P. 1
Demokrasi Dan Partisipasi Publik

Demokrasi Dan Partisipasi Publik

|Views: 368|Likes:
Published by Tataa NymphSerenita

More info:

Published by: Tataa NymphSerenita on Nov 09, 2010
Copyright:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as DOC, PDF, TXT or read online from Scribd
See more
See less

03/11/2012

pdf

text

original

Demokrasi dan Partisipasi Publik

PendahuluanDewasa ini istilah demokrasi sering muncul di media massa Indonesia menjelang diadakannya pemilihan legilatif maupun kepala daerah (PILKADA). Tidak berbeda dengan pemilihan yang akan terjadi di lingkungan Rukun Tetangga (RT) 02 Rukun Warga (RW) 19 Dukuh Baturan Desa Trihanggo Gamping Sleman. Meskipun dalam skala dan lingkup yang kecil, tapi pesta demokrasi adalah hak dari warga negara untuk menentukan pimpinan di daerahnya yang dianggap layak dan mampu memegang amanat masyarakat. Secara terminologi, istilah demokrasi berasal dari bahasa Yunani kuno yang terdiri dari kata demos yang artinya adalah rakyat dan kratos/cratein yang berarti pemerintahan . Dalam bahasa Inggris, democracy artinya adalah pemerintahan yang berasal dari rakyat. Sehingga apabila makna dari kedua kata tersebut digabungkan maka demokrasi berarti pemerintahan rakyat. Sedangkan secara umum demokrasi didefinisikan sebagai pemerintahan yang berasal dari rakyat, oleh rakyat, dan untuk rakyat. Pemerintahan dari rakyat artinya adalah pemerintah yang memperoleh amanat merupakan anggota masyarakat yang dipilih dan kemudian diberi amanat oleh rakyat. Oleh rakyat artinya adalah pemerintahan yang dibentuk merupakan hasil dari kesepakatan bersama oleh rakyat sehingga daerahnya memiliki struktur pemerintahan sehingga menjadi teratur. Sedangkan untuk rakyat, memiliki arti bahwa pemerintahan yang dibentuk kemudian bekerja untuk mengabdi dan melayani rakyat tersebut sehingga masyarakat menjadi sejahtera. Inti DemokrasiKekuasaan tertinggi dalam demokrasi ada di tangan rakyat. Rakyat memiliki kedaulatan melalui suara yang digunakan dalam pemungutan suara dalam pemilihan umum. Dengan demikian suara rakyat menjadi penentu dalam pengambilan keputusan pada masyarakat tersebut. Pemilu memberikan kesempatan kepada rakyat

untuk memilih pemimpin yang dianggap paling layak dan mampu untuk mengemban amanat. Kemudian pemimpin yang terpilih akan memperoleh mandat dari rakyat untuk mengelola pemerintah melalui lembaga perwakilan rakyat. Lembaga perwakilan berasal dari anggota masyarakat yang bertugas untuk menjaga agar pelaksanaan pemerintahan tidak mengalami pemyimpangan. Lembaga perwakilan merupakan wadah bagi rakyat untuk menyalurkan aspirasi sehingga suara rakyat tersalurkan pada pemerintah. Rakyat juga bisa secara langsung memberikan masukan tidak hanya kepada lembaga perwakilan tetapi juga kepada pemerintah. Tindakan ini disebut dengan partisipasi publik (rakyat). Partisipasi adalah suatu proses dimana sejumlah pelaku bermitra punya pengaruh dan membagi wewenang di dalam prakarsa “pembangunan”, termasuk mengambil keputusan atas sumberdaya . Sedangkan Partisipasi publik secara sederhana diartikan sebagai keikutsertaan dan keterlibatan masyarakat dalam aktivitas kenegaraan. Wujud partisipasi publik bisa beragam, misalnya ikut pemilihan umum (pemilu), membayar pajak, menyampaikan aspirasi, keluhan, mengontrol pemerintah, dan lain-lain. Salah satu contoh nyata dari partisipasi publik adalah keikutsertaan dalam pemilihan umum (pemilu). Istilah lain dari pemilu adalah pesta demokrasi. Disebut demikian karena pemilu merupakan kegiatan besar menyerupai perayaan/pesta dimana rakyat berhak dan menjadi penentu dari perjalanan masyarakatnya. Pemilu pertama kali dilaksanakan pada jama Yunani Kuno untuk memilih anggota senat polis yang memberikan masukan kepada kaisar. Pada jaman tersebut pemilu dilaksanakan secara langsung dengan cara memilih calon anggota senat yang ada. Di samping itu, jumlah penduduk yang memiliki suara dalam suatu polis masih sedikit sehingga pemilihan bisa dilakukan secara langsung. Dewasa ini, jumlah rakyat di suatu negara sangatlah besar sehingga pemilihan secara langsung sering kali memakan waktu sehingga

Ketika seseorang memilih calon pemimpin. dan kepala desa adalah pemimpin. Oleh karena itu seorang pemimpin harus bertanggung jawab kepada rakyatnya dan menjalankan tugasnya untuk melayani rakyat. Pemilihan Presiden. Demikian halnya dengan rencana pemilihan Ketua RT 02 ini. Kepala pemerintahan memiliki tugas untuk mengatur tatanan kehidupan masyarakat sehingga berjalan . Ketika memilih seorang pemimpin berarti merelakan hak tersebut dilakukan oleh orang lain. Bupati/Walikota. DPR.dikenal pemilihan tidak langsung. Gubernur. Namun hal ini mendapat banyak kritik karena lembaga perwakilan seringkali tidak mewakili aspirasi dari rakyatnya sehingga pemilihan langsung tetap digunakan untuk memilih pemimpin masyarakat. Bupati. Pemimpin adalah individu yang diberi amanat untuk menjalankan pemerintahan. Hal ini juga berlaku kepada calon Ketua RT yang akan dipilih. Kepemimpinan dalam MasyarakatPemimpin adalah individu yang bertugas sebagai kepala pemerintahan. Rakyat memilih anggota lembaga perwakilan dan lembaga perwakilanlah yang memilih kepada negara tersebut. Walikota. Mengingat setiap individu memiliki hak yang sama untuk memimpin. Amanat dan kekuasaan yang dimiliki oleh pemimpin adalah pemberian rakyat dan bersifat sementara dan bisa dicabut. yang bersangkutan sebenarnya sama saja dengan mendelegasikan hak untuk menjadi pemimpin dan mengelola daerahnya karena setiap individu memiliki hak yang sama. Rakyat memiliki kedaulatan melalui suaranya untuk memilih dan menentukan pemimpin yang paling dipercaya untuk mengemban amanat. DPRD. Namun demikian hak tersebut tidak diserahkan hanya dipinjamkan dalam bentuk amanat dan rakyat bisa meminta kembali bahkan mencabut amanat/hak dipinjamkan kepada pemimpinnya apabila dianggap gagal atau melakukan penyimpangan. dan Kepala Desa dilakukan secara langsung. Presiden.

Setiap individu dalam masyarakat memiliki kepentingan yang berbeda-beda. Perbedaan kepentingan memungkinkan terjadinya benturan antar anggota masyarakat dan berakibat pada timbulnya perselisihan. Kekuasaan yang dimiliki merupakan tanggung jawab yang berasal dari masyarakat. Komunikasi yang baik harus berjalan sehingga menciptakan kedamaian antar wilayah. Masyarakat juga harus mematuhi ketentuan pemerintah yang bertujuan untuk kemakmuran masyarakatnya sehingga resiko terjadi konflik dapat dikendalikan. Keseluruhan tugas yang dimiliki oleh pemimpin adalah amanat dari masyarakatnya. Masyarakat dengan sukarela telah menyerahkan haknya menjadi pemimpin untuk dipimpin oleh orang lain. .dengan baik. Pemimpin dalam hal ini harus mengakomodasi kepentingan rakyat banyak sehingga pemenuhan atas kebutuhan yang menjadi hajat hidup orang banyak harus didahulukan. Masyarakat juga harus secara aktif melakukan pengawasan terkait pemanfaatan sumber daya daerahnya karena kekayaan daerah pada hakikatnya adalah milik masyarakat dan dipungut dari masyarakat oleh pemerintah meskipun pengelolaan diserahkan pada pemerintahan setempat. pemimpin haruslah memiliki visi yang baik sehingga masyarakat yang dipimpinnya memiliki tujuan. Seorang pemimpin harus menjadi wakil masyarakatnya dalam berhubungan dengan masyarakat yang lain. Masyarakat dalam menjalankan kehidupannya juga berhubungan dan berdampingan dengan masyarakat lain. Pemenuhan kebutuhan membutuhkan sumber daya yang dimiliki oleh daerah tersebut. Meskipun tidak memimpin sendiri. Pemimpin harus memiliki pengetahun dan wawasan yang luas sehingga mampu mewakili masyarakatnya untuk berkomunikasi dengan pihak lain. Sumber daya tersebut harus dikelola dan dialokasikan secara tepat sehingga sasaran yang dituju mengena dan tidak terjadi pemborosan. tapi dibantu oleh perangkat organisasi lain.

