BAB I PENDAHULUAN

A. Latar Belakang Masalah Metode Pembelajaran dapat didefinisikan sebagai cara yang digunakan guru untuk mencapai tujuan pembelajaran yang bersifat prosedural yaitu berisi tahapan tertentu. Suatu yang yang terpenting bagi seorang guru bukan hanya menyampaikan informasi dan bahan ajar kepada siswa, melainkan guru harus berusaha menciptakan agar siswa dapat memahami secara keseluruhan isi dari materi pelajaran yang disampaikan. Agar proses belajar-mengajar menjadi berhasil, untuk itu seorang guru harus mampu mempersiapkan bahan-bahan untuk kegiatan belajarmengajar di kelas serta merancang model-model pembelajaran yang sesuai agar siswa tidak bosan dan akan lebih menyenanginya. Banyak kejadian di lapangan siswa yang merasa bosan terhadap salah satu mata pelajaran dikarenakan metode yang digunakan oleh guru tidak mampu membuat siswa mengerti materi bahkan akan timbul persepsi yang negatif. Misalkan pada pelajaran IPS, siswa merasa jenuh dengan cara guru menerangkan materi karena siswa tidak diberi kesempatan bebas untuk mengeluarkan pendapat,tetapi hanya mendengarkan saja penjelasan dari guru sehingga siswa merasa jenuh. Dengan bekal kemampuan dan keterampilan dalam merancang model-model pembelajaran tentunya guru memahami dan menguasai materi serta mampu menentukan jenis model-model pembelajaran yang sesuai dengan materi yang akan digunakan dalam kegitan belajar mengajar di kelas. Salah satu model pembelajaran yang dapat diterapkan dalam kegitan belajar- mengajar IPS SD Kelas 3 adalah Model Pembelajaran Inkury. Model pembelajaran ini melatih siswa untuk belajar sendiri dan menemukan sendiri pengetahuan. Proses pembelajarannya lebih berpusat kepada siswa. Banks (1990) mengemukakan bahwamodel pembelajaran IPS dengan menggunakan inkury sosial untuk menghasilkan fakta, konsep, generalisasi, dan teori.namun tujuan utama inkury sosial adalah untuk membangun teori. Para ilmuwan sosial percaya salah satu cara membantu masyarakat adalah dengan membangun teori. Teori dapat digunakan untuk memehami, menjelaskan, memprekdisi, dan mengontrol perilaku masyarakat. Selain itu, tujuan inkuri sosial pun diharapkan dapat

Apakah kelemahan dan kelebihan dari model pembelajran Inkuiry? C. jika kurang terpimpin atau terarah. dan dapat memecahkan masalah. Bagaimana keaktifan siswa setelah guru menerapkan model pembelajaran Inkuiry ? 4. Karena itu inquiry mengajaran yang berpusat pada siswa. B. Dalam inkuiry siswa dihadapakan pada suatu yang bersifat misterius. berpikir kritis. b. yang berarti siswa berlatih dalam proses inquiry. yang belum diketahui tetapi dapat menarik siswa. Siswa menemukan arti suatu konsep kemudian membuat suatu kesimpulan dan menyusun suatu generalisasi dari data yang mereka simpulkan. Rumusan Masalah 1. Bagaimana penerapan model pembelajaran inkury dalam proses belajarmengajar pada mata pelajaran IPS SD Kelas 3? 3. penemuan (discovery) dan proses pemecahan masalah (problem solving). . masalah tersebut harus didasarkan pada suatu gagasan yang memang dapat ditemukan kebenarannya dan bukan hanya mengada-ada. Namun model ini memakan waktu banyak (time consuming) dan. Untuk mempersiapkan bahan ± bahan untuk kegiatan belajar mengajar di kelas. dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya. Manfaat Makalah 1. Untuk itu inkuri harus difokuskan pada masalah-masalah praktis kemasyarakatan. Dengan proses inquiry siswa dilatih untuk melakukan proses . Tujuan Makalah Dengan proses inquiry. menghendaki siswa terlibat secara aktif dalam pengajaran. D. Mengetahui pentingnya sebuah perencanaan yang matang agar proses belajr mengajar berjalan dengan baik. Adakah kesulitan guru dalam menentukan model pembelajaran yang sesuai dengan materi yang akan diajarkan? 2. diasumsikan bahwa sekolah menyediakan pengajaran yang terbaik kepada siswa untuk mengarahkan diri.membantu masyarakat dalam memecahkamn masalah ± masalah sosial sehingga mereka dapat memperoleh kehidupan yang lebih baik. Manfaat Bagi Mahasiswa a. Pembelajaran inquiry dipandang lebih efektif karena secara pribadi terlibat ( baik fisik dan mental ) dalam kegitan belajar mengajar.

