BAB I PENDAHULUAN

A. Latar Belakang Masalah Metode Pembelajaran dapat didefinisikan sebagai cara yang digunakan guru untuk mencapai tujuan pembelajaran yang bersifat prosedural yaitu berisi tahapan tertentu. Suatu yang yang terpenting bagi seorang guru bukan hanya menyampaikan informasi dan bahan ajar kepada siswa, melainkan guru harus berusaha menciptakan agar siswa dapat memahami secara keseluruhan isi dari materi pelajaran yang disampaikan. Agar proses belajar-mengajar menjadi berhasil, untuk itu seorang guru harus mampu mempersiapkan bahan-bahan untuk kegiatan belajarmengajar di kelas serta merancang model-model pembelajaran yang sesuai agar siswa tidak bosan dan akan lebih menyenanginya. Banyak kejadian di lapangan siswa yang merasa bosan terhadap salah satu mata pelajaran dikarenakan metode yang digunakan oleh guru tidak mampu membuat siswa mengerti materi bahkan akan timbul persepsi yang negatif. Misalkan pada pelajaran IPS, siswa merasa jenuh dengan cara guru menerangkan materi karena siswa tidak diberi kesempatan bebas untuk mengeluarkan pendapat,tetapi hanya mendengarkan saja penjelasan dari guru sehingga siswa merasa jenuh. Dengan bekal kemampuan dan keterampilan dalam merancang model-model pembelajaran tentunya guru memahami dan menguasai materi serta mampu menentukan jenis model-model pembelajaran yang sesuai dengan materi yang akan digunakan dalam kegitan belajar mengajar di kelas. Salah satu model pembelajaran yang dapat diterapkan dalam kegitan belajar- mengajar IPS SD Kelas 3 adalah Model Pembelajaran Inkury. Model pembelajaran ini melatih siswa untuk belajar sendiri dan menemukan sendiri pengetahuan. Proses pembelajarannya lebih berpusat kepada siswa. Banks (1990) mengemukakan bahwamodel pembelajaran IPS dengan menggunakan inkury sosial untuk menghasilkan fakta, konsep, generalisasi, dan teori.namun tujuan utama inkury sosial adalah untuk membangun teori. Para ilmuwan sosial percaya salah satu cara membantu masyarakat adalah dengan membangun teori. Teori dapat digunakan untuk memehami, menjelaskan, memprekdisi, dan mengontrol perilaku masyarakat. Selain itu, tujuan inkuri sosial pun diharapkan dapat

jika kurang terpimpin atau terarah. Namun model ini memakan waktu banyak (time consuming) dan. Karena itu inquiry mengajaran yang berpusat pada siswa. menghendaki siswa terlibat secara aktif dalam pengajaran. Siswa menemukan arti suatu konsep kemudian membuat suatu kesimpulan dan menyusun suatu generalisasi dari data yang mereka simpulkan. Pembelajaran inquiry dipandang lebih efektif karena secara pribadi terlibat ( baik fisik dan mental ) dalam kegitan belajar mengajar. Untuk mempersiapkan bahan ± bahan untuk kegiatan belajar mengajar di kelas. b. dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya. Manfaat Makalah 1.membantu masyarakat dalam memecahkamn masalah ± masalah sosial sehingga mereka dapat memperoleh kehidupan yang lebih baik. yang berarti siswa berlatih dalam proses inquiry. Tujuan Makalah Dengan proses inquiry. D. Mengetahui pentingnya sebuah perencanaan yang matang agar proses belajr mengajar berjalan dengan baik. diasumsikan bahwa sekolah menyediakan pengajaran yang terbaik kepada siswa untuk mengarahkan diri. Dengan proses inquiry siswa dilatih untuk melakukan proses . Rumusan Masalah 1. Adakah kesulitan guru dalam menentukan model pembelajaran yang sesuai dengan materi yang akan diajarkan? 2. Manfaat Bagi Mahasiswa a. penemuan (discovery) dan proses pemecahan masalah (problem solving). Apakah kelemahan dan kelebihan dari model pembelajran Inkuiry? C. Dalam inkuiry siswa dihadapakan pada suatu yang bersifat misterius. berpikir kritis. dan dapat memecahkan masalah. Untuk itu inkuri harus difokuskan pada masalah-masalah praktis kemasyarakatan. Bagaimana penerapan model pembelajaran inkury dalam proses belajarmengajar pada mata pelajaran IPS SD Kelas 3? 3. masalah tersebut harus didasarkan pada suatu gagasan yang memang dapat ditemukan kebenarannya dan bukan hanya mengada-ada. . B. Bagaimana keaktifan siswa setelah guru menerapkan model pembelajaran Inkuiry ? 4. yang belum diketahui tetapi dapat menarik siswa.

