BAB I PENDAHULUAN

A. Latar Belakang Masalah Metode Pembelajaran dapat didefinisikan sebagai cara yang digunakan guru untuk mencapai tujuan pembelajaran yang bersifat prosedural yaitu berisi tahapan tertentu. Suatu yang yang terpenting bagi seorang guru bukan hanya menyampaikan informasi dan bahan ajar kepada siswa, melainkan guru harus berusaha menciptakan agar siswa dapat memahami secara keseluruhan isi dari materi pelajaran yang disampaikan. Agar proses belajar-mengajar menjadi berhasil, untuk itu seorang guru harus mampu mempersiapkan bahan-bahan untuk kegiatan belajarmengajar di kelas serta merancang model-model pembelajaran yang sesuai agar siswa tidak bosan dan akan lebih menyenanginya. Banyak kejadian di lapangan siswa yang merasa bosan terhadap salah satu mata pelajaran dikarenakan metode yang digunakan oleh guru tidak mampu membuat siswa mengerti materi bahkan akan timbul persepsi yang negatif. Misalkan pada pelajaran IPS, siswa merasa jenuh dengan cara guru menerangkan materi karena siswa tidak diberi kesempatan bebas untuk mengeluarkan pendapat,tetapi hanya mendengarkan saja penjelasan dari guru sehingga siswa merasa jenuh. Dengan bekal kemampuan dan keterampilan dalam merancang model-model pembelajaran tentunya guru memahami dan menguasai materi serta mampu menentukan jenis model-model pembelajaran yang sesuai dengan materi yang akan digunakan dalam kegitan belajar mengajar di kelas. Salah satu model pembelajaran yang dapat diterapkan dalam kegitan belajar- mengajar IPS SD Kelas 3 adalah Model Pembelajaran Inkury. Model pembelajaran ini melatih siswa untuk belajar sendiri dan menemukan sendiri pengetahuan. Proses pembelajarannya lebih berpusat kepada siswa. Banks (1990) mengemukakan bahwamodel pembelajaran IPS dengan menggunakan inkury sosial untuk menghasilkan fakta, konsep, generalisasi, dan teori.namun tujuan utama inkury sosial adalah untuk membangun teori. Para ilmuwan sosial percaya salah satu cara membantu masyarakat adalah dengan membangun teori. Teori dapat digunakan untuk memehami, menjelaskan, memprekdisi, dan mengontrol perilaku masyarakat. Selain itu, tujuan inkuri sosial pun diharapkan dapat

Bagaimana penerapan model pembelajaran inkury dalam proses belajarmengajar pada mata pelajaran IPS SD Kelas 3? 3.membantu masyarakat dalam memecahkamn masalah ± masalah sosial sehingga mereka dapat memperoleh kehidupan yang lebih baik. Rumusan Masalah 1. dan dapat memecahkan masalah. Manfaat Makalah 1. Mengetahui pentingnya sebuah perencanaan yang matang agar proses belajr mengajar berjalan dengan baik. penemuan (discovery) dan proses pemecahan masalah (problem solving). Namun model ini memakan waktu banyak (time consuming) dan. Pembelajaran inquiry dipandang lebih efektif karena secara pribadi terlibat ( baik fisik dan mental ) dalam kegitan belajar mengajar. Tujuan Makalah Dengan proses inquiry. yang belum diketahui tetapi dapat menarik siswa. yang berarti siswa berlatih dalam proses inquiry. jika kurang terpimpin atau terarah. Siswa menemukan arti suatu konsep kemudian membuat suatu kesimpulan dan menyusun suatu generalisasi dari data yang mereka simpulkan. masalah tersebut harus didasarkan pada suatu gagasan yang memang dapat ditemukan kebenarannya dan bukan hanya mengada-ada. D. dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya. Apakah kelemahan dan kelebihan dari model pembelajran Inkuiry? C. Untuk itu inkuri harus difokuskan pada masalah-masalah praktis kemasyarakatan. . B. Manfaat Bagi Mahasiswa a. Untuk mempersiapkan bahan ± bahan untuk kegiatan belajar mengajar di kelas. diasumsikan bahwa sekolah menyediakan pengajaran yang terbaik kepada siswa untuk mengarahkan diri. menghendaki siswa terlibat secara aktif dalam pengajaran. Dalam inkuiry siswa dihadapakan pada suatu yang bersifat misterius. Karena itu inquiry mengajaran yang berpusat pada siswa. Bagaimana keaktifan siswa setelah guru menerapkan model pembelajaran Inkuiry ? 4. b. berpikir kritis. Adakah kesulitan guru dalam menentukan model pembelajaran yang sesuai dengan materi yang akan diajarkan? 2. Dengan proses inquiry siswa dilatih untuk melakukan proses .

