BAB I PENDAHULUAN

A. Latar Belakang Masalah Metode Pembelajaran dapat didefinisikan sebagai cara yang digunakan guru untuk mencapai tujuan pembelajaran yang bersifat prosedural yaitu berisi tahapan tertentu. Suatu yang yang terpenting bagi seorang guru bukan hanya menyampaikan informasi dan bahan ajar kepada siswa, melainkan guru harus berusaha menciptakan agar siswa dapat memahami secara keseluruhan isi dari materi pelajaran yang disampaikan. Agar proses belajar-mengajar menjadi berhasil, untuk itu seorang guru harus mampu mempersiapkan bahan-bahan untuk kegiatan belajarmengajar di kelas serta merancang model-model pembelajaran yang sesuai agar siswa tidak bosan dan akan lebih menyenanginya. Banyak kejadian di lapangan siswa yang merasa bosan terhadap salah satu mata pelajaran dikarenakan metode yang digunakan oleh guru tidak mampu membuat siswa mengerti materi bahkan akan timbul persepsi yang negatif. Misalkan pada pelajaran IPS, siswa merasa jenuh dengan cara guru menerangkan materi karena siswa tidak diberi kesempatan bebas untuk mengeluarkan pendapat,tetapi hanya mendengarkan saja penjelasan dari guru sehingga siswa merasa jenuh. Dengan bekal kemampuan dan keterampilan dalam merancang model-model pembelajaran tentunya guru memahami dan menguasai materi serta mampu menentukan jenis model-model pembelajaran yang sesuai dengan materi yang akan digunakan dalam kegitan belajar mengajar di kelas. Salah satu model pembelajaran yang dapat diterapkan dalam kegitan belajar- mengajar IPS SD Kelas 3 adalah Model Pembelajaran Inkury. Model pembelajaran ini melatih siswa untuk belajar sendiri dan menemukan sendiri pengetahuan. Proses pembelajarannya lebih berpusat kepada siswa. Banks (1990) mengemukakan bahwamodel pembelajaran IPS dengan menggunakan inkury sosial untuk menghasilkan fakta, konsep, generalisasi, dan teori.namun tujuan utama inkury sosial adalah untuk membangun teori. Para ilmuwan sosial percaya salah satu cara membantu masyarakat adalah dengan membangun teori. Teori dapat digunakan untuk memehami, menjelaskan, memprekdisi, dan mengontrol perilaku masyarakat. Selain itu, tujuan inkuri sosial pun diharapkan dapat

Tujuan Makalah Dengan proses inquiry. menghendaki siswa terlibat secara aktif dalam pengajaran. diasumsikan bahwa sekolah menyediakan pengajaran yang terbaik kepada siswa untuk mengarahkan diri. D. . Dalam inkuiry siswa dihadapakan pada suatu yang bersifat misterius. Manfaat Makalah 1. Karena itu inquiry mengajaran yang berpusat pada siswa. Rumusan Masalah 1. Adakah kesulitan guru dalam menentukan model pembelajaran yang sesuai dengan materi yang akan diajarkan? 2. berpikir kritis. jika kurang terpimpin atau terarah. masalah tersebut harus didasarkan pada suatu gagasan yang memang dapat ditemukan kebenarannya dan bukan hanya mengada-ada. Pembelajaran inquiry dipandang lebih efektif karena secara pribadi terlibat ( baik fisik dan mental ) dalam kegitan belajar mengajar. Mengetahui pentingnya sebuah perencanaan yang matang agar proses belajr mengajar berjalan dengan baik. penemuan (discovery) dan proses pemecahan masalah (problem solving). Siswa menemukan arti suatu konsep kemudian membuat suatu kesimpulan dan menyusun suatu generalisasi dari data yang mereka simpulkan. yang belum diketahui tetapi dapat menarik siswa. B. Namun model ini memakan waktu banyak (time consuming) dan. b. Bagaimana keaktifan siswa setelah guru menerapkan model pembelajaran Inkuiry ? 4. Manfaat Bagi Mahasiswa a. Dengan proses inquiry siswa dilatih untuk melakukan proses . Untuk itu inkuri harus difokuskan pada masalah-masalah praktis kemasyarakatan.membantu masyarakat dalam memecahkamn masalah ± masalah sosial sehingga mereka dapat memperoleh kehidupan yang lebih baik. dan dapat memecahkan masalah. yang berarti siswa berlatih dalam proses inquiry. Untuk mempersiapkan bahan ± bahan untuk kegiatan belajar mengajar di kelas. Bagaimana penerapan model pembelajaran inkury dalam proses belajarmengajar pada mata pelajaran IPS SD Kelas 3? 3. dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya. Apakah kelemahan dan kelebihan dari model pembelajran Inkuiry? C.