Hal ini bertujuan agar tugas-tugas yang dibebankan pada seorang pemimpin bisa berjalan dan berhasil. Keterlibatan warga sangat . Dengan kriteria tersebut. 3) Partisipasif: melibatkan masyarakat dalam musyawarah. Setiap warga juga wajib untuk melibatkan diri dalam berbagai kegiatan yang diselenggarakan oleh organisasi masyarakat di lingkungannya. Tugas masyarakat setelah seorang pemimpin berhasil dipilih adalah mematuhi dan menjalankan kebijakan serta peraturan yang dibuat untuk kepentingan masyarakat. Akuntabilitas adalah kewajiban untuk menyampaikan pertanggungjawaban atau untuk menjawab dan menerangkan kinerja dan tindakan seseorang/badan hukum/pimpinan kolektif suatu organisasi dalam penggunaan sumber daya yang ada. Hati nurani yang baik seharusnya bisa mengantarkan pemilihan pada seorang pemimpin yang terbaik di mata masyarakat. seorang pemimpin harus mempertanggungjawabkan tugasnya kembali kepada masyarakat. Ini adalah wujud dari akuntabilitas pemimpin kepada warganya. Dengan demikian masyarakat sebagai pihak yang memiliki sumber daya dan melimpahkannya pada pemimpin akan menilai keberhasilan pelaksanaan tugas yang diamanatkan. dan apa saja yang telah dicapai dengan penggunaan wewenang dan sumberdaya tersebut kepada pihak yang memiliki hak atau kewenangan untuk meminta keterangan atau pertanggungjawaban .Oleh karena itu. 2) Transparan (terpercaya): pengelolaan sumber daya bisa diketahui oleh masyarakat. Masyarakat berhak untuk memilih pemimpin sesuai dengan hati nurani yang dimiliki. yaitu: 1) Terbuka (jujur): bisa berkomunikasi dengan semua pihak. calon pemimpin diharapkan bisa mengemban tugas yang akan diletakkan di pundaknya. dan 4) Akuntabel (bertanggung jawab): menjalankan kegiatan yang bermanfaat untuk masyarakat. Terdapat beberapa kriteria untuk memilih pemimpin ideal. Oleh karena itu diperlukan kriteria pemimpin yang ideal.

Ini adalah wujud dari tanggung jawab moral warga terhadap pemimpin yang dipilihnya. Hak tersebut adalah untuk memilih dan dipilih menjadi Ketua RT berdasarkan kriteria yang telah disepakati. mematuhi. Dengan demikian semua orang yang menjadi warga di lingkungan tersebut memiliki hak yang sama. warga juga harus berpartisipasi secara aktif dalam melakukan pengawasan dan kontrol atas kegiatan yang diselenggarakan di wilayahnya. Oleh karena itu.penting dan tidak hanya pada pelaksanaannya tapi juga dalam perencanaan kegiatan. Yang bersangkutan harus legawa dan siap menjalankan tugas. PenutupPemilihan Ketua RT 02 di Padukuhan Baturan merupakan kegiatan dari warga. setiap individu harus siap menjadi ketua apabila dipilih oleh warga yang lain. Sedangkan warga yang lain harus menerima. dan mengawasi ketua baru demi RT 02 semakin maju di masa datang. . membantu. dan untuk warga. Selanjutnya. oleh warga. Dengan demikian kegiatan yang dilaksanakan benar-benar dibutuhkan dan mampu dirasakan manfaatnya secara luas.

1982 : 240). karir yang panjang. Namun apakah sudah menjadi hal yang sulit direform bahwa birokrasi selalu menghambat kemudahan. islam maupun non islam. Organissasi mengopcrasikan prinsip-prinsip dasar hirarki kantor dimana ada garis-garis yang jelas dari atasan dan bawahan. kekuasaan hirarkis. diantaranya usaha. karena organisasi birokrasi punya struktur yang jelas tentang kekuasaan clan orang yang punya kekuasaan mempunyai pengaruh sehingga dapat memberi perintah untuk mendistribusikan tugas kepada orang lain (Robert Denhard. Ciri organisasi yang mengikuti sistem birokrasi ini ciri. tidak imaginatif. Oleh karena itu lebih baik dijelaskan terlebih dahulu apa birokrasi dan demokrasi itu Bagaimana kontribusinya terhadap demokrasi Bagaimana posisi birokrasi dengan demokrasi melalui rekonstruksi bagaimana situasi problematik yang terjadi di Indonesia dan strategi seperti apa yang dapat diterapkan di Indonesia sehingga antara birokrasi dan demokrasi bisa direkonstruksi. M. kemajuan dan perkembangan suatu sistem politik khususnya memperkecil ruang gerak demokrasi. ©2003 Digitized by USU digital library 11984 : 26. kaku.Levine.usaha paling penting berupa implementasi Undang-Undang. DARA AISYAH.pengaruh dan para kepala dan star biro pemerintahan. a. orientasi impersonal. birokrasi di definisikan sebagai:"wewenang atau kekuasaan dari berbagai departemen pemerintahan. Menurut Weber organisasi birokrasi dapat digunakan sebagai pendekatan efektif untuk mengontrol pekerjaan manusia sehingga sampai pada sasarannya. Pembahasan birokrasi selalu menarik untuk dibicarakan baik sebagai bahan diskusi maupun sebagai bahan kajian ilmiah untuk diperdebatkan dengan tujuan mencari solusinya.” Birokrasi sebagai suatu sistem organisasi formal dimunculkan pertama sekali oleh Max Weber pada tahun 1947. boleh dikatakan artinya canggung.HUBUNGAN BIROKRASI DENGAN DEMOKRASI Dra. Apalagi topik yang akan dikaji ada hubungannya dengan demokrasi sehingga memerlukan suatu pemikiran yang serius untuk menelaah dan menilai akibat-akibat yang terjadi dan yang ditimbulkan oleh aksi birokrat dalam konteks demokrasi yang perlu diperbaiki.cirinya adalah pembagian kerja dan spesialisasi. Birokrasi memainkan peranan aktif di dalam proses politik di kebanyakan negara dan birokrasi menggunakan banyak aktifitas-aktifitas. 1. dan para administrator pemerintah yang tidak efisien (Herbert M.982: 241). birokrasi kadang-kadang digunakan dalam suatu hal yang diremehkan. pokoknya selalu mendapat “tanda” negatif dari pendengarnya. menurutnya birokrasi merupakan tipe ideal bagi semua organisasi formal. dan tidak ada pemisahan yang tajam antara kelompok manajerial clan pejabat politik (Martin Albrow.Levine. persiapan proposal legislatif.32). Masyarakat didominasi oleh para birokrat. dan membagi pelayanan kesejahteraan (Herbert M. Cita-cita utama dari sistem birokrasi adalah mencapai efisiensi kerja yang seoptimal mungkin. dan efisiensi. Konsep Birokrasi Dalam kamus Akademi Perancis tahun 1798. prosedur yang panjang dan memakan waktu yang lama. ditulis oleh James Burnham tahun 1941 yang menekankan pentingnya kelompok manajerial di dalam perekonomian. Menurut Herbert M. Birokrasi diartikan :"kekuasaan. negeri maupun swasta. lisensi dalam perekonomian dan masalah-masalah profesional.Si Jurusan Ilmu Adminisrasi Negara Fakultas Ilmu Sosial dan Ilmu Politik Universitas Sumatera Utara Berbicara tentang birokrasi sering kali kita asumsikan dengan urusan yang berbelitbelit. peraturan ekonomi. Tulisan ini mencoba menjabarkan birokrasi berkaitan dengan demokrasi dan melihat posisi itu melalui Rekonstruksi. Hal ini akan menjadi lebih transparan apabila kita memantau birokrasi yang berhubungan atau berurusan dengan organisasi formal. Sedangkan menurut kamus bahasa Jerman edisi 1813. peraturan-peraturan.Levine. 1989 : 100) Berdasarkan tulisan tersebut James memberi persamaan antara .