2. Manfaat Bagi Guru a. . belajar melakukan penelitian dalam pembelajaran. b. b. Guru diharapkan sedapat mungkin memperbanyak latihan dalam merancang model-model pembelajaran. Menciptakan proses belajar mengajar yang lebih efektif dengan menerapan model pembelajaran Inkuiry. Melatih siswa untuk mampu memecahkan masalah damn menarik kesimpulan sendiri. Manfaat Bagi Siswa a. 3. Siswa lebih berperan aktif.

Pengertian Inquiry Inquiri berasal dari kata to inquire yang berarti ikut serta.196) menyatakan bahwa ada beberapa hal yang menjadi ciri utama strategi pembelajaran inkuiri. akan tetapi sebagai fasilitator dan motivator belajar siswa.(---------------------Sejak manusia lahir ke dunia. Rasa ingin tahu tentang alam sekitar di sekelilingnya merupakan kodrat manusia sejak ia lahir ke dunia. Dalam proses pembelajaran. tetapi mereka berperan untuk menemukan sendiri inti dari materi pelajaran itu sendiri. Jika berpikir menjadi tujuan utama dari pendidikan. dalam mengajukan pertanyaan-pertanyaan. mencari informasi. manusia memiliki dorongan untuk menemukan sendiri pengetahuannya. Pertama. sehingga diharapkan dapat menumbuhkan sikap percaya diri (self belief). pengecapan dan indera-indera lainnya. siswa tidak hanya berperan sebagai penerima pelajaran melalui penjelasan guru secara verbal. tujuan dari penggunaan strategi pembelajaran inkuiri adalah mengembangkan kemampuan intelektual sebagai bagian dari proses mental.BAB II KAJIAN PUSTAKA 1. Kedua. Sejak kecil manusia memiliki keinginan untuk mengenal segala sesuatu melalui indera penglihatan. Artinya dalam pendekatan inkuiri menempatkan guru bukan sebagai sumber belajar. strategi inkuiri menekankan kepada aktifitas siswa secara maksimal untuk mencari dan menemukan. seluruh aktivitas yang dilakukan siswa diarahkan untuk mencari dan menemukan sendiri dari sesuatu yang dipertanyakan. Selanjutnya Sanjaya (2008. artinya pendekatan inkuiri menempatkan siswa sebagai subjek belajar. Didasari hal inilah suatu model pembelajaran yang dikenal dengan inkuiri dikembangkan. dan melakukan penyelidikan. Pengetahuan yang dimiliki manusia akan bermakna (meaningfull) apabila didasari oleh keingintahuan itu. Ia menambahkan bahwa pembelajaran inkuiri ini bertujuan untuk memberikan cara bagi siswa untuk membangun kecakapan-kecakapan intelektual (kecakapan berpikir) terkait dengan proses-proses berpikir reflektif. Ketiga. maka harus ditemukan cara-cara untuk membantu individu untuk membangun kemampuan itu. atau terlibat. Aktvitas pembelajaran biasanya dilakukan melalui proses tanya jawab antara guru dan siswa. Hingga dewasa keingintahuan manusia secara terus menerus berkembang dengan menggunakan otak dan pikirannya. pendengaran. sehingga kemampuan guru dalam menggunakan teknik bertanya merupakan syarat utama dalam melakukan inkuiri. akibatnya dalam pembelajaran inkuiri siswa tidak hanya dituntut agar menguasai pelajaran. . akan tetapi bagaimana mereka dapat menggunakan potensi yang dimilikinya.

dan sampai pada pengambilan kesimpulan yang masih tentatif. menguji hipotesa. Inquiry ada banyak bentuk dan model. Karena itu strategi inquiri dalam proses belajar mengajar adalah strategi yang melibatkan siswa dalam tanya jawab. . atau menolak hipotesa itu dan melanjutkan penyelidikan sampai menemukan pemecahan masalah yang memuaskan. dan menghubungkan ide ± ide atau teori untuk mendapatkan konsep. kemudian penyelidikan dilakukan untuk membuktikan apakah kemungkinan pemecahan atau hipotesa itu diterima atau ditolak. dan melakukan penyelidikan. membuat kesimpulan. mencari informasi.BAB III PEMBAHASAN A. merefleksi validitas data. dan menyusun teori serta konsep yang berdasar pada data dan pengetahuan. Pengertian Inquiry dalam Pembelajaran Inquiry merupakan komponen dari CTL. Yang di awalai dari pengamatan dari pertanyaan yang muncul. Melakukan inquiry berarti melibatkan diri dalam tanya jawab. Dalam pelaksanaan siswa bertanggung jawab untuk memberikan ide atau pemikiran dan pertanyaan untuk eksplorasi. Kemudian menentukan bagaimana mempresentasikan dan menjelaskan penemuannya. membuat pengamatan lebih jauh. Inquiry adalah proses perpindahan dari pengamatan menjadi pemahaman. Dalam proses itu. dan pengujian untuk pemecahan. mencari informasi dan melakukan penyelidikan. siswa akan sampai pada suatu kesimpulan yang masih tentatif. suatu kemungkinan pemecahan atau suatu hipotesa diajukan. Jawaban pertanyaan ± Pertanyaan tersebut didapat melalui siklus menyusun dugaan. Dengan dasar kata yang telah terkumpul.masalah adalah salah satu dari kegiatan inquiry yang paling sering digunakan. siswa belajar menggunakan ketrampilan berpikir kritis saat mereka berdiskusi dan menganalisis bukti. mengajukan hipotesa untuk diuji. mengevaluasi ide dan proposisi. Proses ini terdiri dari 5 tahap. dan pemecahan . menyusun hipotesis. kemudian siswa bekerja untuk memecahkan masalah itu dengan meneliti untuk suatu pemecahan. Siswa menghadapi atau dihadapkan pada suatu permasalahan. memproses. Di dalam pembelajaran berdasarkan inquiry.