Manfaat Bagi Siswa a. . Guru diharapkan sedapat mungkin memperbanyak latihan dalam merancang model-model pembelajaran. Manfaat Bagi Guru a. Melatih siswa untuk mampu memecahkan masalah damn menarik kesimpulan sendiri. Menciptakan proses belajar mengajar yang lebih efektif dengan menerapan model pembelajaran Inkuiry. b. b. Siswa lebih berperan aktif. 3. belajar melakukan penelitian dalam pembelajaran.2.

tujuan dari penggunaan strategi pembelajaran inkuiri adalah mengembangkan kemampuan intelektual sebagai bagian dari proses mental. tetapi mereka berperan untuk menemukan sendiri inti dari materi pelajaran itu sendiri. manusia memiliki dorongan untuk menemukan sendiri pengetahuannya. pendengaran. dan melakukan penyelidikan. Kedua.(---------------------Sejak manusia lahir ke dunia. Pengertian Inquiry Inquiri berasal dari kata to inquire yang berarti ikut serta. dalam mengajukan pertanyaan-pertanyaan. akan tetapi bagaimana mereka dapat menggunakan potensi yang dimilikinya. seluruh aktivitas yang dilakukan siswa diarahkan untuk mencari dan menemukan sendiri dari sesuatu yang dipertanyakan. Rasa ingin tahu tentang alam sekitar di sekelilingnya merupakan kodrat manusia sejak ia lahir ke dunia. atau terlibat. akan tetapi sebagai fasilitator dan motivator belajar siswa.196) menyatakan bahwa ada beberapa hal yang menjadi ciri utama strategi pembelajaran inkuiri. Jika berpikir menjadi tujuan utama dari pendidikan. Dalam proses pembelajaran. . maka harus ditemukan cara-cara untuk membantu individu untuk membangun kemampuan itu. pengecapan dan indera-indera lainnya. Selanjutnya Sanjaya (2008. siswa tidak hanya berperan sebagai penerima pelajaran melalui penjelasan guru secara verbal. Ia menambahkan bahwa pembelajaran inkuiri ini bertujuan untuk memberikan cara bagi siswa untuk membangun kecakapan-kecakapan intelektual (kecakapan berpikir) terkait dengan proses-proses berpikir reflektif. strategi inkuiri menekankan kepada aktifitas siswa secara maksimal untuk mencari dan menemukan. Pengetahuan yang dimiliki manusia akan bermakna (meaningfull) apabila didasari oleh keingintahuan itu. Ketiga. mencari informasi. Artinya dalam pendekatan inkuiri menempatkan guru bukan sebagai sumber belajar. Pertama. Didasari hal inilah suatu model pembelajaran yang dikenal dengan inkuiri dikembangkan. akibatnya dalam pembelajaran inkuiri siswa tidak hanya dituntut agar menguasai pelajaran. Hingga dewasa keingintahuan manusia secara terus menerus berkembang dengan menggunakan otak dan pikirannya. artinya pendekatan inkuiri menempatkan siswa sebagai subjek belajar. Sejak kecil manusia memiliki keinginan untuk mengenal segala sesuatu melalui indera penglihatan. sehingga diharapkan dapat menumbuhkan sikap percaya diri (self belief).BAB II KAJIAN PUSTAKA 1. Aktvitas pembelajaran biasanya dilakukan melalui proses tanya jawab antara guru dan siswa. sehingga kemampuan guru dalam menggunakan teknik bertanya merupakan syarat utama dalam melakukan inkuiri.

Dengan dasar kata yang telah terkumpul. Dalam pelaksanaan siswa bertanggung jawab untuk memberikan ide atau pemikiran dan pertanyaan untuk eksplorasi. mencari informasi. dan pemecahan . mengevaluasi ide dan proposisi. merefleksi validitas data. Karena itu strategi inquiri dalam proses belajar mengajar adalah strategi yang melibatkan siswa dalam tanya jawab. dan pengujian untuk pemecahan. atau menolak hipotesa itu dan melanjutkan penyelidikan sampai menemukan pemecahan masalah yang memuaskan. mencari informasi dan melakukan penyelidikan. dan menyusun teori serta konsep yang berdasar pada data dan pengetahuan.masalah adalah salah satu dari kegiatan inquiry yang paling sering digunakan. dan melakukan penyelidikan. Dalam proses itu. Siswa menghadapi atau dihadapkan pada suatu permasalahan.BAB III PEMBAHASAN A. menyusun hipotesis. Proses ini terdiri dari 5 tahap. . kemudian penyelidikan dilakukan untuk membuktikan apakah kemungkinan pemecahan atau hipotesa itu diterima atau ditolak. Melakukan inquiry berarti melibatkan diri dalam tanya jawab. dan sampai pada pengambilan kesimpulan yang masih tentatif. siswa akan sampai pada suatu kesimpulan yang masih tentatif. Pengertian Inquiry dalam Pembelajaran Inquiry merupakan komponen dari CTL. dan menghubungkan ide ± ide atau teori untuk mendapatkan konsep. memproses. Inquiry ada banyak bentuk dan model. Yang di awalai dari pengamatan dari pertanyaan yang muncul. menguji hipotesa. suatu kemungkinan pemecahan atau suatu hipotesa diajukan. membuat kesimpulan. Jawaban pertanyaan ± Pertanyaan tersebut didapat melalui siklus menyusun dugaan. Kemudian menentukan bagaimana mempresentasikan dan menjelaskan penemuannya. Di dalam pembelajaran berdasarkan inquiry. mengajukan hipotesa untuk diuji. kemudian siswa bekerja untuk memecahkan masalah itu dengan meneliti untuk suatu pemecahan. membuat pengamatan lebih jauh. Inquiry adalah proses perpindahan dari pengamatan menjadi pemahaman. siswa belajar menggunakan ketrampilan berpikir kritis saat mereka berdiskusi dan menganalisis bukti.