. Guru diharapkan sedapat mungkin memperbanyak latihan dalam merancang model-model pembelajaran. Menciptakan proses belajar mengajar yang lebih efektif dengan menerapan model pembelajaran Inkuiry. Siswa lebih berperan aktif. Melatih siswa untuk mampu memecahkan masalah damn menarik kesimpulan sendiri.2. 3. belajar melakukan penelitian dalam pembelajaran. Manfaat Bagi Siswa a. b. Manfaat Bagi Guru a. b.

Sejak kecil manusia memiliki keinginan untuk mengenal segala sesuatu melalui indera penglihatan. Didasari hal inilah suatu model pembelajaran yang dikenal dengan inkuiri dikembangkan. Dalam proses pembelajaran. tujuan dari penggunaan strategi pembelajaran inkuiri adalah mengembangkan kemampuan intelektual sebagai bagian dari proses mental. Kedua. manusia memiliki dorongan untuk menemukan sendiri pengetahuannya. Rasa ingin tahu tentang alam sekitar di sekelilingnya merupakan kodrat manusia sejak ia lahir ke dunia. akibatnya dalam pembelajaran inkuiri siswa tidak hanya dituntut agar menguasai pelajaran. pengecapan dan indera-indera lainnya. akan tetapi bagaimana mereka dapat menggunakan potensi yang dimilikinya.196) menyatakan bahwa ada beberapa hal yang menjadi ciri utama strategi pembelajaran inkuiri. Pertama. Ketiga. akan tetapi sebagai fasilitator dan motivator belajar siswa. artinya pendekatan inkuiri menempatkan siswa sebagai subjek belajar.BAB II KAJIAN PUSTAKA 1. atau terlibat. Pengetahuan yang dimiliki manusia akan bermakna (meaningfull) apabila didasari oleh keingintahuan itu. Hingga dewasa keingintahuan manusia secara terus menerus berkembang dengan menggunakan otak dan pikirannya. dan melakukan penyelidikan. Artinya dalam pendekatan inkuiri menempatkan guru bukan sebagai sumber belajar. strategi inkuiri menekankan kepada aktifitas siswa secara maksimal untuk mencari dan menemukan. sehingga kemampuan guru dalam menggunakan teknik bertanya merupakan syarat utama dalam melakukan inkuiri. sehingga diharapkan dapat menumbuhkan sikap percaya diri (self belief). Jika berpikir menjadi tujuan utama dari pendidikan. Ia menambahkan bahwa pembelajaran inkuiri ini bertujuan untuk memberikan cara bagi siswa untuk membangun kecakapan-kecakapan intelektual (kecakapan berpikir) terkait dengan proses-proses berpikir reflektif. dalam mengajukan pertanyaan-pertanyaan. Aktvitas pembelajaran biasanya dilakukan melalui proses tanya jawab antara guru dan siswa. Pengertian Inquiry Inquiri berasal dari kata to inquire yang berarti ikut serta. . siswa tidak hanya berperan sebagai penerima pelajaran melalui penjelasan guru secara verbal. tetapi mereka berperan untuk menemukan sendiri inti dari materi pelajaran itu sendiri. seluruh aktivitas yang dilakukan siswa diarahkan untuk mencari dan menemukan sendiri dari sesuatu yang dipertanyakan.(---------------------Sejak manusia lahir ke dunia. maka harus ditemukan cara-cara untuk membantu individu untuk membangun kemampuan itu. mencari informasi. Selanjutnya Sanjaya (2008. pendengaran.