Siswa diberi kebebasan menentukan permasalahan untuk diselidiki. Karena dalam pendekatan inkuiri bebas ini menempatkan siswa seolah-olah bekerja seperti seorang ilmuwan. Pada pendekatan ini siswa akan dihadapkan pada tugas-tugas yang relevan untuk diselesaikan baik melalui diskusi kelompok maupun secara individual agar mampu menyelesaikan masalah dan menarik suatu kesimpulan secara mandiri. sehingga siswa mampu melakukan proses inkuiri secara mandiri. Pada dasarnya siswa selama proses belajar berlangsung akan memperoleh pedoman sesuai dengan yang diperlukan. Guru mempunyai peran aktif dalam menentukan permasalahan dan tahap-tahap pemecahannya. menemukan dan menyelesaikan masalah secara mandiri. kemudian pada tahap-tahap berikutnya. 2. bimbingan dapat pula diberikan melalui lembar kerja siswa yang terstruktur. Dengan pendekatan ini siswa belajar lebih beorientasi pada bimbingan dan petunjuk dari guru hingga siswa dapat memahami konsep-konsep pelajaran. Jenis ± Jenis Inquiry Inquiry terbagi menjadi tiga jenis berdasarkan besarnya intervensi guru terhadap siswa atau besarnya bimbingan yang diberikan oleh guru kepada siswanya. Pada tahap awal. bimbingan dari guru sangat sedikit diberikan atau bahkan tidak diberikan sama sekali. Selama berlangsungnya proses belajar guru harus memantau kelompok diskusi siswa.B. merancang prosedur atau langkah-langkah yang diperlukan. Pendekatan inkuiri terbimbing ini digunakan bagi siswa yang kurang berpengalaman belajar dengan pendekatan inkuiri. Bimbingan yang diberikan dapat berupa pertanyaan-pertanyaan dan diskusi multi arah yang dapat menggiring siswa agar dapat memahami konsep pelajaran matematika. 1. Pada umumnya pendekatan ini digunakan bagi siswa yang telah berpengalaman belajar dengan pendekatan inkuiri. Inquiry Terbimbing (guided inquiry approach) Pendekatan inquiry terbimbing yaitu pendekatan inquiry dimana guru membimbing siswa melakukan kegiatan dengan memberi pertanyaan awal dan mengarahkan pada suatu diskusi. guru banyak memberikan bimbingan. Inquiri Bebas (free inquiry approach). bimbingan tersebut dikurangi. Selama proses ini. Di samping itu. sehingga guru dapat mengetahui dan memberikan petunjuk-petunjuk dan scafolding yang diperlukan oleh siswa. Salah satu keuntungan belajar dengan metode ini adalah adanya kemungkinan siswa dalam memecahkan masalah open ended dan mempunyai alternatif pemecahan masalah lebih .