kemudian pada tahap-tahap berikutnya. Inquiri Bebas (free inquiry approach). Bimbingan yang diberikan dapat berupa pertanyaan-pertanyaan dan diskusi multi arah yang dapat menggiring siswa agar dapat memahami konsep pelajaran matematika. bimbingan dapat pula diberikan melalui lembar kerja siswa yang terstruktur. Guru mempunyai peran aktif dalam menentukan permasalahan dan tahap-tahap pemecahannya. 1. Selama berlangsungnya proses belajar guru harus memantau kelompok diskusi siswa. bimbingan dari guru sangat sedikit diberikan atau bahkan tidak diberikan sama sekali. Jenis ± Jenis Inquiry Inquiry terbagi menjadi tiga jenis berdasarkan besarnya intervensi guru terhadap siswa atau besarnya bimbingan yang diberikan oleh guru kepada siswanya. guru banyak memberikan bimbingan. Salah satu keuntungan belajar dengan metode ini adalah adanya kemungkinan siswa dalam memecahkan masalah open ended dan mempunyai alternatif pemecahan masalah lebih .B. Karena dalam pendekatan inkuiri bebas ini menempatkan siswa seolah-olah bekerja seperti seorang ilmuwan. merancang prosedur atau langkah-langkah yang diperlukan. Pada umumnya pendekatan ini digunakan bagi siswa yang telah berpengalaman belajar dengan pendekatan inkuiri. Siswa diberi kebebasan menentukan permasalahan untuk diselidiki. sehingga guru dapat mengetahui dan memberikan petunjuk-petunjuk dan scafolding yang diperlukan oleh siswa. Di samping itu. 2. menemukan dan menyelesaikan masalah secara mandiri. Inquiry Terbimbing (guided inquiry approach) Pendekatan inquiry terbimbing yaitu pendekatan inquiry dimana guru membimbing siswa melakukan kegiatan dengan memberi pertanyaan awal dan mengarahkan pada suatu diskusi. Pada dasarnya siswa selama proses belajar berlangsung akan memperoleh pedoman sesuai dengan yang diperlukan. sehingga siswa mampu melakukan proses inkuiri secara mandiri. Selama proses ini. Pendekatan inkuiri terbimbing ini digunakan bagi siswa yang kurang berpengalaman belajar dengan pendekatan inkuiri. Dengan pendekatan ini siswa belajar lebih beorientasi pada bimbingan dan petunjuk dari guru hingga siswa dapat memahami konsep-konsep pelajaran. Pada tahap awal. Pada pendekatan ini siswa akan dihadapkan pada tugas-tugas yang relevan untuk diselesaikan baik melalui diskusi kelompok maupun secara individual agar mampu menyelesaikan masalah dan menarik suatu kesimpulan secara mandiri. bimbingan tersebut dikurangi.