1994: 3.kekuasaan kelas para manajer dengan kelas para birokrasi negara. berkumpul dan berorganisasi. parapenguasadipilihmelaluirepresentatif/perwakilandarimasyarakatdan 7. Huntington. parapenguasaharusdipiliholehmasyarakat. Konsep Demokrasi Pada tulisan ini perhatian kita tertuju pada masalah birokrasi dan hubungannya dengan demokrasi. 1995 : 6). c.masalah kebijaksanaan umum. fraternite. 5. ©2003 Digitized by USU digital library 2 2. 4. Cara pandang tentang demokrasi dari waktu ke waktu mengalami perkembangan sejalan dengan semakin kompleksnya hubungan antar warga. para penguasa berkewajiban untuk mempertanggungjawabkan tindakantindakannya kepada masyarakat . Kalau kita amati model demokrasi David Held diatas. maka masalah birokrasi dan demokrasi tidak akan pernah berhenti. karena adanya perubahan sikap dari masyarakat akan bergantung kepada pengaruh para birokrat. Kontribusi birokrasi dengan Demokrasi Kebanyakan orang menganggap bahwa konsep birokrasi sebagai administrasi yang tidak efisien dan rasional. Demokrasi berarti liberte. 6. menerbitkan. maka untuk kasus negara berkembang seperti Indonesia demokrasi yang muncul sangat bergantung kepada perilaku elit politik dan struktur budaya. dimana ada kontrol yang efektif. Demokrasi yang dapat menghambat nilai-nilai kultural menurut seorang Indonesianist Benedict R. Kata demokrasi berasal dari bahasa Yunani. Masyarakat yang dibentuk dan diperintah oleh para birokrat akan menjadi masyarakat -masyarakat birokratis yang nantinya masyarakat tersebut akan menjadi birokrasi-birokrasi masyarakat yang patuh dan tunduk pada pengaruh sikap-sikap dan nilai-nilai para birokrat. (prisma No. Usaha demokratisasi masih memerlukan rentang waktu yang cukup panjang bagi lembaga-lembaga politik. menurut bahasa Yunani. oleh warga negara terhadap kebijakan pemerintah. para penguasa harus bertindak sesuai dengan kepentingan masyarakat. rezim yang memerintah. oleh rakyat.4). memutuskan kebijaksanaan umum dan melaksanakan hukum dan administrasi pemerintahan. untuk rakyat Esensi dari demokrasi adalah bahwa rakyat memerintah atau melakukan pemerintahan oleh dirinya (government by the people) (majalah Koridor.4 tahun XXI. David Held menyatakan ada 7 prinsip utama penyelenggaraan negara berdasarkan demokrasi yaitu: 1. demokrasi magandung dua dimensi kontes dan partisipasi yang menurut Robert Dahl merupakan hal menentukan bagi demokrasi. definisi yang paling singkat tentang demokrasi adalah apa yang diucapkan oleh Abraham Lincoln di Gettysburg. masyarakat secara perseorangan harus terlibat dalam pembuatan keputusan yang penting dalam arti memutuskan hukum-hukum publik dan masalah. Selama masih ada tipe-tipe pejabat negara dan seperangkat nilai yang dianggap sebagai bagian inheren dalam demokrasi yang sebenamya. antara kekuasaan di kalangan "wong ghede dan wong cilik”. Basis kultural dalam pemerintahan Orde Baru di Indonesia itu dapat dilihat dari bagaimana hubungan antara elit politik dengan warga negara sebagai hubungan antara kawulo dan gusti. Arnerika Serikat tahun 1863 yaitu pemerintahan dari rakyat. Pensylvania. 1992 : 32). maupun nilai masyarakatnya sendiri dalam memaksimalkan upaya yang ada menuju iklim demokratisasi yang diidam-idamkan. 3. b. masyarakat harus memerintah dalam arti semua harus terlibat dalam membuat undang-undang. ekonomi dan ideologi yang menjadi anutan. parapenguasaharusbertanggungjawabkepadaperwakilandarimasyarakat.O'G Anderson yaitu prinsip ajaran demokrasi pandangan Jawa yang sangat mempengaruhi sistem politik dan proses demokratisasi Indonesia. khususnya dalam cara pandang terhadap pembangunan politik. mencakup aplikasi kriteria evaluatif dan spesifikasi sifat . Demokrasi juga mengimplikasikan adanya kebebasan sipil dan politik yaitu kebebasan berbicara. egalite. yang dibutuhkan bagi perdebatan politik dan pelaksanaan kampanye-kampanye pemilihan itu (Samuel P. Hal ini akan cepat menjerat masyarakat akan runtuhya nilai-nilai demokrasi sehingga ada suatu pertentangan dengan nilainilai tersebut yang dianggap sebagai suatu problema yang memerlukan pemecahan.

yaitu 1. untuk itu perlu dilihat bagaimana masing-masing karakteristik antara birokrasi dan demokrasi digunakan dalam usaha mendiagnosis dan menyembuhkan masalah yang terjadi. yaitu suatu proses dimana suatu biroksasisemakin mendekati tipe ideal sebagaimana dikemukakan oleh Max Weber. Berdasarkan konsep Jackson tersebut maka ciri-ciri pokok masyarakat politik birokratik adalah : 1. untuk birokrasi di Indonesia agaknya cendrung ke arah parkinsonisasi dan orwelisasi ketimbang ke arah weberisasi.X tertanggal 3 November 1945. januari-april 1995 : 27. Ada tiga kecendrungan yang dialami oleh setiap birokrasi. 2. 2. dalam jurnal Bestari. Perlu dipertanyakan apakah tindakan tergantung pada bagaimana nilainilai demokrasl Itu ditafsirkan dan mana diantara penafsiran itu yang dipandang salah. lembagapolitikyangdominanadalahaparatbirokrasi 2. konsep ini diamati secara serius karena mendiskusikan tentang pejabat-pejabat negara yang menjalankan tujuan-tujuan demokrasi. ©2003 Digitized by USU digital library 3 Problema yang harus dipecahkan untuk dapat menumbuh kembangkan demokrasi dengan menempatkan birokrasi secara konsisten di dalam sistem politik.Jackson (1978) dalam konteks Indonesia.terutama pembangunan yang mampu mengantisipasi dan menahan gejolak-gejolak eksternal sehingga bisa mencapai tingkat pertumbuhan yang memadai. yaitu pertama proses weberisasi. pejabatbenar-benarmernilikikekuasaandantugasyangsemakinbesarsehingga jabatan tersebut harus dijalankan secara bijaksana . sehingga perlu dipertanyakan kemampuan masyarakat politik birokratik ini untuk melaksanakan pembangunan . dimana politik yang ikut menentukan sosok administrasi pemerintah pada waktu itu.nilai-nilai tersebut (Martin Albrow. konsep masyarakat politik birokratik yang dikembangkan pertama sekali oleh Fred Riggs (1966) dan digunakan oleh Karl D. dan kelompok kepentingan semuanya lemah dan tidak mampu melakukan kontrol terhadap birokrasi. Menurut teori.Northcote Parkinson Ketiga. 3. pejabat menuntut kekuasaan terlalu besar dan perlu dikembalikan pada fungsinya semula. seperti parlamenter. yaitu kecendrungan birokrasi semakin menguasai masyarakat. proses parkinsonisasi yaitu proses dimana birokrasi cendrung menuju kedalam keadaan patologis sebagaimana pernah diduga kuat oleh C. proses orwelisasi. Konsep birokrasi cendrung dianggap sebagai suatu aspek ancaman terhadap demokrasi.28 ). lembaga–lembaga politik lainnya. masa diluar birokrasi secara politis dan ekonomis pasif. sedangkan parameter birokrasi “ sehat “ yang dijadikan sandaran adalah konsep birokrasi weber . di Indonesia terlebih dahulu didekatkan melalui 2 konsep yaitu : 1. Friedrich dan Finer prihatin terhadap masalah kesesuaian praktek-praktek administrasi negara modem dengan nilai-nilai demokrasi. agar dapat memahami birokratisasi dalam pembangunan nasional. kekuaasaan perlu bagi para pejabat sehingga harus dicari metode-metode pelayanan yang dapat disalurkan bersama-sama. yang dapat mendistribusikan secara merata hasil dari perjuangan masyarakat tersebut. apalagi konsep birokrasi sebagai kekuasaan yang dijalankan oleh pejabat. konsepkapitalismebirokratikyangdirumuskanolehWittfogel(1957). Bertitik tolak dari ciri-ciri tersebut maka dapat kita simpulkan bahwa birokrasi di Indonesia cendrung mendekati ke tiga ciri tersebut. karena mereka percaya bahwa bukan kekuasaan yang dijalankan pejabat yang menimbulkan masalah tetap cara menggunakan kekuasaan itulah yang menjadi masalahnya.(Muhadjir Effendy.1989 : 1 07). Dalam sistem politik demokrasi liberal yang berawal dari Maklumat Wakil Presiden No. 1996: 159). Martin Albrow membedakan tiga posisi dasar tentang fungsi-fungsi pejabat di negara demokrasi.Muhadjir Darwin yang menyimpulkan bahwa birokrasi di Indonesia sedang “sakit” dengan titik tekanannya berdasarkan hukum Parkinson. menciptakan suatu sosok sistem politik bureau-nomia (Moeljarto Tjokrowinoto. partai politik. sehingga menyebabkan lemahnya peranan partai politik dan dampaknya semakin memperkuat peranan birokrasi. Menurut analisa Dr. Posisi infrastruktur politlk vis-a-vis suprastruktur politik secara relatif lebih kuat. 3. terwujud konfirmasi.Kedua.