dalam pendekatan ini siswa tidak dapat memilih atau menentukan masalah untuk diselidiki secara sendiri. yaitu: pendekatan inkuiri terbimbing dan pendekatan inkuiri bebas. Sedangkan belajar dengan metode ini mempunyai beberapa kelemahan. Inquiry Training Model pembelajaran ini dikembangkan oleh seoranh tokoh yang bernama Suchman. ada kemungkinan siswa menemukan cara dan solusi yang baru atau belum pernah ditemukan oleh orang lain dari masalah yang diselidiki. dengan harapan agar siswa dapat menemukan sendiri penyelesaiannya. Meskipun begitu permasalahan yang akan dijadikan topik untuk diselidiki tetap diberikan atau mempedomani acuan kurikulum yang telah ada. karena tergantung bagaimana cara mereka mengkonstruksi jawabannya sendiri. 4) karena topik yang diselidiki antara kelompok atau individual berbeda. maka bimbingan dapat diberikan secara tidak langsung dengan memberikan contoh-contoh yang relevan dengan permasalahan yang dihadapi. Namun. sehingga guru akan membutuhkan waktu yang lama untuk memeriksa hasil yang diperoleh siswa. Inquiri Bebas yang Dimodifikasikan ( modified free inquiry approach) Pendekatan ini merupakan kolaborasi atau modifikasi dari dua pendekatan inkuiri sebelumnya. prosedur ilmiah dapat diajarkan secara langsung kepada mereka. antara lain: 1) waktu yang diperlukan untuk menemukan sesuatu relatif lama sehingga melebihi waktu yang sudah ditetapkan dalam kurikulum. Suchman menyakinkani bahwa anak-anak merupakan individu yang penuh rasa ingin tahu akan segala sesuatu. ada kemungkinan topik yang diplih oleh siswa di luar konteks yang ada dalam kurikulum. 3. Namun bimbingan yang diberikan lebih sedikit dari Inkuiri terbimbing dan tidak terstruktur. ada kemungkinan kelompok atau individual lainnya kurang memahami topik yang diselidiki oleh kelompok atau individual tertentu. atau melalui diskusi dengan siswa dalam kelompok lain. 3) ada kemungkinan setiap kelompok atau individual mempunyai topik berbeda. 4. Selain itu. Oleh karena itu. agar siswa berupaya terlebih dahulu secara mandiri. . Berikut ini adalah postulat yang diajukan oleh Suchman untuk mendukung teori yang mendasari model pembelajaran ini. Dalam pendekatan inkuiri jenis ini guru membatasi memberi bimbingan. apabila ada siswa yang tidak dapat menyelesaikan permasalahannya. 2) karena diberi kebebasan untuk menentukan sendiri permasalahan yang diselidiki. sehingga diskusi tidak berjalan sebagaimana yang diharapkan.dari satu cara. namun siswa yang belajar dengan pendekatan ini menerima masalah dari gurunya untuk dipecahkan dan tetap memperoleh bimbingan. Artinya.

Guru harus terampil menumbuhkan motivasi belajar siswa dan menciptakan situasi belajar yang menyenangkan. Partisipasi setiap siswa dalam setiap kegiatan belajar. fenomena. 4. Adanya fasilitas dan sumber belajar yang cukup 4. Tujuan Utama. Tujuan Utama Tujuan utama pengajaran inquiry adalah menyediakan peralatan atau cara bagi siswa untuk mengembangkan ketrampilan intelektualnya yang berkaitan dengan berfikir kritis dan memecahkan masalah. 2. 3. C. 6. menjelaskan. Penelitian kooperatif (cooperative inquiry) dapat memperkaya kemampuan berpikir dan membantu siswa belajar tentang suatu ilmu yang senantiasa bersifat tentatif dan belajar menghargai penjelasan atau solusi alternatif. Peranan Siswa. dan memecahakan masalah secara almiah. Adanya kebebasan siswa untuk berpendapat. berdiskusi. Guru tidak banyak campur tangan dan intervensi terhadap kegiatan siswa. Guru harus terampil memilih persoalan ± persoalan yang relevan untuk diajukan kepada kelas (persoalan bersumber pada bahan pelajaran yang menantang siswa atau yang problematis) dan sesuai dengan daya nalar siswa. Apabila berpikir merupakan tujuan pendidikan. 1. maka cara yang harus dipikirkan . D. 5. Peranan Guru. Mereka akan menyadari keingintahuan akan segala sesuatu tersebut dan akan belajar untuk menganalisis strategi berpikirnya. Secara alami manusia mempunyai kecenderungan untuk selalu mencari tahu segala sesuatu yang menarik perhatiannya. Penggunaan Sumber Pengajaran Evaluasi Inquiry. 3. Syarat ± syarat inquiry 1. berkarya. Secara singkat model ini bertujuan untuk melatih kemampuan siswa dalam meniliti. Strategi baru dapat diajarkan secara langsung dan ditambahkan/digabungkan dengan strategi lama yang telah dimiliki siswa.1. 2.