Guru diharapkan sedapat mungkin memperbanyak latihan dalam merancang model-model pembelajaran. Manfaat Bagi Guru a. 3. Menciptakan proses belajar mengajar yang lebih efektif dengan menerapan model pembelajaran Inkuiry.2. Melatih siswa untuk mampu memecahkan masalah damn menarik kesimpulan sendiri. b. b. . Manfaat Bagi Siswa a. belajar melakukan penelitian dalam pembelajaran. Siswa lebih berperan aktif.

siswa tidak hanya berperan sebagai penerima pelajaran melalui penjelasan guru secara verbal. sehingga kemampuan guru dalam menggunakan teknik bertanya merupakan syarat utama dalam melakukan inkuiri. Ketiga. Artinya dalam pendekatan inkuiri menempatkan guru bukan sebagai sumber belajar. akan tetapi sebagai fasilitator dan motivator belajar siswa. Dalam proses pembelajaran. Aktvitas pembelajaran biasanya dilakukan melalui proses tanya jawab antara guru dan siswa. Pengetahuan yang dimiliki manusia akan bermakna (meaningfull) apabila didasari oleh keingintahuan itu. pengecapan dan indera-indera lainnya.(---------------------Sejak manusia lahir ke dunia. Pertama. pendengaran. strategi inkuiri menekankan kepada aktifitas siswa secara maksimal untuk mencari dan menemukan. manusia memiliki dorongan untuk menemukan sendiri pengetahuannya. Hingga dewasa keingintahuan manusia secara terus menerus berkembang dengan menggunakan otak dan pikirannya. artinya pendekatan inkuiri menempatkan siswa sebagai subjek belajar. akibatnya dalam pembelajaran inkuiri siswa tidak hanya dituntut agar menguasai pelajaran. sehingga diharapkan dapat menumbuhkan sikap percaya diri (self belief). Didasari hal inilah suatu model pembelajaran yang dikenal dengan inkuiri dikembangkan. atau terlibat. akan tetapi bagaimana mereka dapat menggunakan potensi yang dimilikinya. seluruh aktivitas yang dilakukan siswa diarahkan untuk mencari dan menemukan sendiri dari sesuatu yang dipertanyakan. Jika berpikir menjadi tujuan utama dari pendidikan. tujuan dari penggunaan strategi pembelajaran inkuiri adalah mengembangkan kemampuan intelektual sebagai bagian dari proses mental. maka harus ditemukan cara-cara untuk membantu individu untuk membangun kemampuan itu. Sejak kecil manusia memiliki keinginan untuk mengenal segala sesuatu melalui indera penglihatan. Ia menambahkan bahwa pembelajaran inkuiri ini bertujuan untuk memberikan cara bagi siswa untuk membangun kecakapan-kecakapan intelektual (kecakapan berpikir) terkait dengan proses-proses berpikir reflektif. Pengertian Inquiry Inquiri berasal dari kata to inquire yang berarti ikut serta. Selanjutnya Sanjaya (2008. Rasa ingin tahu tentang alam sekitar di sekelilingnya merupakan kodrat manusia sejak ia lahir ke dunia. tetapi mereka berperan untuk menemukan sendiri inti dari materi pelajaran itu sendiri. dalam mengajukan pertanyaan-pertanyaan. . dan melakukan penyelidikan. mencari informasi.196) menyatakan bahwa ada beberapa hal yang menjadi ciri utama strategi pembelajaran inkuiri. Kedua.BAB II KAJIAN PUSTAKA 1.

membuat pengamatan lebih jauh. memproses. . Jawaban pertanyaan ± Pertanyaan tersebut didapat melalui siklus menyusun dugaan. Pengertian Inquiry dalam Pembelajaran Inquiry merupakan komponen dari CTL. membuat kesimpulan. merefleksi validitas data. dan sampai pada pengambilan kesimpulan yang masih tentatif. mencari informasi. siswa belajar menggunakan ketrampilan berpikir kritis saat mereka berdiskusi dan menganalisis bukti. suatu kemungkinan pemecahan atau suatu hipotesa diajukan. Dengan dasar kata yang telah terkumpul. Yang di awalai dari pengamatan dari pertanyaan yang muncul. dan pengujian untuk pemecahan. Inquiry adalah proses perpindahan dari pengamatan menjadi pemahaman. kemudian siswa bekerja untuk memecahkan masalah itu dengan meneliti untuk suatu pemecahan. mencari informasi dan melakukan penyelidikan. siswa akan sampai pada suatu kesimpulan yang masih tentatif. Proses ini terdiri dari 5 tahap. dan menghubungkan ide ± ide atau teori untuk mendapatkan konsep. Inquiry ada banyak bentuk dan model. menyusun hipotesis. Karena itu strategi inquiri dalam proses belajar mengajar adalah strategi yang melibatkan siswa dalam tanya jawab. Melakukan inquiry berarti melibatkan diri dalam tanya jawab. Di dalam pembelajaran berdasarkan inquiry. dan pemecahan .masalah adalah salah satu dari kegiatan inquiry yang paling sering digunakan. menguji hipotesa. Dalam proses itu. Siswa menghadapi atau dihadapkan pada suatu permasalahan. Kemudian menentukan bagaimana mempresentasikan dan menjelaskan penemuannya. mengajukan hipotesa untuk diuji. dan melakukan penyelidikan. dan menyusun teori serta konsep yang berdasar pada data dan pengetahuan.BAB III PEMBAHASAN A. atau menolak hipotesa itu dan melanjutkan penyelidikan sampai menemukan pemecahan masalah yang memuaskan. kemudian penyelidikan dilakukan untuk membuktikan apakah kemungkinan pemecahan atau hipotesa itu diterima atau ditolak. Dalam pelaksanaan siswa bertanggung jawab untuk memberikan ide atau pemikiran dan pertanyaan untuk eksplorasi. mengevaluasi ide dan proposisi.