Gejala tumbuhnya birokrasi yang terlarnpau kuat diungkapkan oleh Fred W Rigg ketika ia rnelakukan penelitiam modernisasi di Thailand yang kemudian muncul . Ibarat seorang pencuri bertobat untuk tidak akan mengulangi perbuatannya karena dia takut kepada Allah (sadar bahwa mencuri itu perbuatan dosa). hal ini berarti mengurangi demokrasi. setidak-tidaknya masyarakat harus memberikan pengertiannya karena pada kenyataannya jumlah polisi tidak cukup banyak di dalam melakukan kontrol atas penerapan hukum. adanya tuntutan negara semakin berkembang terus. karena belum tentu yang dilakukan birokrat baik. kalau mentalnya masih mental pencuri. Sedikit kepatuhan sudah merupakan suatu kondisi bagi demokrasi. yaitu : tuntutan dari rnasyarakat sehingga membuat birokrasi menjadi lebih besar peranannya. Pada dasamya masyarakat lebih menginginkan terciptanya kesadaran daripada kepatuhan. Keberadaan birokrasi-birokrasi semacam itu tidak merusak nilai. baik juga untuk rnasyarakat.203). yakni dengan memantapkan organisasi-organisasi sifatnya yang lebih birokratis daripada berupa pengaturan secara demokratis.1987: 202. karena freewill terbatas untuk masyarakat. Jika birokrasi berlebihan maka masyarakat dirugikan karena masyarakat punya otonomi yang terbatas. daripada takut karena adanya ganjaran hukuman yang menantinya.Kepatuhan tanpa syarat pada hakikatnya menghindari kritik dan ketidaksepakatan yang menjadi inti demokrasi (Peter M.Dampak Kekuasaan Birokrasi Terhadap Kondisi Demokrasi kekuasaan birokrasi menimbulkan pertanyaan yang menyebabkan para ilmuan mulai berpikir.nilai demokrasi. akan tetapi semakin kuat birokrasi dalam negara maka akan semakin rendah demokrasi dan sebaliknya semakin lemah birokrasi maka akan semakin tinggi demokrasi. Adil dan perlakuan yang sama bagi seluruh penduduk ternyata membutuhkan seperangkat hukum yang kompleks da peraturan-peraturan administratif. Hal ini kemudian dicetuskan dalam bentuk protes yang mengacaukan suasana. sehingga ada kesan terpaksa untuk memenuhi kewajiban perpajakan. dorongan politik.Meyer . doronganekonomi. Bila pemerintah harus memaksa kepatuhan yang sepenuhnya. Apabila kita menunggu sampai suasana itu benar-benar terjadi. dengan demikian keadaan menjadi sulit bila masyarakat cendrung tidak mematuhi hukum.Blau. dorongan yang bersifat sosial. bahwa masyarakat wajib pajaknya sudah lelah dengan seabrek peraturan yang harus dipatuhi. untuk dapat berfungsi.ciri organisasi yang diharapkan terlalu ideal sehingga kadang kala belum tentu cocok dengan kondisi atau situasi di suatu negara. ©2003 Digitized by USU digital library 4 d. Marshall. Demokrasi dan birokrasi sesungguhnya sangat diperlukan dalam proses pembangunan suatu negara . karena ciri. 2... sehingga sulit untuk mencapai tahap masyarakat yang "marginal detterence". ada pandangan bahwa negara ©2003 Digitized by USU digital library 5 sebagai penggerak pembanggunanan nasional dan negara diasumsikan sebagai fungsi yang strategis.tetapi pada kenyataanya selalu menimbulkan masalah. yang meminta negara untuk menyelesaikannya dan meminta negara melayani hal tersebut sebagai contoh yaitu negara yang demokratis. Dalam jangka pendek. Birokrasi sulit untuk direm karena ada dorongan dari dalam (birokrat itu sendiri) ataupun dari luar seperti : 1.. inilah yang disebut antitesis demokrasi. Bila kita lihat contoh di Indonesia. tentu saja birokrasi dapat memerintah masyarakat tanpa Menimbulkan perlawanan mereka Namun sebagaimana kita juga pemah belajar dari masa lampau. yaitu pemberian tanggungjawab pada negara untuk melakukan sesuatu pada masyarakat. dan sulit menciptakan masyarakat yang sadar pajak dalam sistem yang diterapkan untuk meningkatkan penerimaan negara. dan W. kerelaan yang pertama-tama bersifat pasif pada akhimya membangkitkan rasa ketidakberdayaan. Nilai-nilai demokratis tidak saja berarti tujuan-tujuan masyarakat yang ditentukan oleh keputusan mayoritas. 3. tetapi juga bahwa tujuan-tujuan tadi diterapkan melalui metode-metode efektif yang ada.

Birokrasi dan Demokrasi melalui penjelasan tersebut ibarat dua sisi dari mata uang yang sama. tetapi turut melakukan kebijakan berupa tindakan membela si miskin sebagai suatu pertanda merekonstruksi demokrasi. apa perlu kebijakan direvisi atau direform. yang menempatkan birokrasi melalui pemasukan nilai budaya masyarakat yang dominan sebagai suatu kekuatan tersendiri dalam mempengaruhi sistem politik dan perilaku politik elit kekuasaan (Karl D. Model Incremental. contohnya : kebijakan pengentasan kemiskinan. merupakan kebijakan yang mencari tujuan yang pasti. Pendekatan ini sering juga disebut organisasi anarki. 2. Birokrasi merupakan salah satu sarana bagi kekuasaan negara untuk memperkuat posisi politik dan merupakan sumber legitirnasi politiknya. masalah-masalah dan kesempatan untuk memilih (Charles . maka model O'Donnell birokrasi itu tidak hanya berkolaborasi dengan kekuasan tetapi juga melibatkan diri hampir di semua bidang kegiatan. Jurnal IImu Politik No.8.Pye.Jackson untuk studinya tentang birokrasi di Indonesia. ©2003 Digitized by USU digital library 6 Modal kebijakan merupakan pendekatan yang akan dipakai dalam merekonstruksi birokrasi dan demokrasi. B.Jackson dan Lucian W. Frank J.Rekonstruksi Birokrasi dan Demokrasi Melalui Beberapa Pendekatan. akan tetapi keduanya justru menunjukkan tingkat perbedaan yang mendasar dan kalaupun memungkinkan dapat dipertemukan satu sama lain melalui rekonstruksi antara keduanya. Studi Fred W Rigg tentang Bureaucratic Polity dan GuelermO'Donnel tentang Bureaucratic Authoritarian nampaknya menggarisbawahi bahwa dalam masyarakat tertentu posisi birokrasi sudah berada di bawah kontrol politik kekuasaan dalam rangka mendapatkan sumber legitimasi politik melalui sarana birokrasi. dalam konsep yang sama Karl D. Thompson. namun menjalar sampai kepada kegiatan ekonomi sosial budaya termasuk juga ideologi.Guy Peters.jackson. apa yang menjadi tantangan masa depan. tetapi ia telah menjadi kekuatan dominan yang marnpu mengatasi keduanya. merupakan kebijakan yang dimulai dengan melihat kebijakan yang ada. adanya kesadaran para aktor dalam birokrasi sehingga mengambil nilai tertentu yang siap dimaksimalkan pemerintah. 3. solusi. menurut model ini hasil pembuatan keputusan secara kebetulan dipengaruhi 4 komponen yaitu : para partisipan. berkolaborasi dengan kekuasaan pemerintah.dengan konsep "Bureaucratic Polity" yang menggambarkan betapa birokrasi di Thailand telah memasuki suatu jaringan kehidupan politik dan ekonomi yang sangat kuat yang dilakukan oleh negara terhadap kehidupan masyarakat. AIPI LIPI Jakarta 1991: 68). Synoptic Model. birokrasi dan demokrasi sangat diperlukan dalam kegiatan negara dan masyarakat.Para aktor politik bisa menilai konsekuensi-konsekuensi positif dan negatif. Berdasarkan studi Guelermo O'Donnel bahwa negara telah muncul sebagai kekuatan politik yang tidak hanya relatif mandiri berhadapan dengan faksi-faksi elit pendukungnya serta masyaraklu sipil. Sementara demokrasi merupakan keinginan dari sebagian besar rnasyarakat untuk rnendapatkan keberdayaan sehingga proses tawar menawar antara state dan sipil society dapat berkembang dengan baik khususnya dalam kerangka pengembalian keputusan politik sebagaimana prinsip-prinsip dasar dari demokrasi itu sendiri. e. Allison mendeskripsikan 4 model kebijakan yaitu : 1. Otoritarian Birokratik memang diciptakan untuk melakukan pengawasan yang kuat terhadap masyarakat sipil. dalam Karl D. 1990 : 82) . akan tetapi hubungan antara tujuan dan kebijakan-kebijakan utama tidak selalu jelas. terutama dalam upaya mencegah massa rakyat di bawah keterlibatan politik yang terlampau aktif agar proses akselerasi industrialisasi tidak tergangggu (Guelermo O'Donnel dalam Muhammad AS Hikam. hat ini menandakan bahwa birokrasi bukan pemerintahan rakyat tetapi mengembalikan peran negara sebagai arbiter (perantara). Model Garbage Can. 1987:4). Jika dalam studi Rigg birokrasi. Dalam hal ini birokrasi tidak hanya penerima kebijakan dari pejabat-pejabat politik. Keterlibatan negara tidak hanya dalam bidang poitik formal. Proses kebijakannnya sering kali tidak dimulai dari titik nol karena selalu dimulai dengan kebijakan yang ada sehingga standard operating procedurenya terlalu kuat. merupakan model yang ideal dengan melihat proses kebijakan sebagai suatu proses yang sangat rasional dimana policy maker atau aktor-aktor yang terlibat dalam proses kebijakan dianggap memiliki persepsi yang jelas tentang tujuan yang akan dicapai (Charles H Levine.

