsung. Daripada kekuatan penuh dicapai meluli kompetisi interpersonal di lingkaran elite di fisik yang tertutup dekat presiden. komponen actor. Sehingga yang tersisa di mata rakyat hanyalah kekuasaan dari birokrasi. Proses politik pada tingkat ini bisa sangat kompleks. . bureaucratic polity tidad jauh beda dari bentuk pemerintahan olek derajat untuk decision making nasional daerah kekuatan sosial dan politik keluar pejabat tidak tinggi bagi modal kota. demokratisasi yang diusung dan diyakini akan membawa perubahan yang besar di Indonesia justru telah memanipulasi sektor publik melalui instrumen reformai administrasi yang sedang populer. Pertautan keduanya terjalin dengan bungkus rapi dibalik mekanisme demokrasi. Actor inilah komponen yang pertama. Birokrasi sebagai komponen dari suatu pemerintah dari pusat sampai dengan daerah politik. Birokrasi melalui aparat negara begitu kuat menjaga nilai manajer yang diinternalisasikan dari nilai politiknya pada kebijakan tersebut. 2. Namun. para pejabat yang memiliki kewenangan formal.1. Dinamika interaksi politik dengan birokrasi pada pemerintahan hasil pemilihan secara lansung. Justru tulisan ini akan menjelaskan adanya kedekatan elit politik dengan birokrasi. daerah utama untuk kompetisi politik tidak di negara yang besar dan kekuatan tidak dicapai terus memperbaiki bagi banyak gerakan. Pada sisi yang lain. Setiap kebijakan yang dirumuskan dianggap sah dan demokratis oleh DPR yang dianggap simbol institusi dan demokrasi.

Dinamika komplek tersebut terlihat melalui politik bargaining dalam sektor publik yang memungkinkan terjadinya manipulasi dalam pengelolaan publim sektor.Oleh karena itu. sehingga kemungkinan adanya bargaining dan cheating ada meski dalam era demokratisasi dan kampanye good-governance. Hal ini dilakukan agar terhindar dari kegagalan implementasi dan nilai negatif birokrasi. Reformasi birokrasi dimanfaatkan oleh kepentingan politik ditengah arus demokratisasi.Pada konteks organisasi publik. memberikan implikasi pada ricuhnya kebijakan publik. perubahan dari partai attachment menjadi personal attachment dan terjadinya transformasi kepentingan elit menjadi kepentingan publik sehingga dapat menyebabkan pemerintah lamban dan tidak responsif. Namun disisi lain. Interaksi yang terjadi bukan saja politisi memanfaatkan eksekutif. bahwa pada sisi birokrasi dituntut untuk selalu profesional dan responsif. Birokrasi Pemerintahan (Bureaucratic Government) Interaksi politik dan birokrasi terjadi begitu inten dalam dinamika pemerintahan kita. World bank). setiap kebijakan yang dibuat selalu bias dengan kepentingan politik. Sistem pemilu secara langsung yang diterapkan. birokrasi ditekan oleh politisi melalui nilai-nilai dari paradigma baru tersebut. termasuk tekanan global (IMF. tapi eksekutif dan birokrasinya menghendaki hal tersebut sebagai bagian dari balas jasa kampanye pemilihan presiden langsung dan untuk mengamankan kekuasaannya dan hal . Hal tersebut dapat terjadi di pusat maupun daerah (pemilihan kepala daerah secara langsung). para ekskutif melalui birokrasinya terbawa tuntutan reformasi administrasi seperti terwujudnya good governance. Dilema yang terjadi adalah. contoh konkritnya dapat dilihat dari Pilkada secara langsung.

Kategori Village Life Menjelaskan bahwa baik aparat atau elit politik memiliki latar belakang sosial ekonomi. ada 2 bentuk model. tetapi ada cara-cara yang tidak demokratis yang berakibat pada implikasi pemerintahan yang otoriter. sedangkan Peters dan Pierrs (2001:5) memahami pola interaksi politisi dengan birokrasi lebih mendalam (intensitas terinternalisasinya nilainilai demokrasi) dan terkesan overlapping (birokrasi dan politisi). Model birokrasi yang berada pada posisi intermediate ada 2 kategori.yang mengakibatkan birokrasi yang awalnya sama akan ada posisi yang lebih tinggi sehingga perlu dikontrol. yaitu:1. or co-quality with the executive. Pada sisi yang ekstrim.tersebut dianggap hal yang normal. yaitu : a. kepentingan. Menurut Carino. mereka memetakan interaksi kedunya dalam bentuk tumpang tindih karena internalisasi nilai-nilai demokrasi. Menurut kerangka yang dikembangkan Carino. Bureaucratic sublation of. pola interaksi tersebut secara teoritis akan menempatkan siapa dimana/dominasi birokrasi ataukah birokrasi sederajat dengan politisi. padahal didalamya terdapat manipulasi kepentingan rakyat yang berarti kepentingan demokrasi. Value normatif pada kategori ini adalah value yang memiliki orientasi pada efektivitas dan produktivitas lembaga. . Executive ascendancy seperti bentuk dikotomi politik administrasi yang murni (Carino. dan pengalaman yang sama. sesungguhnya pemerintahan yang demikian sedang berusaha tampil secara demokratis. Posisi ini sama dengan yang pertama. 2. ada kemungkinan penyalahgunaan posisi.1992:4). sehingga negara yang sedang melakukan konsolidasi demokrasi memungkinkan elit eksekutif memiliki akses dalam memainkan informasi dalam birokrasi. Kategori Functional Village Dari perumusan kebijakan / policy sampai dengan implementasinya / pelaksanaannya semuanya tertata rapi. b.