merancang prosedur atau langkah-langkah yang diperlukan. Pada dasarnya siswa selama proses belajar berlangsung akan memperoleh pedoman sesuai dengan yang diperlukan. sehingga siswa mampu melakukan proses inkuiri secara mandiri. Siswa diberi kebebasan menentukan permasalahan untuk diselidiki. Guru mempunyai peran aktif dalam menentukan permasalahan dan tahap-tahap pemecahannya. 1. bimbingan dapat pula diberikan melalui lembar kerja siswa yang terstruktur. Dengan pendekatan ini siswa belajar lebih beorientasi pada bimbingan dan petunjuk dari guru hingga siswa dapat memahami konsep-konsep pelajaran. bimbingan tersebut dikurangi. Pada pendekatan ini siswa akan dihadapkan pada tugas-tugas yang relevan untuk diselesaikan baik melalui diskusi kelompok maupun secara individual agar mampu menyelesaikan masalah dan menarik suatu kesimpulan secara mandiri. bimbingan dari guru sangat sedikit diberikan atau bahkan tidak diberikan sama sekali. Selama berlangsungnya proses belajar guru harus memantau kelompok diskusi siswa. kemudian pada tahap-tahap berikutnya. 2. Pada umumnya pendekatan ini digunakan bagi siswa yang telah berpengalaman belajar dengan pendekatan inkuiri. Di samping itu. Pada tahap awal. Jenis ± Jenis Inquiry Inquiry terbagi menjadi tiga jenis berdasarkan besarnya intervensi guru terhadap siswa atau besarnya bimbingan yang diberikan oleh guru kepada siswanya. Karena dalam pendekatan inkuiri bebas ini menempatkan siswa seolah-olah bekerja seperti seorang ilmuwan. Selama proses ini. sehingga guru dapat mengetahui dan memberikan petunjuk-petunjuk dan scafolding yang diperlukan oleh siswa. Salah satu keuntungan belajar dengan metode ini adalah adanya kemungkinan siswa dalam memecahkan masalah open ended dan mempunyai alternatif pemecahan masalah lebih . Bimbingan yang diberikan dapat berupa pertanyaan-pertanyaan dan diskusi multi arah yang dapat menggiring siswa agar dapat memahami konsep pelajaran matematika. Inquiry Terbimbing (guided inquiry approach) Pendekatan inquiry terbimbing yaitu pendekatan inquiry dimana guru membimbing siswa melakukan kegiatan dengan memberi pertanyaan awal dan mengarahkan pada suatu diskusi. Pendekatan inkuiri terbimbing ini digunakan bagi siswa yang kurang berpengalaman belajar dengan pendekatan inkuiri. menemukan dan menyelesaikan masalah secara mandiri. Inquiri Bebas (free inquiry approach). guru banyak memberikan bimbingan.B.