Inquiry meminta siswa untuk berfikir secara bebas. menyusun hipotesa. dan berfikir untuk alternatif pemecahan. menafsirkan dan meferivikasi data. mereka akan ³belajar bagaimana belajar´. Guru membuat suasana yang menjamin kebebasan untuk melakukan eksplorasi.adalah untuk membantu mengembangkan kemampuan individual. sebagai fasilitator yang berhadapan dengan siswa membantu mereka mengidentifikasi pertanyaan dan masalah. Tujuan inquiry adalah memberi latihan untuk mengembangkan ketrampilan intelektual yang khusus. Guru harus memilikiketrampilan khusus dalam bertanya yang dapat meningkatkan berfikir kritis dan dapat memecahkan masalah. Melalui inquiry. Sejauh mungkin guru berusaha untuk meningkatkan cara kerja siswa secara bebas. Peranan Guru Karena inquiry adalah pembelajaran yang terpusat pada siswa. melakukan hubungan pribadi yang baik. dan bersamaan dengan itu diperlukan bantuan psycologis. Sesungguhnya. untuk merespon masalah yang diberikan. 3. siswa dengan bantuan guru . Dengan keterbatasannya. Situasinya dibuat sedemikian rupa sehingga inquiry dapat berjalan dengan baik. menguji hipotesa dan sampai pada suatu kesimpulan. dan menyarankan suatu alternatif penafsiran terhadap data. Guru membantu siswa dalam menemukan sumber informasi yang tepat dan bertanggung jawab bahwa sejumlah sumber pengajaran itu cukup dan digunakan. dan membimbing dalam melakukan penyelidikan. 2. Inquiry menekankan menemukan sesuatu untuk diri mereka sendiri. Karena itu siswa tidak secara keseluruhan bebas mengluyur sendiri melakukan inquiry. Mereka aktif menggunakan cara belajar mereka sendiri. tidak mencakup menspesifikasi faktor ± faktor dari suatu ilmu. Guru tidak menekankan kebenaran jawaban. tetapi diharapkan bahwa mereka ditingkatkan keberanian mengajukan pertanyaan. Guru menyusun kembali dan mengklarifikasi respon siswa. Peranan Siswa Peranan siswa dalam pengajaran inquiry adalah sebagai pengambil inisiatif atau prakarsa dalam menemukan sesuatu untuk mereka sendiri. mengumpulkan dan mengklasifikasi data yang relevan. tidak diharapkan bahwa mereka tidak dibimbing dalam penyelidikan mereka. Siswa ditingkatkan kemampuannya untuk dapat menemukan sesuatu untuk diri mereka sendiri dengan mengaplikasikan prinsip metode ilmiah inquiry. maka peranan guru adalah sebagai pembimbing dan sebagai stimulator. Perhatian utama pada inquiry adalah pengembangan proses mental seperti mengidentifikasi dan menganalisis masalah. tetapi membantu siswa menemukan dan mengklarifikasi jawaban yang tepat.

Tahap Dua Tahap Tiga . perpustakaan dapat digunakan secara efektif untuk penyelidikan inquiry. Hubungan sebab akibat. keadaan. sifat dan peristiwa. nara sumber. 4. Siswa bebas melakukan eksplorasi. Siswa tidak hanya dievaluasi pada kemampuan mengingat (recall) dan mereproduksi informasi. Memverifikasi benda. masalahnya bukan sumber pengajaran apa. Tetapi inquiry mengutamakan bagaimana siswa itu menghasilkan dan meferivikasi permasalahan. model inquiri tidak memerlukan menggunakan materi pengajaran. SINTAKSIS MODEL INQUIRY Tahap Satu : Menghadapkan pemasalahan. film. film strip. Penjelasan prosedur inquiry. Sumber pengajaran itu digunakan untuk membuka tabir pertanyaan yang berupa hipotesa. Menyampaikan peristiwa peristiwa yang kontradiksi. : Pengumpulan data eksperimentasi. Seringkali. Peranan siswa tidak hanya merespon pertanyaan yang diajukan guru. Sumber ± sumber seperti buku teks. Penggunaan Sumber Pengajaran Berlawanan seperti apa yang sering dianggap. 5. gambar. Evaluasi Evaluasi hasil belajar siswa pada model inquiry dipusatkan pada sampai sejauh mana siswa dapat menggunakan ketrampilan intelektual yang berhubungan dengan pengajaran inquiry. tetapi juga mengajukan pertanyaan dan menemukan jawabannya melalui penyelidikan. tetapi bagaimana mereka menggunakan sumber pengajara itu. Inquiry memerlukan data untuk penafsiran. Dalam pengajaran inquiry seperti halnya dengan model yang lain. : Pengumpulan data dan verivikasi. Tes yang berstandart memusatkan pada pengukuran berfikir kritis dan ketrampilan memecahkan masalah adalah lebih tepat dibandingkan dengan evaluasi yang mendasarkan diri terutama pada penguasaan suatu bidang ilmu.menyusun tujuan mereka sendiri. dan diberi kesempatan untuk malakukan pemilihan alternatif pemecahan masalah. bila inquiry digunakan maka evaluasinya didasarkan pada banyak pengetahuan yang dipindahkan. buku pertanyaan atau anjuran. Menyusun dan menguji hipotesa. Mengisolasi variabel yang relevan.

dan observasi siswa mampu menghubungkan pengetahuan sains pribadi dengan konsep komunitas sains. dan observasi proses koneksi melalui : konsiliasai. 2. pertanyaan. E.  Dilakukan dengan diskusi bersama. menemukan hubungan dengan literature. dan observasi proses koneksi melalui : konsiliasai. Investigasi  proses melalui koleksi dan mempresentasikan data . pertanyaan. Formulasi dan Penjelasan. Menyusun aturan atau penjelasan. pemahaman mereka bagaimana fenomena menggunakan contoh dari pengalaman pribadi. Koneksi    proses koneksi melalui : konsiliasai. Desain   Proses desain melalui prosedur materi.  guru memantauketepatanaktifitassiswa 3. Disini terjadi integrasi konsep sains dengan proses sains. Karakteristik Model Inquiry 1. pertanyaan.Tahap Empat : Mengorganisir. Tahap Lima : Analisis Proses inquiry Analisis strategi inquiry dan mengembangkan proses inquiry lebih efektif. Siswa membuat perencanaan mengumpulkan data yang bermakana yang ditujukan pada pertanyaan. eksplorasi fenomena  Guru mendorong untuk mendiskusikan suatu dan menjelaskan bekerja.