4) karena topik yang diselidiki antara kelompok atau individual berbeda. sehingga guru akan membutuhkan waktu yang lama untuk memeriksa hasil yang diperoleh siswa. 2) karena diberi kebebasan untuk menentukan sendiri permasalahan yang diselidiki. Berikut ini adalah postulat yang diajukan oleh Suchman untuk mendukung teori yang mendasari model pembelajaran ini. antara lain: 1) waktu yang diperlukan untuk menemukan sesuatu relatif lama sehingga melebihi waktu yang sudah ditetapkan dalam kurikulum. maka bimbingan dapat diberikan secara tidak langsung dengan memberikan contoh-contoh yang relevan dengan permasalahan yang dihadapi. yaitu: pendekatan inkuiri terbimbing dan pendekatan inkuiri bebas. Sedangkan belajar dengan metode ini mempunyai beberapa kelemahan. karena tergantung bagaimana cara mereka mengkonstruksi jawabannya sendiri.dari satu cara. 3. 4. Artinya. ada kemungkinan topik yang diplih oleh siswa di luar konteks yang ada dalam kurikulum. Oleh karena itu. Namun. apabila ada siswa yang tidak dapat menyelesaikan permasalahannya. dalam pendekatan ini siswa tidak dapat memilih atau menentukan masalah untuk diselidiki secara sendiri. Namun bimbingan yang diberikan lebih sedikit dari Inkuiri terbimbing dan tidak terstruktur. Inquiry Training Model pembelajaran ini dikembangkan oleh seoranh tokoh yang bernama Suchman. Suchman menyakinkani bahwa anak-anak merupakan individu yang penuh rasa ingin tahu akan segala sesuatu. prosedur ilmiah dapat diajarkan secara langsung kepada mereka. atau melalui diskusi dengan siswa dalam kelompok lain. Meskipun begitu permasalahan yang akan dijadikan topik untuk diselidiki tetap diberikan atau mempedomani acuan kurikulum yang telah ada. ada kemungkinan siswa menemukan cara dan solusi yang baru atau belum pernah ditemukan oleh orang lain dari masalah yang diselidiki. namun siswa yang belajar dengan pendekatan ini menerima masalah dari gurunya untuk dipecahkan dan tetap memperoleh bimbingan. . ada kemungkinan kelompok atau individual lainnya kurang memahami topik yang diselidiki oleh kelompok atau individual tertentu. 3) ada kemungkinan setiap kelompok atau individual mempunyai topik berbeda. Dalam pendekatan inkuiri jenis ini guru membatasi memberi bimbingan. dengan harapan agar siswa dapat menemukan sendiri penyelesaiannya. Selain itu. Inquiri Bebas yang Dimodifikasikan ( modified free inquiry approach) Pendekatan ini merupakan kolaborasi atau modifikasi dari dua pendekatan inkuiri sebelumnya. sehingga diskusi tidak berjalan sebagaimana yang diharapkan. agar siswa berupaya terlebih dahulu secara mandiri.

maka cara yang harus dipikirkan . 2. 2. Secara singkat model ini bertujuan untuk melatih kemampuan siswa dalam meniliti. Adanya kebebasan siswa untuk berpendapat. 3. C. fenomena. 1. Peranan Guru. Apabila berpikir merupakan tujuan pendidikan.1. dan memecahakan masalah secara almiah. Syarat ± syarat inquiry 1. Tujuan Utama. Peranan Siswa. Partisipasi setiap siswa dalam setiap kegiatan belajar. menjelaskan. Penelitian kooperatif (cooperative inquiry) dapat memperkaya kemampuan berpikir dan membantu siswa belajar tentang suatu ilmu yang senantiasa bersifat tentatif dan belajar menghargai penjelasan atau solusi alternatif. 4. Strategi baru dapat diajarkan secara langsung dan ditambahkan/digabungkan dengan strategi lama yang telah dimiliki siswa. Penggunaan Sumber Pengajaran Evaluasi Inquiry. berkarya. Secara alami manusia mempunyai kecenderungan untuk selalu mencari tahu segala sesuatu yang menarik perhatiannya. 3. Mereka akan menyadari keingintahuan akan segala sesuatu tersebut dan akan belajar untuk menganalisis strategi berpikirnya. 5. Guru harus terampil menumbuhkan motivasi belajar siswa dan menciptakan situasi belajar yang menyenangkan. Guru tidak banyak campur tangan dan intervensi terhadap kegiatan siswa. berdiskusi. 6. Tujuan Utama Tujuan utama pengajaran inquiry adalah menyediakan peralatan atau cara bagi siswa untuk mengembangkan ketrampilan intelektualnya yang berkaitan dengan berfikir kritis dan memecahkan masalah. Adanya fasilitas dan sumber belajar yang cukup 4. Guru harus terampil memilih persoalan ± persoalan yang relevan untuk diajukan kepada kelas (persoalan bersumber pada bahan pelajaran yang menantang siswa atau yang problematis) dan sesuai dengan daya nalar siswa. D.