Suchman menyakinkani bahwa anak-anak merupakan individu yang penuh rasa ingin tahu akan segala sesuatu. Inquiri Bebas yang Dimodifikasikan ( modified free inquiry approach) Pendekatan ini merupakan kolaborasi atau modifikasi dari dua pendekatan inkuiri sebelumnya. Oleh karena itu. apabila ada siswa yang tidak dapat menyelesaikan permasalahannya. ada kemungkinan kelompok atau individual lainnya kurang memahami topik yang diselidiki oleh kelompok atau individual tertentu. antara lain: 1) waktu yang diperlukan untuk menemukan sesuatu relatif lama sehingga melebihi waktu yang sudah ditetapkan dalam kurikulum. Inquiry Training Model pembelajaran ini dikembangkan oleh seoranh tokoh yang bernama Suchman. Meskipun begitu permasalahan yang akan dijadikan topik untuk diselidiki tetap diberikan atau mempedomani acuan kurikulum yang telah ada. 3) ada kemungkinan setiap kelompok atau individual mempunyai topik berbeda. Namun. agar siswa berupaya terlebih dahulu secara mandiri. ada kemungkinan siswa menemukan cara dan solusi yang baru atau belum pernah ditemukan oleh orang lain dari masalah yang diselidiki. sehingga guru akan membutuhkan waktu yang lama untuk memeriksa hasil yang diperoleh siswa. 2) karena diberi kebebasan untuk menentukan sendiri permasalahan yang diselidiki. prosedur ilmiah dapat diajarkan secara langsung kepada mereka. Artinya. 4) karena topik yang diselidiki antara kelompok atau individual berbeda. dengan harapan agar siswa dapat menemukan sendiri penyelesaiannya. Sedangkan belajar dengan metode ini mempunyai beberapa kelemahan. 3. sehingga diskusi tidak berjalan sebagaimana yang diharapkan. atau melalui diskusi dengan siswa dalam kelompok lain. Dalam pendekatan inkuiri jenis ini guru membatasi memberi bimbingan. dalam pendekatan ini siswa tidak dapat memilih atau menentukan masalah untuk diselidiki secara sendiri.dari satu cara. Namun bimbingan yang diberikan lebih sedikit dari Inkuiri terbimbing dan tidak terstruktur. Berikut ini adalah postulat yang diajukan oleh Suchman untuk mendukung teori yang mendasari model pembelajaran ini. 4. . maka bimbingan dapat diberikan secara tidak langsung dengan memberikan contoh-contoh yang relevan dengan permasalahan yang dihadapi. ada kemungkinan topik yang diplih oleh siswa di luar konteks yang ada dalam kurikulum. namun siswa yang belajar dengan pendekatan ini menerima masalah dari gurunya untuk dipecahkan dan tetap memperoleh bimbingan. karena tergantung bagaimana cara mereka mengkonstruksi jawabannya sendiri. Selain itu. yaitu: pendekatan inkuiri terbimbing dan pendekatan inkuiri bebas.

3. Peranan Guru. Adanya kebebasan siswa untuk berpendapat. Tujuan Utama. berdiskusi. Penelitian kooperatif (cooperative inquiry) dapat memperkaya kemampuan berpikir dan membantu siswa belajar tentang suatu ilmu yang senantiasa bersifat tentatif dan belajar menghargai penjelasan atau solusi alternatif. Strategi baru dapat diajarkan secara langsung dan ditambahkan/digabungkan dengan strategi lama yang telah dimiliki siswa. Syarat ± syarat inquiry 1. dan memecahakan masalah secara almiah. 2. menjelaskan. 6.1. Guru harus terampil menumbuhkan motivasi belajar siswa dan menciptakan situasi belajar yang menyenangkan. 3. C. Guru tidak banyak campur tangan dan intervensi terhadap kegiatan siswa. D. 4. Guru harus terampil memilih persoalan ± persoalan yang relevan untuk diajukan kepada kelas (persoalan bersumber pada bahan pelajaran yang menantang siswa atau yang problematis) dan sesuai dengan daya nalar siswa. 5. Adanya fasilitas dan sumber belajar yang cukup 4. Secara alami manusia mempunyai kecenderungan untuk selalu mencari tahu segala sesuatu yang menarik perhatiannya. Apabila berpikir merupakan tujuan pendidikan. maka cara yang harus dipikirkan . Secara singkat model ini bertujuan untuk melatih kemampuan siswa dalam meniliti. Peranan Siswa. Tujuan Utama Tujuan utama pengajaran inquiry adalah menyediakan peralatan atau cara bagi siswa untuk mengembangkan ketrampilan intelektualnya yang berkaitan dengan berfikir kritis dan memecahkan masalah. 2. 1. Mereka akan menyadari keingintahuan akan segala sesuatu tersebut dan akan belajar untuk menganalisis strategi berpikirnya. Partisipasi setiap siswa dalam setiap kegiatan belajar. fenomena. Penggunaan Sumber Pengajaran Evaluasi Inquiry. berkarya.