dimana birokrasi negara kita sedang mengalami himpitan permainan elit politik. Sebagai contohnya adalah pemanfaatan konsep oleh IMF dan World Bank dalam rangka good governance. Dalam model ini terjadi kompleksitas politik yang cukup tinggi pada tingkatan organisasi. Multi lever mengembangkannya dalam konteks interaksi antara lembaga lokal. Para elit politik tersebut mendapatkan ruang yang lebih luas dalam wilayah birokrasi. Sehingga kesannya. Dan yang terkhir adalah dalam konteks interaksi publik dan private. Reformasi akan merubah tatanan yang telah ada sebelumnya dengan meredefinisi dan resistensi untuk menuju keberhasialn.Model birokrasi yang dibahas disini adalah model Bureaucratic Government. di kembangkan melalui konsep tentang governance framework. para pejabat tersebut lebih mementingkan kepentingan golongan atau partainya. Global Governance juga berkembang melalui level hubungan internasilonal. Hampir semua pejabat di Indonesia dipilih berdasarkan politik. Reformasi administrasi terjadi melalui tahapan yang kompleks dan melibabtkan banyak kepentingan. regional. yaitu Governance. governance telah di gunakan untuk penelitian-penelitian tentang peran pemerintah dalam melakukan koordinasi di sektor . nasional. dan transnasional. mengapa banyak kebijakan publik di Indonesia sekarang ini memiliki kecenderungan yang mungkin saja berpotensi menyesengsarakan rakyat. Sedangkan dalam konteks policy analisis. Karena model birokrasi yang seperti itulah. Secara umum konsep ini telah di gunakan karena terkait dengan fokus kapabilitas dari pemeerintah dengan interaksinya dan interaksinya antara pemerintah dengan masyarakat. dan aktivitas operasional antar beberapa institusi. pemanfaatan konsep melalui Local Governance. Dalam konteks urban politics. daripada kepentingan rakyat. regulasi. Model ini juga sangat cocok dengan model Birokrasi Indonesia saat ini. Ide ini di kemas dalam konsep yang telah menjadi Political Catchword di seluruh dunia.

yang bisa juga di katakan merupakan gagalnya suatu administrasi negara yang di terapkan dalam konteks global yang terjadi di negara transisi seperti Indonesia ini. Komlpeksitas politik pada transisi demokrasi yang belum matang telah memutuskan link yang seharusnya terjadi atau di lakukan. yakni pada adopsi instrumen administratif tertentu yang kelihatan tehnis. Kenyataan yang seperti ini bisa mengakibatkan kegagalan. Sebagai contoh adalah NPM dan kasus BBM.ekonomi. Dalam kasus BBm. Peluang ini telah terbaca oleh politisi karena memanng organisasi publik sedang mengalami kesulitan untuk menggunakan instrumen baru ini. Dari awal kebijakan ini memang di kendalikan secara politis. Kasus BBM ini merupakan kebijakn yang sarat dengan tuntutan responsibilitas dari organisasipublik yang mendelivernya dan nilai-nilai kolektif yang lebih luas yang menyangkut masyarakat miskin. Seharusnya reformasi menghendaki pengelolaan yang sistematis. Ini merupakan permasalahan transfer nilai dari organissai privat ke organisasi publik. analisis lebih di fokuskan pada interaksi politik dan birokrasi. Intervensi paradigma ini juga akan mempengaruhi interaksi kekuasaan antara birokrasi yang di lakukan oleh pelatyan publik dengan politisi pada berbagai tahapan. Intervensi Paradigma ini lebih di fokuskan pada konteks reformasi administrasi saja. tetapi belum sepenuhnya berubah. Kenaikan harga BBM yang terus di paksakan dengan berbagai . Perkembangan ini terkait dengan krisis yang dialami oleh nega5a. maka politisi lebih leluasa memanfaatkan instrumen responsibilitas untuk kepentingan kekuasaan jangka pendek. ada proses perubahan internal organisasi dan juga lingkup eksternal pada suatu negara yang memungkinkan terjadinya reformasi tersebut. Dengan kenyataan lemahnya proses reformasi. Dalam penerapan reformasi administrasi ini seringkali di manfaatkan oleh politisi untuk mengambil keuntungan. Selebihnya. namun dalam intervensi global dan demokrasi telah membuka ruang yang lebih besar bagi politisi untuk bermainm dalam wilayah birokrasi ini.