merupakan proses pengambilan keputusan dalam melibatkan banyak aktor/kelompok-kelompok kepcntingan yang masing-masing punya nilai atau kepentingan sendiri. Kurang berhasilnya reformasi administrasi di Indonesia selama kurun waktu PJPT-1 ini nampaknya dipengaruhi paling tidak oleh 2 faktor : 1. para birokrat agak alergi karena daya inovasi kaum birokrat dipengaruhi oleh advokasi dari para pimpinan politik yang harus diyakini melalui reformasi tersebut. ©2003 Digitized by USU digital library 7 Sumarlin dan Saleh Affif ketika beliau-beliau tersebut menjadi Menteri Penertiban Aparatur Negara pada Kabinet Pembangunan I.84) 4. Bila aparatur administrasi mampu mendukung pembangunan nasional. Namun. dimana terlalu banyak prosedur dan standard operating procedure terlalu dinomorsatukan atau dijadikan sebagai salah satu instrumen yang digunakan oleh pemerintah pusat.evine. beberapa teknokrat dalam birokrasi mencoba mengadakan upaya-upaya reformasi . Pada waktu yang lalu. karena hidupnya dari gaji yang diperoleh dari pajak rakyat dan bukan malah menjadi alat untuk menekan rakyat.B. Problema birokrasi yang melanda negara Indonesia dengan adanya pelaksanaan peraturan dan juga yang semakin banyak. dalam orasi ilmiah yang disampaikan pada kuliah perdana program MAP UNT AG. g. liberalisasi dan industrialisasi ekonomi Indonesia. Reformasi tersebut dapat dilaksanakan walaupun pada kurun waktu tersebut birokrasi Indonesia secara umum masih konservatif dan belum terbuka terhadap perubahan.Frank J.(Charles H. telah menimbulkan politisasi birokrasi yang berlebihan. J. bergaining atau kompromi sesuai dengan tujuan yang ia miliki. Situasi Problematis yang teriadi di Indonesia. memperjungkan atau membangun strategi-strategi sendiri dengan koalisi. 2. . Menteri Emil Salim berhasil mengadakan reformasi pada organisasi dan tala kerja departemen. aliansi yang kuat antara birokrasi dan organisasi politik.H. dan Menteri Saleh Affif mengadakan reformasi untuk menggairahkan kegiatan ekonorni melalui serangkaian kebijakan deregulasi. Model Birokratik Politik. Posisi saling berhadapan antara birokrasi yang mewakili lembaga negara dengan civil society yang berada pada posisi masyarakat. f. punya agenda masing-masing. kurang mampu mendorong empowering masyarakat karena birokrasi melihat masyarakat dari kaca mata bagaimana masyarakat melaksanakan peraturan dan bukan melihat bagaimana inisiatif masyarakat itu sendiri sehingga ada kesan pemaksaan yang dapat menimbulkan benih-benih konflik yang mengakibatkan rakyat sebagai lawan dari birokrasi.II dan III. seperti yang dilakukan oleh Emil Salim.Frank J.B Guy Peters. terutama melalui pengaruh jalur-jalur A dan B di Golkar. jika kita mengacu ke negeri sendiri yaitu Indonesia. Thompson. Pembuatan keputusan-keputusan poitik nasional amat didominasi oleh pemerintah dan kesan seperti itu sukar dibantah. Berdasarkan beberapa model yang ditawarkan.1990: 84). reformasi tersebut belum mampu menciptakan suatu snow ball reformasi administrasi yang terus sustainable dan akhirnya mampu menciptakan sistem adrninistrasi yang handal dan dapat bargaining mendukung pembangunan ekonomi politik (Sofian Effendi. 1990 :83.Thompson. Sepertinya mendengar kata reformasi.Guy Peters. merupakan bagian yang tidak dapat terpisahkan dari upaya mencari wilayah dinamika dari studi pembangunan politik yang akan meningkatkan kehidupan politik ideal yang demokratis. Strategi Birokrasi yang Diterapkan Di Indonesia melalui Contoh kasus Reformasi Perpajakan. kuatnya dominasi ekonomi perencanaan pembangunan nasional. Reformasi administrasi perlu dilancarkan sebagai bagian dari pembangunan politik. sehingga reformasi administrasi tidak pernah menjadi fokus perhatian tetapi hanya sebagai pendukung pembangunan ekonomi . belum nampak adanya minat yang cukup besar dikalangan para pimpinan organisasi politik mengenai reformasi administrasi. maka ada kecendrungan kita memakai model Incremental. Padahal seharusnya birokrasi bekerja untuk rakyat. maka dapat tercipta sistem tersebut sehingga mampu mendukung demokratisasi politik. Menteri Sumarlin mengadakan reformasi pada sistem remunerasi pegawai negeri. 1994 :3). yang menimbulkan dorongan yang kuat pada birokrasi yang cendrung lebih mempertahankan status-Quo daripada reformasi.Levine.