dan menyarankan suatu alternatif penafsiran terhadap data. Sesungguhnya. tidak mencakup menspesifikasi faktor ± faktor dari suatu ilmu. melakukan hubungan pribadi yang baik. menafsirkan dan meferivikasi data. tetapi membantu siswa menemukan dan mengklarifikasi jawaban yang tepat. untuk merespon masalah yang diberikan.adalah untuk membantu mengembangkan kemampuan individual. siswa dengan bantuan guru . Melalui inquiry. Situasinya dibuat sedemikian rupa sehingga inquiry dapat berjalan dengan baik. mereka akan ³belajar bagaimana belajar´. dan bersamaan dengan itu diperlukan bantuan psycologis. Sejauh mungkin guru berusaha untuk meningkatkan cara kerja siswa secara bebas. tidak diharapkan bahwa mereka tidak dibimbing dalam penyelidikan mereka. Guru tidak menekankan kebenaran jawaban. Inquiry meminta siswa untuk berfikir secara bebas. Perhatian utama pada inquiry adalah pengembangan proses mental seperti mengidentifikasi dan menganalisis masalah. Peranan Guru Karena inquiry adalah pembelajaran yang terpusat pada siswa. menyusun hipotesa. Karena itu siswa tidak secara keseluruhan bebas mengluyur sendiri melakukan inquiry. maka peranan guru adalah sebagai pembimbing dan sebagai stimulator. menguji hipotesa dan sampai pada suatu kesimpulan. Siswa ditingkatkan kemampuannya untuk dapat menemukan sesuatu untuk diri mereka sendiri dengan mengaplikasikan prinsip metode ilmiah inquiry. Guru membuat suasana yang menjamin kebebasan untuk melakukan eksplorasi. 3. Peranan Siswa Peranan siswa dalam pengajaran inquiry adalah sebagai pengambil inisiatif atau prakarsa dalam menemukan sesuatu untuk mereka sendiri. Guru harus memilikiketrampilan khusus dalam bertanya yang dapat meningkatkan berfikir kritis dan dapat memecahkan masalah. dan berfikir untuk alternatif pemecahan. dan membimbing dalam melakukan penyelidikan. tetapi diharapkan bahwa mereka ditingkatkan keberanian mengajukan pertanyaan. Inquiry menekankan menemukan sesuatu untuk diri mereka sendiri. Tujuan inquiry adalah memberi latihan untuk mengembangkan ketrampilan intelektual yang khusus. 2. Mereka aktif menggunakan cara belajar mereka sendiri. Guru menyusun kembali dan mengklarifikasi respon siswa. mengumpulkan dan mengklasifikasi data yang relevan. Guru membantu siswa dalam menemukan sumber informasi yang tepat dan bertanggung jawab bahwa sejumlah sumber pengajaran itu cukup dan digunakan. sebagai fasilitator yang berhadapan dengan siswa membantu mereka mengidentifikasi pertanyaan dan masalah. Dengan keterbatasannya.

gambar. Seringkali. Tahap Dua Tahap Tiga . Penjelasan prosedur inquiry. Menyusun dan menguji hipotesa. buku pertanyaan atau anjuran. Peranan siswa tidak hanya merespon pertanyaan yang diajukan guru. model inquiri tidak memerlukan menggunakan materi pengajaran. perpustakaan dapat digunakan secara efektif untuk penyelidikan inquiry. Tetapi inquiry mengutamakan bagaimana siswa itu menghasilkan dan meferivikasi permasalahan. tetapi juga mengajukan pertanyaan dan menemukan jawabannya melalui penyelidikan. sifat dan peristiwa. SINTAKSIS MODEL INQUIRY Tahap Satu : Menghadapkan pemasalahan. tetapi bagaimana mereka menggunakan sumber pengajara itu. 5. Dalam pengajaran inquiry seperti halnya dengan model yang lain. Menyampaikan peristiwa peristiwa yang kontradiksi. : Pengumpulan data dan verivikasi. film strip. Sumber ± sumber seperti buku teks. : Pengumpulan data eksperimentasi. Tes yang berstandart memusatkan pada pengukuran berfikir kritis dan ketrampilan memecahkan masalah adalah lebih tepat dibandingkan dengan evaluasi yang mendasarkan diri terutama pada penguasaan suatu bidang ilmu. film. Sumber pengajaran itu digunakan untuk membuka tabir pertanyaan yang berupa hipotesa. nara sumber. Evaluasi Evaluasi hasil belajar siswa pada model inquiry dipusatkan pada sampai sejauh mana siswa dapat menggunakan ketrampilan intelektual yang berhubungan dengan pengajaran inquiry. Inquiry memerlukan data untuk penafsiran. bila inquiry digunakan maka evaluasinya didasarkan pada banyak pengetahuan yang dipindahkan. dan diberi kesempatan untuk malakukan pemilihan alternatif pemecahan masalah.menyusun tujuan mereka sendiri. Siswa tidak hanya dievaluasi pada kemampuan mengingat (recall) dan mereproduksi informasi. Mengisolasi variabel yang relevan. Penggunaan Sumber Pengajaran Berlawanan seperti apa yang sering dianggap. Hubungan sebab akibat. 4. masalahnya bukan sumber pengajaran apa. keadaan. Siswa bebas melakukan eksplorasi. Memverifikasi benda.

2. Disini terjadi integrasi konsep sains dengan proses sains. pertanyaan. dan observasi siswa mampu menghubungkan pengetahuan sains pribadi dengan konsep komunitas sains. eksplorasi fenomena  Guru mendorong untuk mendiskusikan suatu dan menjelaskan bekerja. E. pertanyaan. Karakteristik Model Inquiry 1. Desain   Proses desain melalui prosedur materi. Formulasi dan Penjelasan. menemukan hubungan dengan literature. Tahap Lima : Analisis Proses inquiry Analisis strategi inquiry dan mengembangkan proses inquiry lebih efektif. dan observasi proses koneksi melalui : konsiliasai. pertanyaan. Investigasi  proses melalui koleksi dan mempresentasikan data . Koneksi    proses koneksi melalui : konsiliasai. dan observasi proses koneksi melalui : konsiliasai. pemahaman mereka bagaimana fenomena menggunakan contoh dari pengalaman pribadi. Siswa membuat perencanaan mengumpulkan data yang bermakana yang ditujukan pada pertanyaan. Menyusun aturan atau penjelasan.Tahap Empat : Mengorganisir.  guru memantauketepatanaktifitassiswa 3.  Dilakukan dengan diskusi bersama.