kasus kenaikan harga BBM yang didukung oleh . Di indonesia antara politisi dan public servant tidak terjadi kerjasama yang baik dalam pemecahan masalah publik yang seharusnya secara demokratis dalam perumusan kebijakan dalam perumusan kebijakan dan responsivitas dalam implementasinya namun disini terjadi penipuan yang dilakukan publik servant dalam pelayanan publik. Dan lebih di tekankan lagi bahwa proses internalisasi instrument yang lemah akan memberikan peluang yang besar bagi politisi untuk memberikan suatu perfomance dari kebijakan tertentu. Dalam reformasi ini di manfaatkan oleh politisi melalui cara yang tidak demokratis. Padahal rezim seharusnya menentukan peraturan dasar dan kualitas dari interaksi antara bermacam-macam lembaga melalui kebenaran proses kebijakan dan gabungan nilai untuk mengelola masalah publik. Birokrasi kita sekarang ini masih sangat mengecewakan di dalam pelaksanaannya. Rezim kita sekarang ini telah gagal menentukan kualitas yang tinggi dalam mengelola masalah publik. Sementara akuntabilitas dalam reformasi administrasi merupakan instrumen yang penting. Contohnya. Yang kedua yaitu adanya kenyataan bahwa demokrasi yang diinternalisasikan masih dalam tahapan demokrasi formal. bureaucratic goverment di Indonesia merupakan birokrasi publik yang mengalami kebingungan arah dan ini terjadi di tengah perubahan ke arah demokrasi.penolakan melalui demonstrasi-demontrasi menunjukan rendahnya akuntabilitas organisasi publik. karena birokrasi tidak siap untuk berubah. Hal ini ditandai dengan banyaknya lobi yang dilakukan eksekutif untuk kepentingan kebijakan.maka ada dua hal yang penting yaitu : reformasi administrasi yang menggunakan beberapa instrumen yang memiliki nilai kontradiktif satu sama lain dalam dirinya sendiri karena nilai dari organisasi publik dan privat yang digeneralisasikan ternyata telah membuka peluang permainan politik. Melihat kenyataan tersebut.prosedural yang memberikan ruang pada elit politik untuk memberi instrument pada organisasi publik.

lanngsung maupun tidak langsung mewarnai nilai kebijakan melalui lembaga presiden atau wakil presiden yang secara langsung berhadapan dengan rakyat. dan rakyat. Jadi Reformasi administyrasi akan mempertemukan birokrasi. adalah reformasi pastilah produk keputusan politik dan bukannya administratif belaka.partai PKS dan PPP padahal dulunya menolak kenaikan BBM. serta pasar menjadi bagian stakeholder dalam reformasi administrasi. Jadi reformasi itu bukan sekedar masalah tehnis administratif. politisi. di mana instrument membawa persamaan politik. Logika tersebut di kembangkan dengan beberapa alasan. Semua ini terungkap ketika negara kita melakukan pemilu secara langsung. Kedua partai tersebut setuju dengan kenaikan BBM karena untuk mempertahankan kekuasaan mereka yaitu demi pertimbangan kadernya yang mendapatkan posisi sebagai menteri. politisi memainkan perannya untuk tidak melakukan perannya untuk tidak melakukan reaksi sama sekali terhadap resistensi yang di berikan oleh publik. Karena apabila reformasi hanya pada tahapan tehnis. pertama ide reformasi selalu datang dari kepentingan eksternal dan bahkan global. Hal ini dapat merugikan reformasi administrasi kita. maka instrumen yang digunakan akan sangat mungkin bernuansa dan di terjemahkan oleh kepentingan elit yakni politik. Dengan demikian birokrasi kita sekarang ini di bawah kontrol politisi. demokrasidan kesejahteraan rakyat miskin. Seharusnya reformasi administrasi di pahami sebagai sistem administrasi yang lebih efektif untuk perubahan sosial. Keempat. keadilan sosial dan pertumbuhan ekonomi. reformasi administrasi yang terbungkus dengan paradigma besar seperti demokratisasi dan globalisasi. . Ketiga. kedua kepentingan global tersebut tidak selamanya berdimensi tunggal.

Justru pelayanan publik berjalan ketika demokrasi di singkirkan. Hal itu di karenakan adanya pengawasan dan kontrol langsung oleh pemerintah pusat. Padahal dulu pada jaman pemerintahan Soeharto pelayanan publik lebih baik.Komentar: Indonesia adalah negara yang menganut model pemerintahan Demokrasi. dulu jika perintah itu tidak di laksanakan maka akan di tindak langsung. Para pejabat sekarang lebih mementingkan kepentingan pribadi dan golongannya daripada kepentingan publik atau rakyat. model pemerintahan demokrasi adalah model pemerintahan yang bebas mengeluarkan pendapat dan pemerintah mengutamakan suara rakyatnya di banding kepentingan pimpinannya. . Tetapi pada kenyataanya di Indonesia tidak berjalan seperti teorinya.

Sign up to vote on this title
UsefulNot useful