mengorganisasi data dengan cara yang logis dan bermakna. Ia harus menghubungkan antara interpretasi ilmiah yang diterima. Namun permulaan pelaksanaan inquiry dapat dimulai dengan masalah yanmg sederhana. MembangunPengetahuan   proses melalui reflektif ± konstruksi ± prediksi. generalisasi. Siswa mengajukan faktor atau unsur yang baru ke dalam permasalahan untuk dapat . dimana para siswa mengumpulkan data atau informasi tentang peristiwa (masalah) yang telah mereka lihat atau alami. Dalam memberikan permasalahan dapat berupa peristiwa yang kontradiksi. dan memperjelas hasil penyelidikan. guru memberi permasalahan. adalah latihan inquiry yang dianjurkan oleh Bruce Joyce dan Marsha Weil (1986). c. Aplikasi inquiry Salah satu model inquiry yang berangkat dari fakta sampai pada teori. dan prosesnya dilakukan dengan ³yes and no questions´ yaitu pertanyaan yang diajukan siswa. Kelima tahap pelaksanaan inquiry adalah sebagai berikut : a. danprediksi. b. konsep yang dilakukan dengan eksperimen akan memberi arti yang lebih bermakna dan mampu berfikir kritis. siswa dapat membaca data secara akurat. dan menjelaskan prosedur pelaksanaan inquiry kepada siswa. 4. ialah melakukan eksperimentasi. Yang diutamakan dalam hal ini ialah pengalaman proses berfikir secara inquiry. teka ± teki yang sederhana yang tidak banyak memerlukan latar belakang pengetahuan tentang teka ± teki tersebut. ialah verifikasi. dan akan dijawab oleh guru dengan ³jawaban ya atau tidak´. Di dalam penjelasan diaturkan tentang tujuan. Tahap ketiga. ide atau pikiran yang sederhana. dengan mengajukan pertanyaan kepada guru sedemikian rupa sehingga guru terpaksa menjawab ³ya atau tidak´.  siswadapatmengaplikasikanpemahamannyapadasituasibaru mengembangkaninferensi. dan dapat juga berbentuk tekai ± teki. Tahap pertama.  gurubertukarpendapatterhadappemahamansiswa. yang F. Tahap kedua.

tetapi peserta didik yang diberi peluang . Menguji secara langsung terjadi bila siswa melakukan uji coba teori atau hipotesa. Tahap keempat. Biasanya siswa mendapatkan kesulitan dalam membuat lompatan intelektual. dari informasi yang komprehen yang mereka kumpulkan menjadi suatu penjelasan yang cukup jelas. Eksplorasi adalah merubah sesuatu untuk melihat apa yang akan terjadi dan tidak perlu bimbingan teori atau hipotesis. Dalam proses verifikasi mereka boleh mengajukan pertanyaan tentang : 1) Benda (obyects) 2) Sifat (properties) 3) Kondisi (conditions) 4) Peristiwa (events) d. Mereka boleh menentukan bahwa pertanyaan itu efektif atau tidak efektif. Tahap kelima. tetapi dapat memberi saran untuk suatu teori. Tugas berikutnya dari guru ialah memperdalam proses inquiry siswa dengan memperluas jenis-jenis informasi yang mereka peroleh. siswa diminta untuk menganalisis proses inquiry. Prosedur Inquiry Di dalam sistem belajar ± mengajar ini. G. Eksperimen memiliki dua fungsi. Proses merubah hipotesa kedalam eksperimentasi adalah tidak mudah dan memerlukan latihan atau praktek. ada informasi yang diperlukan tapi tidak diperoleh. e. guru menyajikan bahan pelajaran tidak dalam bentuknya yang final. namun cara berpikir siswa dan bentuk pertanyaan yang diajukan umumnya berada di antara dua tahap ini. Mereka diperkenankan memberi penjelasan yang kurang dengan menghilangkan beberapa bagian yang penting. Banyak pertanyaan verifikasi dan eksperimen diperlukan hanya untuk meneliti suatu teori. pertanyaan itu produktif atau tidak produktif. Walaupun tahap kedua dan ketiga terpisah. yaitu eksplorasi dan menguji langsung. Seringkali ada beberapa teori atau penjelasan yang didasarkan pada data yang sama. guru meminta siswa untuk mengorganisir data dan menyusun suatu penjelasan.melihat apakah peristiwa itu dapat terjadi secara berbeda. Tahap ini penting jika kita ingin membuat proses inquiry secara sadar dan secara sistematis mencoba untuk memperbaikinya.