danprediksi. Tahap kedua. dan prosesnya dilakukan dengan ³yes and no questions´ yaitu pertanyaan yang diajukan siswa. dan akan dijawab oleh guru dengan ³jawaban ya atau tidak´. c. Di dalam penjelasan diaturkan tentang tujuan. dan memperjelas hasil penyelidikan. 4. siswa dapat membaca data secara akurat. MembangunPengetahuan   proses melalui reflektif ± konstruksi ± prediksi. Namun permulaan pelaksanaan inquiry dapat dimulai dengan masalah yanmg sederhana. b. Kelima tahap pelaksanaan inquiry adalah sebagai berikut : a. ialah melakukan eksperimentasi. Aplikasi inquiry Salah satu model inquiry yang berangkat dari fakta sampai pada teori. teka ± teki yang sederhana yang tidak banyak memerlukan latar belakang pengetahuan tentang teka ± teki tersebut. dimana para siswa mengumpulkan data atau informasi tentang peristiwa (masalah) yang telah mereka lihat atau alami. yang F. Dalam memberikan permasalahan dapat berupa peristiwa yang kontradiksi. adalah latihan inquiry yang dianjurkan oleh Bruce Joyce dan Marsha Weil (1986).  siswadapatmengaplikasikanpemahamannyapadasituasibaru mengembangkaninferensi. Tahap ketiga. Yang diutamakan dalam hal ini ialah pengalaman proses berfikir secara inquiry.  gurubertukarpendapatterhadappemahamansiswa. mengorganisasi data dengan cara yang logis dan bermakna. guru memberi permasalahan. dan dapat juga berbentuk tekai ± teki. dan menjelaskan prosedur pelaksanaan inquiry kepada siswa. generalisasi. ialah verifikasi. Tahap pertama. konsep yang dilakukan dengan eksperimen akan memberi arti yang lebih bermakna dan mampu berfikir kritis. Ia harus menghubungkan antara interpretasi ilmiah yang diterima. ide atau pikiran yang sederhana. Siswa mengajukan faktor atau unsur yang baru ke dalam permasalahan untuk dapat . dengan mengajukan pertanyaan kepada guru sedemikian rupa sehingga guru terpaksa menjawab ³ya atau tidak´.

pertanyaan itu produktif atau tidak produktif. Biasanya siswa mendapatkan kesulitan dalam membuat lompatan intelektual. Dalam proses verifikasi mereka boleh mengajukan pertanyaan tentang : 1) Benda (obyects) 2) Sifat (properties) 3) Kondisi (conditions) 4) Peristiwa (events) d. tetapi dapat memberi saran untuk suatu teori. Banyak pertanyaan verifikasi dan eksperimen diperlukan hanya untuk meneliti suatu teori. ada informasi yang diperlukan tapi tidak diperoleh. siswa diminta untuk menganalisis proses inquiry. tetapi peserta didik yang diberi peluang . guru menyajikan bahan pelajaran tidak dalam bentuknya yang final. Tugas berikutnya dari guru ialah memperdalam proses inquiry siswa dengan memperluas jenis-jenis informasi yang mereka peroleh. e. dari informasi yang komprehen yang mereka kumpulkan menjadi suatu penjelasan yang cukup jelas. Walaupun tahap kedua dan ketiga terpisah. namun cara berpikir siswa dan bentuk pertanyaan yang diajukan umumnya berada di antara dua tahap ini. Proses merubah hipotesa kedalam eksperimentasi adalah tidak mudah dan memerlukan latihan atau praktek. Mereka diperkenankan memberi penjelasan yang kurang dengan menghilangkan beberapa bagian yang penting. Prosedur Inquiry Di dalam sistem belajar ± mengajar ini. Seringkali ada beberapa teori atau penjelasan yang didasarkan pada data yang sama.melihat apakah peristiwa itu dapat terjadi secara berbeda. Tahap keempat. yaitu eksplorasi dan menguji langsung. G. Eksperimen memiliki dua fungsi. Eksplorasi adalah merubah sesuatu untuk melihat apa yang akan terjadi dan tidak perlu bimbingan teori atau hipotesis. guru meminta siswa untuk mengorganisir data dan menyusun suatu penjelasan. Menguji secara langsung terjadi bila siswa melakukan uji coba teori atau hipotesa. Tahap kelima. Tahap ini penting jika kita ingin membuat proses inquiry secara sadar dan secara sistematis mencoba untuk memperbaikinya. Mereka boleh menentukan bahwa pertanyaan itu efektif atau tidak efektif.