Kemudian menentukan bagaimana mempresentasikan dan menjelaskan penemuannya. dan menghubungkan ide ± ide atau teori untuk mendapatkan konsep. Melakukan inquiry berarti melibatkan diri dalam tanya jawab. membuat pengamatan lebih jauh. Jawaban pertanyaan ± Pertanyaan tersebut didapat melalui siklus menyusun dugaan. Di dalam pembelajaran berdasarkan inquiry. kemudian penyelidikan dilakukan untuk membuktikan apakah kemungkinan pemecahan atau hipotesa itu diterima atau ditolak. Pengertian Inquiry dalam Pembelajaran Inquiry merupakan komponen dari CTL. merefleksi validitas data. Dengan dasar kata yang telah terkumpul. kemudian siswa bekerja untuk memecahkan masalah itu dengan meneliti untuk suatu pemecahan. Inquiry ada banyak bentuk dan model.masalah adalah salah satu dari kegiatan inquiry yang paling sering digunakan. mengajukan hipotesa untuk diuji.BAB III PEMBAHASAN A. . mencari informasi. Siswa menghadapi atau dihadapkan pada suatu permasalahan. memproses. siswa belajar menggunakan ketrampilan berpikir kritis saat mereka berdiskusi dan menganalisis bukti. dan menyusun teori serta konsep yang berdasar pada data dan pengetahuan. dan pengujian untuk pemecahan. atau menolak hipotesa itu dan melanjutkan penyelidikan sampai menemukan pemecahan masalah yang memuaskan. menguji hipotesa. Inquiry adalah proses perpindahan dari pengamatan menjadi pemahaman. dan pemecahan . Dalam pelaksanaan siswa bertanggung jawab untuk memberikan ide atau pemikiran dan pertanyaan untuk eksplorasi. Proses ini terdiri dari 5 tahap. mencari informasi dan melakukan penyelidikan. suatu kemungkinan pemecahan atau suatu hipotesa diajukan. Karena itu strategi inquiri dalam proses belajar mengajar adalah strategi yang melibatkan siswa dalam tanya jawab. membuat kesimpulan. menyusun hipotesis. mengevaluasi ide dan proposisi. Yang di awalai dari pengamatan dari pertanyaan yang muncul. Dalam proses itu. siswa akan sampai pada suatu kesimpulan yang masih tentatif. dan melakukan penyelidikan. dan sampai pada pengambilan kesimpulan yang masih tentatif.

Pada dasarnya siswa selama proses belajar berlangsung akan memperoleh pedoman sesuai dengan yang diperlukan. Selama berlangsungnya proses belajar guru harus memantau kelompok diskusi siswa. bimbingan tersebut dikurangi. Selama proses ini. Dengan pendekatan ini siswa belajar lebih beorientasi pada bimbingan dan petunjuk dari guru hingga siswa dapat memahami konsep-konsep pelajaran. Inquiry Terbimbing (guided inquiry approach) Pendekatan inquiry terbimbing yaitu pendekatan inquiry dimana guru membimbing siswa melakukan kegiatan dengan memberi pertanyaan awal dan mengarahkan pada suatu diskusi. Salah satu keuntungan belajar dengan metode ini adalah adanya kemungkinan siswa dalam memecahkan masalah open ended dan mempunyai alternatif pemecahan masalah lebih . bimbingan dari guru sangat sedikit diberikan atau bahkan tidak diberikan sama sekali. Di samping itu. Siswa diberi kebebasan menentukan permasalahan untuk diselidiki. guru banyak memberikan bimbingan. 1. Pada pendekatan ini siswa akan dihadapkan pada tugas-tugas yang relevan untuk diselesaikan baik melalui diskusi kelompok maupun secara individual agar mampu menyelesaikan masalah dan menarik suatu kesimpulan secara mandiri. Pada umumnya pendekatan ini digunakan bagi siswa yang telah berpengalaman belajar dengan pendekatan inkuiri. Inquiri Bebas (free inquiry approach). bimbingan dapat pula diberikan melalui lembar kerja siswa yang terstruktur. Karena dalam pendekatan inkuiri bebas ini menempatkan siswa seolah-olah bekerja seperti seorang ilmuwan.B. kemudian pada tahap-tahap berikutnya. Bimbingan yang diberikan dapat berupa pertanyaan-pertanyaan dan diskusi multi arah yang dapat menggiring siswa agar dapat memahami konsep pelajaran matematika. sehingga guru dapat mengetahui dan memberikan petunjuk-petunjuk dan scafolding yang diperlukan oleh siswa. Guru mempunyai peran aktif dalam menentukan permasalahan dan tahap-tahap pemecahannya. menemukan dan menyelesaikan masalah secara mandiri. sehingga siswa mampu melakukan proses inkuiri secara mandiri. Pendekatan inkuiri terbimbing ini digunakan bagi siswa yang kurang berpengalaman belajar dengan pendekatan inkuiri. Pada tahap awal. merancang prosedur atau langkah-langkah yang diperlukan. Jenis ± Jenis Inquiry Inquiry terbagi menjadi tiga jenis berdasarkan besarnya intervensi guru terhadap siswa atau besarnya bimbingan yang diberikan oleh guru kepada siswanya. 2.