tidak mencakup menspesifikasi faktor ± faktor dari suatu ilmu. Karena itu siswa tidak secara keseluruhan bebas mengluyur sendiri melakukan inquiry. menafsirkan dan meferivikasi data.adalah untuk membantu mengembangkan kemampuan individual. mereka akan ³belajar bagaimana belajar´. menyusun hipotesa. untuk merespon masalah yang diberikan. tetapi diharapkan bahwa mereka ditingkatkan keberanian mengajukan pertanyaan. Guru membuat suasana yang menjamin kebebasan untuk melakukan eksplorasi. 3. Melalui inquiry. Situasinya dibuat sedemikian rupa sehingga inquiry dapat berjalan dengan baik. Sesungguhnya. Siswa ditingkatkan kemampuannya untuk dapat menemukan sesuatu untuk diri mereka sendiri dengan mengaplikasikan prinsip metode ilmiah inquiry. Perhatian utama pada inquiry adalah pengembangan proses mental seperti mengidentifikasi dan menganalisis masalah. dan menyarankan suatu alternatif penafsiran terhadap data. mengumpulkan dan mengklasifikasi data yang relevan. siswa dengan bantuan guru . Guru tidak menekankan kebenaran jawaban. menguji hipotesa dan sampai pada suatu kesimpulan. Peranan Siswa Peranan siswa dalam pengajaran inquiry adalah sebagai pengambil inisiatif atau prakarsa dalam menemukan sesuatu untuk mereka sendiri. Mereka aktif menggunakan cara belajar mereka sendiri. Guru menyusun kembali dan mengklarifikasi respon siswa. tidak diharapkan bahwa mereka tidak dibimbing dalam penyelidikan mereka. Peranan Guru Karena inquiry adalah pembelajaran yang terpusat pada siswa. dan membimbing dalam melakukan penyelidikan. dan berfikir untuk alternatif pemecahan. Guru membantu siswa dalam menemukan sumber informasi yang tepat dan bertanggung jawab bahwa sejumlah sumber pengajaran itu cukup dan digunakan. Tujuan inquiry adalah memberi latihan untuk mengembangkan ketrampilan intelektual yang khusus. Guru harus memilikiketrampilan khusus dalam bertanya yang dapat meningkatkan berfikir kritis dan dapat memecahkan masalah. maka peranan guru adalah sebagai pembimbing dan sebagai stimulator. Dengan keterbatasannya. 2. tetapi membantu siswa menemukan dan mengklarifikasi jawaban yang tepat. dan bersamaan dengan itu diperlukan bantuan psycologis. Sejauh mungkin guru berusaha untuk meningkatkan cara kerja siswa secara bebas. Inquiry menekankan menemukan sesuatu untuk diri mereka sendiri. sebagai fasilitator yang berhadapan dengan siswa membantu mereka mengidentifikasi pertanyaan dan masalah. melakukan hubungan pribadi yang baik. Inquiry meminta siswa untuk berfikir secara bebas.

Sumber ± sumber seperti buku teks. dan diberi kesempatan untuk malakukan pemilihan alternatif pemecahan masalah. Hubungan sebab akibat. sifat dan peristiwa. perpustakaan dapat digunakan secara efektif untuk penyelidikan inquiry. Siswa tidak hanya dievaluasi pada kemampuan mengingat (recall) dan mereproduksi informasi. Sumber pengajaran itu digunakan untuk membuka tabir pertanyaan yang berupa hipotesa. keadaan. Evaluasi Evaluasi hasil belajar siswa pada model inquiry dipusatkan pada sampai sejauh mana siswa dapat menggunakan ketrampilan intelektual yang berhubungan dengan pengajaran inquiry. : Pengumpulan data eksperimentasi. Penggunaan Sumber Pengajaran Berlawanan seperti apa yang sering dianggap. Tetapi inquiry mengutamakan bagaimana siswa itu menghasilkan dan meferivikasi permasalahan. masalahnya bukan sumber pengajaran apa. Penjelasan prosedur inquiry. Menyampaikan peristiwa peristiwa yang kontradiksi. buku pertanyaan atau anjuran. Inquiry memerlukan data untuk penafsiran. tetapi juga mengajukan pertanyaan dan menemukan jawabannya melalui penyelidikan. Tes yang berstandart memusatkan pada pengukuran berfikir kritis dan ketrampilan memecahkan masalah adalah lebih tepat dibandingkan dengan evaluasi yang mendasarkan diri terutama pada penguasaan suatu bidang ilmu. tetapi bagaimana mereka menggunakan sumber pengajara itu. Mengisolasi variabel yang relevan. model inquiri tidak memerlukan menggunakan materi pengajaran. SINTAKSIS MODEL INQUIRY Tahap Satu : Menghadapkan pemasalahan. gambar. Seringkali. : Pengumpulan data dan verivikasi. film. Memverifikasi benda. Tahap Dua Tahap Tiga . film strip. Siswa bebas melakukan eksplorasi. Menyusun dan menguji hipotesa. 5. nara sumber. 4. Peranan siswa tidak hanya merespon pertanyaan yang diajukan guru.menyusun tujuan mereka sendiri. Dalam pengajaran inquiry seperti halnya dengan model yang lain. bila inquiry digunakan maka evaluasinya didasarkan pada banyak pengetahuan yang dipindahkan.

pertanyaan. 2. Karakteristik Model Inquiry 1. Koneksi    proses koneksi melalui : konsiliasai.  guru memantauketepatanaktifitassiswa 3. E. dan observasi siswa mampu menghubungkan pengetahuan sains pribadi dengan konsep komunitas sains. pertanyaan. Siswa membuat perencanaan mengumpulkan data yang bermakana yang ditujukan pada pertanyaan. eksplorasi fenomena  Guru mendorong untuk mendiskusikan suatu dan menjelaskan bekerja. Menyusun aturan atau penjelasan. dan observasi proses koneksi melalui : konsiliasai. dan observasi proses koneksi melalui : konsiliasai. Tahap Lima : Analisis Proses inquiry Analisis strategi inquiry dan mengembangkan proses inquiry lebih efektif. Disini terjadi integrasi konsep sains dengan proses sains. Investigasi  proses melalui koleksi dan mempresentasikan data . Desain   Proses desain melalui prosedur materi. pemahaman mereka bagaimana fenomena menggunakan contoh dari pengalaman pribadi.Tahap Empat : Mengorganisir. menemukan hubungan dengan literature.  Dilakukan dengan diskusi bersama. Formulasi dan Penjelasan. pertanyaan.