Langkah ketiga. keputusankeputusan tersebut menggambarkan pemanfaatan hasil-hasil kegiatan yang sejenis di negara-negara lain. Dalam rangka memecahkan problematik yang terjadi pada waktu itu. terdapat bermacam-macam tarif pajak baik untuk perorangan maupun untuk perseroan. obyek pajak. demi tercapainya keadilan sosial dan kemakmuran yang merata. sehingga menimbulkan kesan membingungkan dan bahkan terdapat pembebanan pajak berganda. menuangkan kebijakan perpajakan ke dalam suatu konsep dalam bentuk perundang-undangan yang ketat. Ketiga unsur tersebut adalah kebijaksanaan. Pada sistem lama. Komisi tersebut berfungsi . adalah hukum pajak atau hukum fiskal yaitu keseluruhan peraturan yang meliputi wewenang pemerintah untuk mengambil kekayaan seseorang dan menyerahkannya kembali kepada masyarakat melalui Kas Negara. termasuk beberapa ©2003 Digitized by USU digital library 9 diantaranya dari jajaran Direktorat Jenderal Pajak. Pada dasarnya pemungutan pajak rnerupakan perwujudan atas kewajiban kenegaraan dan partisipasi anggota masyarakat dalam memenuhi keperluan pengelolaan negara dan pembangunan nasional. hanya saja situasi dan kondisinya belum memungkinkan. para menteri bidang Ekonomi Keuangan dan lndustri (EKUIN) serta beberapa anggota lembaga perekonomian mempertimbangkan bahwa rencana pembaruan perpajakan di Indonesia dengan menggunakan batasan tahunan dan bukan bulanan. Sebagai bahan kajian bahwa dalam perundang-undangan pajak lama terdapat beberapa permasalahan dan sekaligus kelemahan yang perlu disoroti yaitu: ©2003 Digitized by USU digital library 8 Pertama. maka para pemikir ekonomi Indonesia pada tahun 1980-1981 sudah mengenal pokok.. Pemilihan unsur-unsur tersebut berkenaan dengan subyek pajak. diperhatikan saling keterkaitan antara tiga unsur pokok pemungutan pajak.Hal yang kedua.Kedua pelaksanaan kewajiban perpajakan sangat tergantung pada aparat perpajakan. Kebijaksanaan perpajakan merupakan pemilihan unsurunsur tertentu dari berbagai alternatif yang didasarkan atas sasaran yang ingin dicapai.Melalui tulisan ini ada strategi positif yang dapat memperbaiki kelemahan birokrasi menuju demokrasi di Indonesia dengan mengambil contoh yang pemah terjadi di Indonesia yaitu Pelaksanaan Reformasi Perpajakan. Kelima. Pada awal tahun 1981. tampaklah bahwa sesungguhnya pada masa lalupun telah ada upaya-upaya untuk mengadakan pembaruan sistem perpajakan.cara dan prosedur pengenaan serta pemungutan pajak.Keempat. terdapat berbagai jenis pajak sehingga menimbulkan ketidakjelasan bagi masyarakat dalam memenuhi kewajibannya. diarnbil Beberapa keputusan tingkat menteri dalam hal strategi dan teknik untuk pembaharuan perpajakan Indonesia. bernegara dan berpemerintahan.. tingginya tariftarif tersebut sehingga menimbulkan rangsangan untuk menghindari pajak mela1ui berbagai cara. sasaran perpajakan semata-mata untuk pemerintah penjajah Belanda dengan berkedok pengisian kas negara tetapi nyata-nyata digunakan untuk kepentingan kolonial.. sehingga menimbulkan kecendrungan masyarakat wajib pajak kurang turut bertanggung jawab dalam memikul beban negara yang pada hakikatnya untuk kepentingannya sendiri dalarn bermasyarakat. yang dalam banyak hal. Keenam. Ketiga. dibentuk Komite atau Panitia Pengarah dengan mengikutsertakan beberapa pejabat dari jajaran Departemen Keuangan. tatacara pemungutan pajak yang berbelit-belit. Langkah kedua. maupun karena menyusun sistem yang barn tidaklah mudah. baik karena kemungkinan mendapat tantangan dan antipati dari rakyat yang memang telah lama mengalami trauma dan sindrome pajak pada masa penjajahan. maka dalam menyusun sistem yang baru. Dari paparan di muka .Keputusan itu dikelompokkan dalam 8 langkah kebijakan sebagai berikut : Langkah pertama.pokok dan hasil dari misi-misi pembaruan perpajakan di beberapa negara. Dari keenam kelemahan yang terjadi pada sistem yang lama. peraturan-peraturan pajak yang beraneka ragam. Direktorat jendral Bea dan Cukai serta Direktorat Jendral Moneter. dimana yang bertindak sebagai pelaku administrasi pajak di Indonesia adalah Direktorat Jendral Pajak. tarif pajak dan prosedur pajak. Sedangkan administarsi perpajakan adalah cara. hukum perpajakan dan administrasi perpajakan.

Dalam rangka pengkajian masalah pembaruan sistem perpajakan di Indonesia. Langkah kelima. Responsive terhadap tuntutan rakyat. dan ilmu teknologi komputer dalam pekerjaan studi pembaruan sistem perpajakan di Indonesia. Seperti telah dijelaskan. swasta maupun para ilmuwan dari berbagai disiplin ilmu. T. ini tidak akan jadi persoalan bila birokrasi tetap dipandang sebagai instrumen negara. Keikutsertaan para ahli tersebut baik akademisi maupun para profesional dan pejabat yang berwenang di dalam negeri dimaksudkan untuk memperoleh proses dan pemecahan masalah dalam pengerjaannya. telah diundang tenaga ahli dan tokoh-tokoh terkemuka yang sangat berpengalaman dan bereputasi Intemasional dalam bidang perpajakan. Setelah sampai rancangan tersebut ke DPR. Berdasarkan pengalaman sejarah. baik kalangan pemerintahan. Dari para anggota DPR yang pada umumnya dikenal sebagai tokoh-tokoh masyarakat yang vokal.(Salamun A. Direktorat Jendral Pajak dan Tim dari Luar Departemen Keuangan. selama proses pembahasan di DPR banyak pihak dari berbagai disiplin ilmu. saran dan juga kritik tajam. Langkah keenam. baik itu pendidikan formal maupun pendidikan informal untuk memulai kaderisasi pejabat pajak yang terlatih baik. baik dari luar maupun dalam negeri untuk memberikan pengalamannya sekaligus menguji konsep pembaruan sistem perpajakan di Indonesia. pengertian dan pemahaman yang tulus. dimana kekuatan-kekuatan sosial dan negara mengarahkan birokrasi kesana. mana yang haq dan mana yang bathil.44. sehingga mampu mendorong birokrasi untuk meningkatkan responsivitas mereka terhadap keinginan rakyat . melibatkan ©2003 Digitized by USU digital library 10 kepentingan pribadi di atas kesejahteraan umum.45). Meskipun seringkali didengungkan masalah kebersamaan dan demokrasi di dalam organisasi Direktorat Jendral Pajak tapi kenyataannya kekuasaan lebih ditentukan oleh landasan rasional sehingga masalah organisasi harus didahulukan daripada masalah pribadi. mengenai mana yang benar dan mana yang salah. kebijaksanaan untuk memulai sistem perpajakanan yang baru secara keseluruhan tanpa sedikitpun mengambil bagian-bagian dari sistem yang lama. Langkah keempat. . mengawasi dan berperanserta langsung dalam penelitian yang dilakukan oleh tim tenaga ahli asing yang mungkin akan digunakan. juga membuat kebijakan dan mengimplementasikannya berat sebelah (LV . di samping tenaga ahli ekonomi dan hukum. memperluas wawasan pembaharuan sistem perpajakan sehingga mencaku bidang-bidang yang sebelumnya tidak merupakan obyek pajak.pilihan kebijakan yang memuaskan klien-klien tertentu. disamping tim pengarah ada lagi tim yang dibentuk oleh Departemen Keuangan.Carino. secara jujur harus diakui bahwa sebagian besar menekankan pentingnya mental aparatur pajak mendapat perhatian pemerintah. Dari banyak tanggapan spontan yang muncul pada hari-hari paertama pengajuan RUU ke DPR. 1993 : 119 -140).mengarahkan. Langkah ketujuh. kalangan masyarakat dan berbagai sudut pandang yang memberikan tanggapan. telah terbukti bahwa usaha birokrasi untuk merekonstruksi demokrasi tidak bisa lepas dari politik publik.. Ambisi utama daripada sistem birokrasi adalah tercapainya efisiensi kerja yang seoptimal mungkin tapi bukan malah mempolitisikan birokrasi dengan pilihan. mengharuskan agar usaha persiapan ini dilakukan secara biasa saja tanpa publikasi besar-besaran . menyiapkan latihan dan pendidikan bagi para pejabat perpajakan. 1990 :43. Diperlukan juga tenaga-tenaga ahli dalam bidang-bidang lain seperti ahli administrasi perpajakan akuntan. Langkah kedelapan. korupsi. sehingga kekuasaan kepemimpinan politik mampu membuat birokrasi bertanggung jawab terutama alas dasar kepentingan publik.Bautista dkk. menerapkan langsung hasil dari tiap-formulasi tanpa menunggu laporan hasil keseluruhan paketnya. namun tetap rnemperhatikan berbagai pendapat dari kelompok-kelompok yang ada dalam masyarakat. sehingga diharapkan timbul kesadaran.