dalam pendekatan ini siswa tidak dapat memilih atau menentukan masalah untuk diselidiki secara sendiri. 3) ada kemungkinan setiap kelompok atau individual mempunyai topik berbeda. yaitu: pendekatan inkuiri terbimbing dan pendekatan inkuiri bebas. Oleh karena itu. Suchman menyakinkani bahwa anak-anak merupakan individu yang penuh rasa ingin tahu akan segala sesuatu. Sedangkan belajar dengan metode ini mempunyai beberapa kelemahan.dari satu cara. namun siswa yang belajar dengan pendekatan ini menerima masalah dari gurunya untuk dipecahkan dan tetap memperoleh bimbingan. karena tergantung bagaimana cara mereka mengkonstruksi jawabannya sendiri. sehingga diskusi tidak berjalan sebagaimana yang diharapkan. atau melalui diskusi dengan siswa dalam kelompok lain. agar siswa berupaya terlebih dahulu secara mandiri. Meskipun begitu permasalahan yang akan dijadikan topik untuk diselidiki tetap diberikan atau mempedomani acuan kurikulum yang telah ada. 4) karena topik yang diselidiki antara kelompok atau individual berbeda. Selain itu. 3. ada kemungkinan kelompok atau individual lainnya kurang memahami topik yang diselidiki oleh kelompok atau individual tertentu. dengan harapan agar siswa dapat menemukan sendiri penyelesaiannya. Artinya. prosedur ilmiah dapat diajarkan secara langsung kepada mereka. Inquiri Bebas yang Dimodifikasikan ( modified free inquiry approach) Pendekatan ini merupakan kolaborasi atau modifikasi dari dua pendekatan inkuiri sebelumnya. Namun bimbingan yang diberikan lebih sedikit dari Inkuiri terbimbing dan tidak terstruktur. . Namun. 2) karena diberi kebebasan untuk menentukan sendiri permasalahan yang diselidiki. sehingga guru akan membutuhkan waktu yang lama untuk memeriksa hasil yang diperoleh siswa. apabila ada siswa yang tidak dapat menyelesaikan permasalahannya. ada kemungkinan topik yang diplih oleh siswa di luar konteks yang ada dalam kurikulum. Inquiry Training Model pembelajaran ini dikembangkan oleh seoranh tokoh yang bernama Suchman. Dalam pendekatan inkuiri jenis ini guru membatasi memberi bimbingan. 4. maka bimbingan dapat diberikan secara tidak langsung dengan memberikan contoh-contoh yang relevan dengan permasalahan yang dihadapi. ada kemungkinan siswa menemukan cara dan solusi yang baru atau belum pernah ditemukan oleh orang lain dari masalah yang diselidiki. antara lain: 1) waktu yang diperlukan untuk menemukan sesuatu relatif lama sehingga melebihi waktu yang sudah ditetapkan dalam kurikulum. Berikut ini adalah postulat yang diajukan oleh Suchman untuk mendukung teori yang mendasari model pembelajaran ini.