untuk mencari dan menemukan sendiri dengan mempergunakan teknik pendekatan pemecahan masalah. Generalization : Tahap selanjutnya. diacak. mencoba (uji coba) sendiri. . 5. 3. peserta didik diberi kesempatan untuk mengumpulkan berbagai informasi yang relevan. H.. berdasarkan hasil verifikasi tadi siswa belajar menrik generalisasi atau kesimpulan tertentu. Permasalahan yang dipilih ini selanjutnya harus dirumuskan dalam bentuk pertanyaan atau hipotesis (pernyataan sebagai jawaban sementara atas pertanyaan tersebut). atau menyuruh peserta didik membaca atau mendengarkan uraian yang memuat permasalahan. pertanyaan atau hipotesis yang telah dirumuskan terdahulu itu kemudian dicek. Contoh Penerapan inquiry di SD kelas 3 Pembelajaran IPS dengan menggunakan pendekatan inquiry dapat di terapkan pada semua jenjang dan kelas. misalnya siswa mengawali dengan belajar bagaimana belajar dan bekerja dengan menggunakan peta dan globe. 2. observasi. Secara garis besar prosedurnya sebagai berikut : 1. Dibawah ini adalah contoh pembelajaran inquiry tentang ³Peta dan Globe´ pada kelas 3 SD. dengan kata lain. apakah terjawab atau. ditabulasikan. diklasifikasikan. 6. 4. Untuk siswa sekolah dasar pada kelas-kelas rendah dapat juga menggunakan pendekatan inquiry ini melalui pembelajaran-pembelajaran yang sederhana. dan sebagainya. Data processing : Semua informasi (hasil bacaan wawancara. Stimulation : Guru mulai dengan bertanya mengajukan mengajukan persoalan. terbukti atau tidak. Verifikation : Berdasarkan hasil pengolahan dan tafsiran atau informasi yang ada tersebut (available information). bahkan kalu perlu dihitung dengan cara tertentu serta ditafsirkan pada tingkat kepercayaan tertentu. dengan jelas membaca literatur mengamati objeknya. sebanyak mungkin memilihnya yang dipandang paling menarik dan fleksibel untuk dipecahkan. dan sebagainya) itu diolah. mewawancarai orang sumber. Data collection : Untuk menjawab pertanyaan atau membuktikan benar tidaknya hipotesis itu. Problem statement : Peserta didik diberi kesempatan untuk mengidentifikasi berbagai permasalahan.

Ini ada di peta? Apa warnanya? (Siswa menjawab: ³biru´) Mari lihat pula Samudra Indonesia. mari kita lihat Laut Jawa. dan laut itu? (Siswa menjawab setiap pertanyaan. Beri pula dorongan agar mereka bercerita atau menjelaskan apa yang telah mereka ketahui.) Tahukah kamu bahwa lautan lebih luas daripada daratan? Orang yang membuat peta dan globe mempunyai kesulitan karena harus dapat meyakinkan orang lain wilayah mana yang berupa daratan dan wilayah mana yang berbentuk lautan. Mari kita lihat bola dunia ini. danau. y Tahap 3 Guru: Anggaplah bahwa kita adalah ilmuwan yang akan menguji pendapat siapa yang paling tepat. Inilah ada di peta. . Prosedur: Bimbinglah siswa melalui langkah-langkah berikut ini: Tahap 1 Guru: Siapa diantara kamu yang pernah melihat danau? Sungai? Adakah diantara kamu yang pernah melihat laut? Seperti apakah sungai. Mungkin juga mereka menggambar gelombang pada tempat yang ada airnya. Kembangkan pertanyaan itu hingga para siswa menyebutkan bahwa semua tempat itu berisi air. (Pegang bola dinia ini) Coba berikan nama laut ini? (Apabila kamu tidak tahu coba bantu oleh yang lainnya) Baiklah.Tujuan: Pada akhir proses belajar mengajar diharapkan para siswa dapat (1) mengenal simbol-simbol yang ada di dalam peta dan (2) mengemukakan alasan mengapa harus menggunakan simbol yang berbeda-beda. Apa warnanya? (Siswa menjawab: ³warnanya sama ± biru´) Tahap 4 Beri lagi pertanyaan untuk membuktikan bahwa mereka telah menguasainya. Mereka mungkin mewarnai bagian/tempat yang ada airnya. Tahap 2 Guru: Bagaimana pembuat globe untuk mengatasi kesulitan ini? Bagaimana pendapatmu tentang cara menunjukkan lokasi perairan? Kemungkinan jawaban siswa: y y Mungkin siswa menuliskan kata ³air´ pada tempat yang ada airnya.