dengan mengajukan pertanyaan kepada guru sedemikian rupa sehingga guru terpaksa menjawab ³ya atau tidak´. konsep yang dilakukan dengan eksperimen akan memberi arti yang lebih bermakna dan mampu berfikir kritis. Siswa mengajukan faktor atau unsur yang baru ke dalam permasalahan untuk dapat . Ia harus menghubungkan antara interpretasi ilmiah yang diterima. Tahap pertama. Di dalam penjelasan diaturkan tentang tujuan. Kelima tahap pelaksanaan inquiry adalah sebagai berikut : a. dan memperjelas hasil penyelidikan. mengorganisasi data dengan cara yang logis dan bermakna. ide atau pikiran yang sederhana.  gurubertukarpendapatterhadappemahamansiswa. generalisasi. dan menjelaskan prosedur pelaksanaan inquiry kepada siswa. adalah latihan inquiry yang dianjurkan oleh Bruce Joyce dan Marsha Weil (1986). 4. Namun permulaan pelaksanaan inquiry dapat dimulai dengan masalah yanmg sederhana. ialah verifikasi. teka ± teki yang sederhana yang tidak banyak memerlukan latar belakang pengetahuan tentang teka ± teki tersebut. danprediksi. b. Tahap kedua. guru memberi permasalahan. Dalam memberikan permasalahan dapat berupa peristiwa yang kontradiksi. dan akan dijawab oleh guru dengan ³jawaban ya atau tidak´. siswa dapat membaca data secara akurat. Aplikasi inquiry Salah satu model inquiry yang berangkat dari fakta sampai pada teori. Tahap ketiga. Yang diutamakan dalam hal ini ialah pengalaman proses berfikir secara inquiry. yang F. dimana para siswa mengumpulkan data atau informasi tentang peristiwa (masalah) yang telah mereka lihat atau alami. ialah melakukan eksperimentasi.  siswadapatmengaplikasikanpemahamannyapadasituasibaru mengembangkaninferensi. dan dapat juga berbentuk tekai ± teki. MembangunPengetahuan   proses melalui reflektif ± konstruksi ± prediksi. dan prosesnya dilakukan dengan ³yes and no questions´ yaitu pertanyaan yang diajukan siswa. c.

Mereka diperkenankan memberi penjelasan yang kurang dengan menghilangkan beberapa bagian yang penting. siswa diminta untuk menganalisis proses inquiry. namun cara berpikir siswa dan bentuk pertanyaan yang diajukan umumnya berada di antara dua tahap ini. Eksperimen memiliki dua fungsi. Dalam proses verifikasi mereka boleh mengajukan pertanyaan tentang : 1) Benda (obyects) 2) Sifat (properties) 3) Kondisi (conditions) 4) Peristiwa (events) d. e. Tahap keempat. Tugas berikutnya dari guru ialah memperdalam proses inquiry siswa dengan memperluas jenis-jenis informasi yang mereka peroleh. tetapi dapat memberi saran untuk suatu teori. Mereka boleh menentukan bahwa pertanyaan itu efektif atau tidak efektif. guru meminta siswa untuk mengorganisir data dan menyusun suatu penjelasan. yaitu eksplorasi dan menguji langsung. ada informasi yang diperlukan tapi tidak diperoleh. dari informasi yang komprehen yang mereka kumpulkan menjadi suatu penjelasan yang cukup jelas. Eksplorasi adalah merubah sesuatu untuk melihat apa yang akan terjadi dan tidak perlu bimbingan teori atau hipotesis. Seringkali ada beberapa teori atau penjelasan yang didasarkan pada data yang sama. Banyak pertanyaan verifikasi dan eksperimen diperlukan hanya untuk meneliti suatu teori.melihat apakah peristiwa itu dapat terjadi secara berbeda. Proses merubah hipotesa kedalam eksperimentasi adalah tidak mudah dan memerlukan latihan atau praktek. Tahap kelima. G. guru menyajikan bahan pelajaran tidak dalam bentuknya yang final. Biasanya siswa mendapatkan kesulitan dalam membuat lompatan intelektual. Prosedur Inquiry Di dalam sistem belajar ± mengajar ini. Tahap ini penting jika kita ingin membuat proses inquiry secara sadar dan secara sistematis mencoba untuk memperbaikinya. Menguji secara langsung terjadi bila siswa melakukan uji coba teori atau hipotesa. pertanyaan itu produktif atau tidak produktif. tetapi peserta didik yang diberi peluang . Walaupun tahap kedua dan ketiga terpisah.