pada sisi lain otonominya sebenarnya sedang ditekan oleh politisi melalui paradigma baru. Dilema yang muncul adalah birokrasi harus professional dan responsive tapi. telah dimanfaatkan oleh kepentingan politik ditengah arus demokratisasi. karena reformasi administrasi sering direduksi pada tatanan tehnis. Dugaan bahwa dinamika komplek terpotret melalui bargaining dalam sector public yang memungkunkan terjadi manipulasi dalam pengelolaan sector public. Birokrasi dan jebakan politik Orde baru melalui bureaucratic polity. Disini demokrasi dikesampingkan. Dua hal penting model bureaucratic polity eksis: . eksekutif melalui birokrasinya terbawa tuntutan reformasi administrasi melalui paradigma pasar. Kebijakan yang dirumuskan dianggap sah dan demokratis. tekanan kekuasaan dan dinamika dibangun sistematis di dalam menjalankan. yakni DPR. Di sisi berhadapan birokrat begitu kuat menjaga motif nilai manajer departemen. Pada konteks organisasi public.ORMASI ADMINISTRASI DAN PARADOKS DEMOKRASI Ini menjelaskan tentang perselingkuhan antara birokrasi dengan elit politik yang semakin inten. Ini dilakukan untuk menghindari kegagalan implementasi dan kritik keras terhadap birokrasi. Reformasi politik. hanya karena adanya keberadaan symbol institusi dari demokrasi. DPR. Melalui institusi Presiden dan Wakil Presiden dengan Wakil Rakyat. sepert terwujudnya good governance. Birokrasi sebenarnya tidak akan bisa netral.

Justru tulisan ini akan menjelaskan adanya kedekatan elit politik dengan birokrasi. Daripada kekuatan penuh dicapai meluli kompetisi interpersonal di lingkaran elite di fisik yang tertutup dekat presiden. Proses politik pada tingkat ini bisa sangat kompleks. Birokrasi sebagai komponen dari suatu pemerintah dari pusat sampai dengan daerah politik. Sehingga yang tersisa di mata rakyat hanyalah kekuasaan dari birokrasi. Adanya dikotomi administrasi dan politik dijelaskan dengan konteks yang spesifik. Pertautan keduanya terjalin dengan bungkus rapi dibalik mekanisme demokrasi. Dinamika interaksi politik dengan birokrasi pada pemerintahan hasil pemilihan secara lansung. para pejabat yang memiliki kewenangan formal. Setiap kebijakan yang dirumuskan dianggap sah dan demokratis oleh DPR yang dianggap simbol institusi dan demokrasi. Struktur dikotomi dilihat dari sisi struktur formal. 2. Tulisan ini tidak menjelaskan jarak antara birokrasi dengan elit politik dalam dinamika administrasi publik di Indonesia. Birokrasi melalui aparat negara begitu kuat menjaga nilai manajer yang diinternalisasikan dari nilai politiknya pada kebijakan tersebut.tanpa memperdulikan rakyat yang akan terkena dampak langsung. komponen actor. Decision making benarbenar diperankan oleh arena inti proses kompetisi politik yang dibangun diluar birokrasi sesungguhnya. bureaucratic polity tidad jauh beda dari bentuk pemerintahan olek derajat untuk decision making nasional daerah kekuatan sosial dan politik keluar pejabat tidak tinggi bagi modal kota. namun bersifat informal di sekitar presiden.1. tiga komponen dinamika politik terkait dengan birokrasi menggejala: komponen political competition. Namun. Birokrasi yang selalu dituntut responsif sesungguhnya sedang mengalami tekanan elit politik. 1. . daerah utama untuk kompetisi politik tidak di negara yang besar dan kekuatan tidak dicapai terus memperbaiki bagi banyak gerakan. Pada sisi yang lain. demokratisasi yang diusung dan diyakini akan membawa perubahan yang besar di Indonesia justru telah memanipulasi sektor publik melalui instrumen reformai administrasi yang sedang populer. Actor inilah komponen yang pertama. 2.

Birokrasi Pemerintahan (Bureaucratic Government) Interaksi politik dan birokrasi terjadi begitu inten dalam dinamika pemerintahan kita.Oleh karena itu. Dilema yang terjadi adalah.Pada konteks organisasi publik. Reformasi birokrasi dimanfaatkan oleh kepentingan politik ditengah arus demokratisasi. Hal ini dilakukan agar terhindar dari kegagalan implementasi dan nilai negatif birokrasi. birokrasi ditekan oleh politisi melalui nilai-nilai dari paradigma baru tersebut. Dinamika komplek tersebut terlihat melalui politik bargaining dalam sektor publik yang memungkinkan terjadinya manipulasi dalam pengelolaan publim sektor. bahwa pada sisi birokrasi dituntut untuk selalu profesional dan responsif. Namun disisi lain. Hal tersebut dapat terjadi di pusat maupun daerah (pemilihan kepala daerah secara langsung). para ekskutif melalui birokrasinya terbawa tuntutan reformasi administrasi seperti terwujudnya good governance. termasuk tekanan global (IMF. Sistem pemilu secara langsung yang diterapkan. memberikan implikasi pada ricuhnya kebijakan publik. contoh konkritnya dapat dilihat dari Pilkada secara langsung. sehingga kemungkinan adanya bargaining dan cheating ada meski dalam era demokratisasi dan kampanye good-governance. perubahan dari partai attachment menjadi personal attachment dan terjadinya transformasi kepentingan elit menjadi kepentingan publik sehingga dapat menyebabkan pemerintah lamban dan tidak responsif. Interaksi yang terjadi bukan saja politisi memanfaatkan eksekutif. setiap kebijakan yang dibuat selalu bias dengan kepentingan politik. tapi eksekutif dan birokrasinya menghendaki hal tersebut sebagai bagian dari balas jasa kampanye pemilihan presiden langsung dan untuk mengamankan kekuasaannya dan hal . World bank).

Kategori Village Life Menjelaskan bahwa baik aparat atau elit politik memiliki latar belakang sosial ekonomi. dan pengalaman yang sama. Executive ascendancy seperti bentuk dikotomi politik administrasi yang murni (Carino.1992:4). pola interaksi tersebut secara teoritis akan menempatkan siapa dimana/dominasi birokrasi ataukah birokrasi sederajat dengan politisi. Bureaucratic sublation of. Kategori Functional Village Dari perumusan kebijakan / policy sampai dengan implementasinya / pelaksanaannya semuanya tertata rapi. 2. sedangkan Peters dan Pierrs (2001:5) memahami pola interaksi politisi dengan birokrasi lebih mendalam (intensitas terinternalisasinya nilainilai demokrasi) dan terkesan overlapping (birokrasi dan politisi). padahal didalamya terdapat manipulasi kepentingan rakyat yang berarti kepentingan demokrasi. . tetapi ada cara-cara yang tidak demokratis yang berakibat pada implikasi pemerintahan yang otoriter. Posisi ini sama dengan yang pertama. Model birokrasi yang berada pada posisi intermediate ada 2 kategori. Pada sisi yang ekstrim. Value normatif pada kategori ini adalah value yang memiliki orientasi pada efektivitas dan produktivitas lembaga. or co-quality with the executive. Menurut Carino. b. yaitu : a. kepentingan.yang mengakibatkan birokrasi yang awalnya sama akan ada posisi yang lebih tinggi sehingga perlu dikontrol. sehingga negara yang sedang melakukan konsolidasi demokrasi memungkinkan elit eksekutif memiliki akses dalam memainkan informasi dalam birokrasi. ada 2 bentuk model. ada kemungkinan penyalahgunaan posisi. yaitu:1. mereka memetakan interaksi kedunya dalam bentuk tumpang tindih karena internalisasi nilai-nilai demokrasi. sesungguhnya pemerintahan yang demikian sedang berusaha tampil secara demokratis. Menurut kerangka yang dikembangkan Carino.tersebut dianggap hal yang normal.