Guru: Dari apa yang telah kita pelajari. Marilah kita perhatikan peta dan bola dunia lainnya. warna biru digunakan untuk menunjukan perairan´.) Kesimpulannya: ³Umumnya pada peta dan bola dunia. Kelemahan .Guru: Berdasarkan informasi yang telah kita diketahui. mengapa pembuat bola dunia memilih cara membuat simbol laut dengan warna biru? Maksud saya.) Tahap 5 Tahap ini adalah kesimpulan dari seluruh pelajaran. ³Menggambarkan gelombang untuk lautan mungkin saja. pada tahap ini pun dirancang untuk membuat penjelasan umum yang dapat diterapkan dalam situasi lainnya. Selain itu. Kelebihan dan Kelemahan Inquiry Kelebihan Bahwa hasil belajar dengan cara ini lebih mudah dihafal dan diingat. bagaimana pembuat bola dunia menggambar lautan agar berbeda dengan simbol lainnya? (Siswa menjawab: ³warnanya biru´) Tahukah kamu. mudah ditransfer (untuk menghadapi pemecahan masalah). namun kesulitan untuk sungai´. Karena ada wilayah perairan laut yang sempit sehingga akan sulit menuliskan kata ³air´ pada tempat itu´. Samakah simbol yang dibuat untuk wilayah perairan laut? (Guru dan siswa melihat-lihat peta dan bola dunia lainnya. dapatkah kamu mengemukakan simbol wilayah perairan pada peta dan bola dunia (globe)? (Siswa menjawab: ³Wilayah perairan itu digambarkan dengan warna biru´). mengapa mereka tidak menuliskan ³air´ pada tempattempat yang menunjukan lautan atau menggambarkan gelombang? (Para siswa menjawab: ³Apabila pembuat bola dunia itu menuliskan kata µair´ maka ia harus menuliskan kata air beberapa kali´. Di bawah ini ditampilkan suatu contoh model inquiry untuk siswa SD kelas 6 dengan topik kependudukan. I. Pengetahuan dan kecakapan (intelektual potency) peserta didik yang bersangkutan lebih jauh lagi dapat menumbuhkan motif intrinsik (karena peserta didik merasa puas atas penggunannya sendiri). ³Akan sulit juga menuliskan kata ³air´ untuk menunjukan suatu ³sungai´. Pembelajaran dengan menggunakan pendekatan inquiry di sekolah dasar untuk kelas yang lebih tinggi dapat dengan cara melakukan analisis terhadap suatu data .

J. baik secara individu ataupun secara kelompok 3a Siswa tidak banyak berusaha mencari informasi untuk membuktikan praduga . dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya. kalau kurang terpimpin atau terarah.Kelemahan dari inquiry antara lain memakan waktu banyak (time consuming) dan. Bagan Penerapan Inquiry Guru memilih tingkah laku/tujuan 1 2 Guru mengajukan pertanyaan yang dapat menumbuhkan siswa menemukan pendapatnya 3 Siswa menetapkan hipotesis /praduga jawaban untuk dikaji lebih lanjut (alternatif jawaban) 4a Secara spontan siswa menjelajahi informasi/data untuk menguji praduga.

cara sebagai beriktu : y Didasarkan pada artefak (artifact) yaitu benda ± benda hasil kepandaian manusia. Misalnya adanya protes dari penduduk suatu wilayah tentang pencemaran limbah industri terhadap sumber air penduduk. y Inquiry berdasarkan situasi masalah yang diminta pemecahan. . Misalnya manusia diminta mempelajari makna simbol yang terdapat pada mata uang bangsanya. mendorong melakukan kegiatan belajar untuk mencari informasi yang diperoleh Inquiry Siswa mengidentifikasi beberapa kemungkinan jawaban/menarik kesimpulan 5 Keterangan : Jalur 1 ± 2 ± 3 ± 4a ± 5 1 ± 2 ± 3 ± 3a ± 4b ± 5 BAB IV PENUTUP A.Siswa menarik kesimpulan 4b Guru membantu siswa. contoh untuk bentuk ini telah dikemukakan dalam perilaku pemecahan masalah. y Inquiry berdasarkan isu ± isu yang kontroversial atau kejadian sekarang. Kesimpulan Model pembelajaran inkuiry dapat dilakukan dengan cara.

y Inquiry yang didasarkan pada potret dan ilustrasi. Untuk itu misalnya guru dapat mengajukan pertanyaan pada siswa misalnya: 1) Apa hubungan antara gambar atau ilustrasi tersebut dengan materi/konsep yang kita bicarakan ? atau 2) Kapan gambar tersebut dibuat? B. Gambar dan ilustrasi adalah untuk meningkatkan ketelitian terhadap konsep yang dikemukakan dalam buku teks IPS. misalnya mempelajari bagaimana kontak dengan budaya lain mempengaruhi cara kehidupan. Misalnya kontak ± kontak yang dilakukan oleh suku terasing dengan kelompok masyarakat lain dan pengaruhnya terhadap suku terasing tersebut.y Inquiry yang berdasarkan pada konsep ± konsep yang ditemukan dalam pelajaran. Saran .

Sign up to vote on this title
UsefulNot useful