untuk mencari dan menemukan sendiri dengan mempergunakan teknik pendekatan pemecahan masalah. diklasifikasikan. 3. Stimulation : Guru mulai dengan bertanya mengajukan mengajukan persoalan. 5. Problem statement : Peserta didik diberi kesempatan untuk mengidentifikasi berbagai permasalahan. peserta didik diberi kesempatan untuk mengumpulkan berbagai informasi yang relevan. misalnya siswa mengawali dengan belajar bagaimana belajar dan bekerja dengan menggunakan peta dan globe. dengan jelas membaca literatur mengamati objeknya. pertanyaan atau hipotesis yang telah dirumuskan terdahulu itu kemudian dicek. atau menyuruh peserta didik membaca atau mendengarkan uraian yang memuat permasalahan. Dibawah ini adalah contoh pembelajaran inquiry tentang ³Peta dan Globe´ pada kelas 3 SD. Contoh Penerapan inquiry di SD kelas 3 Pembelajaran IPS dengan menggunakan pendekatan inquiry dapat di terapkan pada semua jenjang dan kelas. mewawancarai orang sumber. dan sebagainya. Data collection : Untuk menjawab pertanyaan atau membuktikan benar tidaknya hipotesis itu. Permasalahan yang dipilih ini selanjutnya harus dirumuskan dalam bentuk pertanyaan atau hipotesis (pernyataan sebagai jawaban sementara atas pertanyaan tersebut). bahkan kalu perlu dihitung dengan cara tertentu serta ditafsirkan pada tingkat kepercayaan tertentu. berdasarkan hasil verifikasi tadi siswa belajar menrik generalisasi atau kesimpulan tertentu. Verifikation : Berdasarkan hasil pengolahan dan tafsiran atau informasi yang ada tersebut (available information). dengan kata lain. H. mencoba (uji coba) sendiri. diacak. 6. Untuk siswa sekolah dasar pada kelas-kelas rendah dapat juga menggunakan pendekatan inquiry ini melalui pembelajaran-pembelajaran yang sederhana. terbukti atau tidak. 4. dan sebagainya) itu diolah. 2. Secara garis besar prosedurnya sebagai berikut : 1. ditabulasikan. apakah terjawab atau.. Data processing : Semua informasi (hasil bacaan wawancara. Generalization : Tahap selanjutnya. sebanyak mungkin memilihnya yang dipandang paling menarik dan fleksibel untuk dipecahkan. observasi. .

Tahap 2 Guru: Bagaimana pembuat globe untuk mengatasi kesulitan ini? Bagaimana pendapatmu tentang cara menunjukkan lokasi perairan? Kemungkinan jawaban siswa: y y Mungkin siswa menuliskan kata ³air´ pada tempat yang ada airnya. Apa warnanya? (Siswa menjawab: ³warnanya sama ± biru´) Tahap 4 Beri lagi pertanyaan untuk membuktikan bahwa mereka telah menguasainya. Ini ada di peta? Apa warnanya? (Siswa menjawab: ³biru´) Mari lihat pula Samudra Indonesia. danau. Prosedur: Bimbinglah siswa melalui langkah-langkah berikut ini: Tahap 1 Guru: Siapa diantara kamu yang pernah melihat danau? Sungai? Adakah diantara kamu yang pernah melihat laut? Seperti apakah sungai. (Pegang bola dinia ini) Coba berikan nama laut ini? (Apabila kamu tidak tahu coba bantu oleh yang lainnya) Baiklah. y Tahap 3 Guru: Anggaplah bahwa kita adalah ilmuwan yang akan menguji pendapat siapa yang paling tepat. Mungkin juga mereka menggambar gelombang pada tempat yang ada airnya. dan laut itu? (Siswa menjawab setiap pertanyaan. Kembangkan pertanyaan itu hingga para siswa menyebutkan bahwa semua tempat itu berisi air. Mari kita lihat bola dunia ini. .) Tahukah kamu bahwa lautan lebih luas daripada daratan? Orang yang membuat peta dan globe mempunyai kesulitan karena harus dapat meyakinkan orang lain wilayah mana yang berupa daratan dan wilayah mana yang berbentuk lautan.Tujuan: Pada akhir proses belajar mengajar diharapkan para siswa dapat (1) mengenal simbol-simbol yang ada di dalam peta dan (2) mengemukakan alasan mengapa harus menggunakan simbol yang berbeda-beda. Mereka mungkin mewarnai bagian/tempat yang ada airnya. Beri pula dorongan agar mereka bercerita atau menjelaskan apa yang telah mereka ketahui. mari kita lihat Laut Jawa. Inilah ada di peta.