daripada kepentingan rakyat. Sedangkan dalam konteks policy analisis. di kembangkan melalui konsep tentang governance framework. Sehingga kesannya. Reformasi administrasi terjadi melalui tahapan yang kompleks dan melibabtkan banyak kepentingan. Ide ini di kemas dalam konsep yang telah menjadi Political Catchword di seluruh dunia. Hampir semua pejabat di Indonesia dipilih berdasarkan politik. pemanfaatan konsep melalui Local Governance.dimana birokrasi negara kita sedang mengalami himpitan permainan elit politik. regional.Model birokrasi yang dibahas disini adalah model Bureaucratic Government. Secara umum konsep ini telah di gunakan karena terkait dengan fokus kapabilitas dari pemeerintah dengan interaksinya dan interaksinya antara pemerintah dengan masyarakat. Multi lever mengembangkannya dalam konteks interaksi antara lembaga lokal. Model ini juga sangat cocok dengan model Birokrasi Indonesia saat ini. para pejabat tersebut lebih mementingkan kepentingan golongan atau partainya. Dalam konteks urban politics. nasional. Sebagai contohnya adalah pemanfaatan konsep oleh IMF dan World Bank dalam rangka good governance. dan transnasional. yaitu Governance. Para elit politik tersebut mendapatkan ruang yang lebih luas dalam wilayah birokrasi. governance telah di gunakan untuk penelitian-penelitian tentang peran pemerintah dalam melakukan koordinasi di sektor . regulasi. Global Governance juga berkembang melalui level hubungan internasilonal. Reformasi akan merubah tatanan yang telah ada sebelumnya dengan meredefinisi dan resistensi untuk menuju keberhasialn. Karena model birokrasi yang seperti itulah. Dalam model ini terjadi kompleksitas politik yang cukup tinggi pada tingkatan organisasi. mengapa banyak kebijakan publik di Indonesia sekarang ini memiliki kecenderungan yang mungkin saja berpotensi menyesengsarakan rakyat. dan aktivitas operasional antar beberapa institusi. Dan yang terkhir adalah dalam konteks interaksi publik dan private.

Dalam kasus BBm. ada proses perubahan internal organisasi dan juga lingkup eksternal pada suatu negara yang memungkinkan terjadinya reformasi tersebut. tetapi belum sepenuhnya berubah.ekonomi. Intervensi paradigma ini juga akan mempengaruhi interaksi kekuasaan antara birokrasi yang di lakukan oleh pelatyan publik dengan politisi pada berbagai tahapan. Seharusnya reformasi menghendaki pengelolaan yang sistematis. Selebihnya. maka politisi lebih leluasa memanfaatkan instrumen responsibilitas untuk kepentingan kekuasaan jangka pendek. analisis lebih di fokuskan pada interaksi politik dan birokrasi. Kasus BBM ini merupakan kebijakn yang sarat dengan tuntutan responsibilitas dari organisasipublik yang mendelivernya dan nilai-nilai kolektif yang lebih luas yang menyangkut masyarakat miskin. Kenaikan harga BBM yang terus di paksakan dengan berbagai . Kenyataan yang seperti ini bisa mengakibatkan kegagalan. Sebagai contoh adalah NPM dan kasus BBM. Dari awal kebijakan ini memang di kendalikan secara politis. namun dalam intervensi global dan demokrasi telah membuka ruang yang lebih besar bagi politisi untuk bermainm dalam wilayah birokrasi ini. Intervensi Paradigma ini lebih di fokuskan pada konteks reformasi administrasi saja. Dengan kenyataan lemahnya proses reformasi. Peluang ini telah terbaca oleh politisi karena memanng organisasi publik sedang mengalami kesulitan untuk menggunakan instrumen baru ini. yakni pada adopsi instrumen administratif tertentu yang kelihatan tehnis. yang bisa juga di katakan merupakan gagalnya suatu administrasi negara yang di terapkan dalam konteks global yang terjadi di negara transisi seperti Indonesia ini. Dalam penerapan reformasi administrasi ini seringkali di manfaatkan oleh politisi untuk mengambil keuntungan. Ini merupakan permasalahan transfer nilai dari organissai privat ke organisasi publik. Komlpeksitas politik pada transisi demokrasi yang belum matang telah memutuskan link yang seharusnya terjadi atau di lakukan. Perkembangan ini terkait dengan krisis yang dialami oleh nega5a.

Dalam reformasi ini di manfaatkan oleh politisi melalui cara yang tidak demokratis. Padahal rezim seharusnya menentukan peraturan dasar dan kualitas dari interaksi antara bermacam-macam lembaga melalui kebenaran proses kebijakan dan gabungan nilai untuk mengelola masalah publik. bureaucratic goverment di Indonesia merupakan birokrasi publik yang mengalami kebingungan arah dan ini terjadi di tengah perubahan ke arah demokrasi. Sementara akuntabilitas dalam reformasi administrasi merupakan instrumen yang penting. Dan lebih di tekankan lagi bahwa proses internalisasi instrument yang lemah akan memberikan peluang yang besar bagi politisi untuk memberikan suatu perfomance dari kebijakan tertentu. karena birokrasi tidak siap untuk berubah. Rezim kita sekarang ini telah gagal menentukan kualitas yang tinggi dalam mengelola masalah publik.maka ada dua hal yang penting yaitu : reformasi administrasi yang menggunakan beberapa instrumen yang memiliki nilai kontradiktif satu sama lain dalam dirinya sendiri karena nilai dari organisasi publik dan privat yang digeneralisasikan ternyata telah membuka peluang permainan politik. Hal ini ditandai dengan banyaknya lobi yang dilakukan eksekutif untuk kepentingan kebijakan. Yang kedua yaitu adanya kenyataan bahwa demokrasi yang diinternalisasikan masih dalam tahapan demokrasi formal. Di indonesia antara politisi dan public servant tidak terjadi kerjasama yang baik dalam pemecahan masalah publik yang seharusnya secara demokratis dalam perumusan kebijakan dalam perumusan kebijakan dan responsivitas dalam implementasinya namun disini terjadi penipuan yang dilakukan publik servant dalam pelayanan publik. Birokrasi kita sekarang ini masih sangat mengecewakan di dalam pelaksanaannya.kasus kenaikan harga BBM yang didukung oleh .penolakan melalui demonstrasi-demontrasi menunjukan rendahnya akuntabilitas organisasi publik. Contohnya. Melihat kenyataan tersebut.prosedural yang memberikan ruang pada elit politik untuk memberi instrument pada organisasi publik.

. Logika tersebut di kembangkan dengan beberapa alasan. di mana instrument membawa persamaan politik. Dengan demikian birokrasi kita sekarang ini di bawah kontrol politisi. politisi. serta pasar menjadi bagian stakeholder dalam reformasi administrasi.partai PKS dan PPP padahal dulunya menolak kenaikan BBM. reformasi administrasi yang terbungkus dengan paradigma besar seperti demokratisasi dan globalisasi. Ketiga. Seharusnya reformasi administrasi di pahami sebagai sistem administrasi yang lebih efektif untuk perubahan sosial. politisi memainkan perannya untuk tidak melakukan perannya untuk tidak melakukan reaksi sama sekali terhadap resistensi yang di berikan oleh publik. dan rakyat. Keempat. keadilan sosial dan pertumbuhan ekonomi. adalah reformasi pastilah produk keputusan politik dan bukannya administratif belaka. Kedua partai tersebut setuju dengan kenaikan BBM karena untuk mempertahankan kekuasaan mereka yaitu demi pertimbangan kadernya yang mendapatkan posisi sebagai menteri. Karena apabila reformasi hanya pada tahapan tehnis. maka instrumen yang digunakan akan sangat mungkin bernuansa dan di terjemahkan oleh kepentingan elit yakni politik. Hal ini dapat merugikan reformasi administrasi kita. kedua kepentingan global tersebut tidak selamanya berdimensi tunggal. Jadi reformasi itu bukan sekedar masalah tehnis administratif. pertama ide reformasi selalu datang dari kepentingan eksternal dan bahkan global. demokrasidan kesejahteraan rakyat miskin. lanngsung maupun tidak langsung mewarnai nilai kebijakan melalui lembaga presiden atau wakil presiden yang secara langsung berhadapan dengan rakyat. Semua ini terungkap ketika negara kita melakukan pemilu secara langsung. Jadi Reformasi administyrasi akan mempertemukan birokrasi.

Tetapi pada kenyataanya di Indonesia tidak berjalan seperti teorinya. Padahal dulu pada jaman pemerintahan Soeharto pelayanan publik lebih baik. Justru pelayanan publik berjalan ketika demokrasi di singkirkan. Hal itu di karenakan adanya pengawasan dan kontrol langsung oleh pemerintah pusat. dulu jika perintah itu tidak di laksanakan maka akan di tindak langsung. . model pemerintahan demokrasi adalah model pemerintahan yang bebas mengeluarkan pendapat dan pemerintah mengutamakan suara rakyatnya di banding kepentingan pimpinannya.Komentar: Indonesia adalah negara yang menganut model pemerintahan Demokrasi. Para pejabat sekarang lebih mementingkan kepentingan pribadi dan golongannya daripada kepentingan publik atau rakyat.

You're Reading a Free Preview

Download
scribd
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->