Generalization : Tahap selanjutnya. dengan kata lain. bahkan kalu perlu dihitung dengan cara tertentu serta ditafsirkan pada tingkat kepercayaan tertentu. peserta didik diberi kesempatan untuk mengumpulkan berbagai informasi yang relevan.. dan sebagainya. 5. misalnya siswa mengawali dengan belajar bagaimana belajar dan bekerja dengan menggunakan peta dan globe. Data collection : Untuk menjawab pertanyaan atau membuktikan benar tidaknya hipotesis itu. berdasarkan hasil verifikasi tadi siswa belajar menrik generalisasi atau kesimpulan tertentu. terbukti atau tidak. Stimulation : Guru mulai dengan bertanya mengajukan mengajukan persoalan. Problem statement : Peserta didik diberi kesempatan untuk mengidentifikasi berbagai permasalahan. 4. Data processing : Semua informasi (hasil bacaan wawancara. sebanyak mungkin memilihnya yang dipandang paling menarik dan fleksibel untuk dipecahkan. mencoba (uji coba) sendiri. atau menyuruh peserta didik membaca atau mendengarkan uraian yang memuat permasalahan. . diacak. Untuk siswa sekolah dasar pada kelas-kelas rendah dapat juga menggunakan pendekatan inquiry ini melalui pembelajaran-pembelajaran yang sederhana. mewawancarai orang sumber. ditabulasikan. diklasifikasikan. Contoh Penerapan inquiry di SD kelas 3 Pembelajaran IPS dengan menggunakan pendekatan inquiry dapat di terapkan pada semua jenjang dan kelas. H. Secara garis besar prosedurnya sebagai berikut : 1. Dibawah ini adalah contoh pembelajaran inquiry tentang ³Peta dan Globe´ pada kelas 3 SD. 2. dengan jelas membaca literatur mengamati objeknya.untuk mencari dan menemukan sendiri dengan mempergunakan teknik pendekatan pemecahan masalah. apakah terjawab atau. 6. Verifikation : Berdasarkan hasil pengolahan dan tafsiran atau informasi yang ada tersebut (available information). pertanyaan atau hipotesis yang telah dirumuskan terdahulu itu kemudian dicek. 3. Permasalahan yang dipilih ini selanjutnya harus dirumuskan dalam bentuk pertanyaan atau hipotesis (pernyataan sebagai jawaban sementara atas pertanyaan tersebut). observasi. dan sebagainya) itu diolah.

Inilah ada di peta. Prosedur: Bimbinglah siswa melalui langkah-langkah berikut ini: Tahap 1 Guru: Siapa diantara kamu yang pernah melihat danau? Sungai? Adakah diantara kamu yang pernah melihat laut? Seperti apakah sungai. Beri pula dorongan agar mereka bercerita atau menjelaskan apa yang telah mereka ketahui. mari kita lihat Laut Jawa. Kembangkan pertanyaan itu hingga para siswa menyebutkan bahwa semua tempat itu berisi air. Mari kita lihat bola dunia ini. .) Tahukah kamu bahwa lautan lebih luas daripada daratan? Orang yang membuat peta dan globe mempunyai kesulitan karena harus dapat meyakinkan orang lain wilayah mana yang berupa daratan dan wilayah mana yang berbentuk lautan. Mereka mungkin mewarnai bagian/tempat yang ada airnya.Tujuan: Pada akhir proses belajar mengajar diharapkan para siswa dapat (1) mengenal simbol-simbol yang ada di dalam peta dan (2) mengemukakan alasan mengapa harus menggunakan simbol yang berbeda-beda. Mungkin juga mereka menggambar gelombang pada tempat yang ada airnya. y Tahap 3 Guru: Anggaplah bahwa kita adalah ilmuwan yang akan menguji pendapat siapa yang paling tepat. dan laut itu? (Siswa menjawab setiap pertanyaan. (Pegang bola dinia ini) Coba berikan nama laut ini? (Apabila kamu tidak tahu coba bantu oleh yang lainnya) Baiklah. Ini ada di peta? Apa warnanya? (Siswa menjawab: ³biru´) Mari lihat pula Samudra Indonesia. Apa warnanya? (Siswa menjawab: ³warnanya sama ± biru´) Tahap 4 Beri lagi pertanyaan untuk membuktikan bahwa mereka telah menguasainya. Tahap 2 Guru: Bagaimana pembuat globe untuk mengatasi kesulitan ini? Bagaimana pendapatmu tentang cara menunjukkan lokasi perairan? Kemungkinan jawaban siswa: y y Mungkin siswa menuliskan kata ³air´ pada tempat yang ada airnya. danau.