mengapa pembuat bola dunia memilih cara membuat simbol laut dengan warna biru? Maksud saya. Samakah simbol yang dibuat untuk wilayah perairan laut? (Guru dan siswa melihat-lihat peta dan bola dunia lainnya. I. Selain itu. Karena ada wilayah perairan laut yang sempit sehingga akan sulit menuliskan kata ³air´ pada tempat itu´. ³Menggambarkan gelombang untuk lautan mungkin saja. namun kesulitan untuk sungai´. Pembelajaran dengan menggunakan pendekatan inquiry di sekolah dasar untuk kelas yang lebih tinggi dapat dengan cara melakukan analisis terhadap suatu data . Kelebihan dan Kelemahan Inquiry Kelebihan Bahwa hasil belajar dengan cara ini lebih mudah dihafal dan diingat. warna biru digunakan untuk menunjukan perairan´. mudah ditransfer (untuk menghadapi pemecahan masalah). Di bawah ini ditampilkan suatu contoh model inquiry untuk siswa SD kelas 6 dengan topik kependudukan.) Kesimpulannya: ³Umumnya pada peta dan bola dunia. mengapa mereka tidak menuliskan ³air´ pada tempattempat yang menunjukan lautan atau menggambarkan gelombang? (Para siswa menjawab: ³Apabila pembuat bola dunia itu menuliskan kata µair´ maka ia harus menuliskan kata air beberapa kali´. Marilah kita perhatikan peta dan bola dunia lainnya.Guru: Berdasarkan informasi yang telah kita diketahui. bagaimana pembuat bola dunia menggambar lautan agar berbeda dengan simbol lainnya? (Siswa menjawab: ³warnanya biru´) Tahukah kamu.) Tahap 5 Tahap ini adalah kesimpulan dari seluruh pelajaran. pada tahap ini pun dirancang untuk membuat penjelasan umum yang dapat diterapkan dalam situasi lainnya. dapatkah kamu mengemukakan simbol wilayah perairan pada peta dan bola dunia (globe)? (Siswa menjawab: ³Wilayah perairan itu digambarkan dengan warna biru´). ³Akan sulit juga menuliskan kata ³air´ untuk menunjukan suatu ³sungai´. Guru: Dari apa yang telah kita pelajari. Pengetahuan dan kecakapan (intelektual potency) peserta didik yang bersangkutan lebih jauh lagi dapat menumbuhkan motif intrinsik (karena peserta didik merasa puas atas penggunannya sendiri). Kelemahan .

J. kalau kurang terpimpin atau terarah. Bagan Penerapan Inquiry Guru memilih tingkah laku/tujuan 1 2 Guru mengajukan pertanyaan yang dapat menumbuhkan siswa menemukan pendapatnya 3 Siswa menetapkan hipotesis /praduga jawaban untuk dikaji lebih lanjut (alternatif jawaban) 4a Secara spontan siswa menjelajahi informasi/data untuk menguji praduga. dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya.Kelemahan dari inquiry antara lain memakan waktu banyak (time consuming) dan. baik secara individu ataupun secara kelompok 3a Siswa tidak banyak berusaha mencari informasi untuk membuktikan praduga .

contoh untuk bentuk ini telah dikemukakan dalam perilaku pemecahan masalah. y Inquiry berdasarkan situasi masalah yang diminta pemecahan.cara sebagai beriktu : y Didasarkan pada artefak (artifact) yaitu benda ± benda hasil kepandaian manusia. Kesimpulan Model pembelajaran inkuiry dapat dilakukan dengan cara. y Inquiry berdasarkan isu ± isu yang kontroversial atau kejadian sekarang. Misalnya adanya protes dari penduduk suatu wilayah tentang pencemaran limbah industri terhadap sumber air penduduk. Misalnya manusia diminta mempelajari makna simbol yang terdapat pada mata uang bangsanya.Siswa menarik kesimpulan 4b Guru membantu siswa. mendorong melakukan kegiatan belajar untuk mencari informasi yang diperoleh Inquiry Siswa mengidentifikasi beberapa kemungkinan jawaban/menarik kesimpulan 5 Keterangan : Jalur 1 ± 2 ± 3 ± 4a ± 5 1 ± 2 ± 3 ± 3a ± 4b ± 5 BAB IV PENUTUP A. .

misalnya mempelajari bagaimana kontak dengan budaya lain mempengaruhi cara kehidupan. Gambar dan ilustrasi adalah untuk meningkatkan ketelitian terhadap konsep yang dikemukakan dalam buku teks IPS. Saran . y Inquiry yang didasarkan pada potret dan ilustrasi. Misalnya kontak ± kontak yang dilakukan oleh suku terasing dengan kelompok masyarakat lain dan pengaruhnya terhadap suku terasing tersebut. Untuk itu misalnya guru dapat mengajukan pertanyaan pada siswa misalnya: 1) Apa hubungan antara gambar atau ilustrasi tersebut dengan materi/konsep yang kita bicarakan ? atau 2) Kapan gambar tersebut dibuat? B.y Inquiry yang berdasarkan pada konsep ± konsep yang ditemukan dalam pelajaran.

Sign up to vote on this title
UsefulNot useful