Guru harus terampil menumbuhkan motivasi belajar siswa dan menciptakan situasi belajar yang menyenangkan. Adanya kebebasan siswa untuk berpendapat. 4. berkarya. Apabila berpikir merupakan tujuan pendidikan. menjelaskan. 6. Guru tidak banyak campur tangan dan intervensi terhadap kegiatan siswa. 2. maka cara yang harus dipikirkan . 1. berdiskusi. Tujuan Utama. Penelitian kooperatif (cooperative inquiry) dapat memperkaya kemampuan berpikir dan membantu siswa belajar tentang suatu ilmu yang senantiasa bersifat tentatif dan belajar menghargai penjelasan atau solusi alternatif. 2. Peranan Guru. Tujuan Utama Tujuan utama pengajaran inquiry adalah menyediakan peralatan atau cara bagi siswa untuk mengembangkan ketrampilan intelektualnya yang berkaitan dengan berfikir kritis dan memecahkan masalah. Syarat ± syarat inquiry 1. 3. Mereka akan menyadari keingintahuan akan segala sesuatu tersebut dan akan belajar untuk menganalisis strategi berpikirnya. 5. Peranan Siswa. Secara alami manusia mempunyai kecenderungan untuk selalu mencari tahu segala sesuatu yang menarik perhatiannya. Guru harus terampil memilih persoalan ± persoalan yang relevan untuk diajukan kepada kelas (persoalan bersumber pada bahan pelajaran yang menantang siswa atau yang problematis) dan sesuai dengan daya nalar siswa. Strategi baru dapat diajarkan secara langsung dan ditambahkan/digabungkan dengan strategi lama yang telah dimiliki siswa. Secara singkat model ini bertujuan untuk melatih kemampuan siswa dalam meniliti.1. Adanya fasilitas dan sumber belajar yang cukup 4. Penggunaan Sumber Pengajaran Evaluasi Inquiry. D. Partisipasi setiap siswa dalam setiap kegiatan belajar. fenomena. 3. dan memecahakan masalah secara almiah. C.

Guru menyusun kembali dan mengklarifikasi respon siswa. siswa dengan bantuan guru . Inquiry menekankan menemukan sesuatu untuk diri mereka sendiri. Guru membantu siswa dalam menemukan sumber informasi yang tepat dan bertanggung jawab bahwa sejumlah sumber pengajaran itu cukup dan digunakan. Melalui inquiry. 3. sebagai fasilitator yang berhadapan dengan siswa membantu mereka mengidentifikasi pertanyaan dan masalah. Inquiry meminta siswa untuk berfikir secara bebas. tidak diharapkan bahwa mereka tidak dibimbing dalam penyelidikan mereka. Guru harus memilikiketrampilan khusus dalam bertanya yang dapat meningkatkan berfikir kritis dan dapat memecahkan masalah. Sesungguhnya. Sejauh mungkin guru berusaha untuk meningkatkan cara kerja siswa secara bebas. tetapi membantu siswa menemukan dan mengklarifikasi jawaban yang tepat. Perhatian utama pada inquiry adalah pengembangan proses mental seperti mengidentifikasi dan menganalisis masalah. Peranan Guru Karena inquiry adalah pembelajaran yang terpusat pada siswa. melakukan hubungan pribadi yang baik. Peranan Siswa Peranan siswa dalam pengajaran inquiry adalah sebagai pengambil inisiatif atau prakarsa dalam menemukan sesuatu untuk mereka sendiri. Mereka aktif menggunakan cara belajar mereka sendiri. Dengan keterbatasannya.adalah untuk membantu mengembangkan kemampuan individual. menyusun hipotesa. menguji hipotesa dan sampai pada suatu kesimpulan. menafsirkan dan meferivikasi data. Karena itu siswa tidak secara keseluruhan bebas mengluyur sendiri melakukan inquiry. Guru membuat suasana yang menjamin kebebasan untuk melakukan eksplorasi. dan bersamaan dengan itu diperlukan bantuan psycologis. untuk merespon masalah yang diberikan. 2. tidak mencakup menspesifikasi faktor ± faktor dari suatu ilmu. Siswa ditingkatkan kemampuannya untuk dapat menemukan sesuatu untuk diri mereka sendiri dengan mengaplikasikan prinsip metode ilmiah inquiry. mereka akan ³belajar bagaimana belajar´. dan membimbing dalam melakukan penyelidikan. Guru tidak menekankan kebenaran jawaban. dan menyarankan suatu alternatif penafsiran terhadap data. maka peranan guru adalah sebagai pembimbing dan sebagai stimulator. mengumpulkan dan mengklasifikasi data yang relevan. Situasinya dibuat sedemikian rupa sehingga inquiry dapat berjalan dengan baik. tetapi diharapkan bahwa mereka ditingkatkan keberanian mengajukan pertanyaan. dan berfikir untuk alternatif pemecahan. Tujuan inquiry adalah memberi latihan untuk mengembangkan ketrampilan intelektual yang khusus.