mengapa pembuat bola dunia memilih cara membuat simbol laut dengan warna biru? Maksud saya. Karena ada wilayah perairan laut yang sempit sehingga akan sulit menuliskan kata ³air´ pada tempat itu´. bagaimana pembuat bola dunia menggambar lautan agar berbeda dengan simbol lainnya? (Siswa menjawab: ³warnanya biru´) Tahukah kamu. Pembelajaran dengan menggunakan pendekatan inquiry di sekolah dasar untuk kelas yang lebih tinggi dapat dengan cara melakukan analisis terhadap suatu data . Guru: Dari apa yang telah kita pelajari. pada tahap ini pun dirancang untuk membuat penjelasan umum yang dapat diterapkan dalam situasi lainnya. Di bawah ini ditampilkan suatu contoh model inquiry untuk siswa SD kelas 6 dengan topik kependudukan.Guru: Berdasarkan informasi yang telah kita diketahui. warna biru digunakan untuk menunjukan perairan´. Kelemahan . ³Menggambarkan gelombang untuk lautan mungkin saja.) Tahap 5 Tahap ini adalah kesimpulan dari seluruh pelajaran. I. mudah ditransfer (untuk menghadapi pemecahan masalah). namun kesulitan untuk sungai´. ³Akan sulit juga menuliskan kata ³air´ untuk menunjukan suatu ³sungai´. Kelebihan dan Kelemahan Inquiry Kelebihan Bahwa hasil belajar dengan cara ini lebih mudah dihafal dan diingat. mengapa mereka tidak menuliskan ³air´ pada tempattempat yang menunjukan lautan atau menggambarkan gelombang? (Para siswa menjawab: ³Apabila pembuat bola dunia itu menuliskan kata µair´ maka ia harus menuliskan kata air beberapa kali´. Pengetahuan dan kecakapan (intelektual potency) peserta didik yang bersangkutan lebih jauh lagi dapat menumbuhkan motif intrinsik (karena peserta didik merasa puas atas penggunannya sendiri). dapatkah kamu mengemukakan simbol wilayah perairan pada peta dan bola dunia (globe)? (Siswa menjawab: ³Wilayah perairan itu digambarkan dengan warna biru´). Samakah simbol yang dibuat untuk wilayah perairan laut? (Guru dan siswa melihat-lihat peta dan bola dunia lainnya.) Kesimpulannya: ³Umumnya pada peta dan bola dunia. Marilah kita perhatikan peta dan bola dunia lainnya. Selain itu.

J.Kelemahan dari inquiry antara lain memakan waktu banyak (time consuming) dan. baik secara individu ataupun secara kelompok 3a Siswa tidak banyak berusaha mencari informasi untuk membuktikan praduga . dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya. Bagan Penerapan Inquiry Guru memilih tingkah laku/tujuan 1 2 Guru mengajukan pertanyaan yang dapat menumbuhkan siswa menemukan pendapatnya 3 Siswa menetapkan hipotesis /praduga jawaban untuk dikaji lebih lanjut (alternatif jawaban) 4a Secara spontan siswa menjelajahi informasi/data untuk menguji praduga. kalau kurang terpimpin atau terarah.

contoh untuk bentuk ini telah dikemukakan dalam perilaku pemecahan masalah.cara sebagai beriktu : y Didasarkan pada artefak (artifact) yaitu benda ± benda hasil kepandaian manusia. Misalnya adanya protes dari penduduk suatu wilayah tentang pencemaran limbah industri terhadap sumber air penduduk. y Inquiry berdasarkan situasi masalah yang diminta pemecahan. . Misalnya manusia diminta mempelajari makna simbol yang terdapat pada mata uang bangsanya. mendorong melakukan kegiatan belajar untuk mencari informasi yang diperoleh Inquiry Siswa mengidentifikasi beberapa kemungkinan jawaban/menarik kesimpulan 5 Keterangan : Jalur 1 ± 2 ± 3 ± 4a ± 5 1 ± 2 ± 3 ± 3a ± 4b ± 5 BAB IV PENUTUP A. y Inquiry berdasarkan isu ± isu yang kontroversial atau kejadian sekarang. Kesimpulan Model pembelajaran inkuiry dapat dilakukan dengan cara.Siswa menarik kesimpulan 4b Guru membantu siswa.

Misalnya kontak ± kontak yang dilakukan oleh suku terasing dengan kelompok masyarakat lain dan pengaruhnya terhadap suku terasing tersebut. Saran . Gambar dan ilustrasi adalah untuk meningkatkan ketelitian terhadap konsep yang dikemukakan dalam buku teks IPS. y Inquiry yang didasarkan pada potret dan ilustrasi.y Inquiry yang berdasarkan pada konsep ± konsep yang ditemukan dalam pelajaran. Untuk itu misalnya guru dapat mengajukan pertanyaan pada siswa misalnya: 1) Apa hubungan antara gambar atau ilustrasi tersebut dengan materi/konsep yang kita bicarakan ? atau 2) Kapan gambar tersebut dibuat? B. misalnya mempelajari bagaimana kontak dengan budaya lain mempengaruhi cara kehidupan.

Sign up to vote on this title
UsefulNot useful