film strip. gambar. perpustakaan dapat digunakan secara efektif untuk penyelidikan inquiry. Seringkali. Mengisolasi variabel yang relevan. tetapi juga mengajukan pertanyaan dan menemukan jawabannya melalui penyelidikan. Tetapi inquiry mengutamakan bagaimana siswa itu menghasilkan dan meferivikasi permasalahan. Penjelasan prosedur inquiry. tetapi bagaimana mereka menggunakan sumber pengajara itu. Penggunaan Sumber Pengajaran Berlawanan seperti apa yang sering dianggap. film.menyusun tujuan mereka sendiri. sifat dan peristiwa. Siswa tidak hanya dievaluasi pada kemampuan mengingat (recall) dan mereproduksi informasi. nara sumber. buku pertanyaan atau anjuran. Evaluasi Evaluasi hasil belajar siswa pada model inquiry dipusatkan pada sampai sejauh mana siswa dapat menggunakan ketrampilan intelektual yang berhubungan dengan pengajaran inquiry. Tahap Dua Tahap Tiga . : Pengumpulan data dan verivikasi. bila inquiry digunakan maka evaluasinya didasarkan pada banyak pengetahuan yang dipindahkan. Dalam pengajaran inquiry seperti halnya dengan model yang lain. dan diberi kesempatan untuk malakukan pemilihan alternatif pemecahan masalah. Menyusun dan menguji hipotesa. Siswa bebas melakukan eksplorasi. : Pengumpulan data eksperimentasi. Sumber ± sumber seperti buku teks. SINTAKSIS MODEL INQUIRY Tahap Satu : Menghadapkan pemasalahan. Memverifikasi benda. model inquiri tidak memerlukan menggunakan materi pengajaran. Inquiry memerlukan data untuk penafsiran. Sumber pengajaran itu digunakan untuk membuka tabir pertanyaan yang berupa hipotesa. Menyampaikan peristiwa peristiwa yang kontradiksi. keadaan. Peranan siswa tidak hanya merespon pertanyaan yang diajukan guru. 4. Tes yang berstandart memusatkan pada pengukuran berfikir kritis dan ketrampilan memecahkan masalah adalah lebih tepat dibandingkan dengan evaluasi yang mendasarkan diri terutama pada penguasaan suatu bidang ilmu. masalahnya bukan sumber pengajaran apa. 5. Hubungan sebab akibat.

Formulasi dan Penjelasan. pertanyaan. eksplorasi fenomena  Guru mendorong untuk mendiskusikan suatu dan menjelaskan bekerja. dan observasi proses koneksi melalui : konsiliasai. 2. menemukan hubungan dengan literature. pertanyaan. Investigasi  proses melalui koleksi dan mempresentasikan data . pemahaman mereka bagaimana fenomena menggunakan contoh dari pengalaman pribadi. Koneksi    proses koneksi melalui : konsiliasai. pertanyaan. dan observasi siswa mampu menghubungkan pengetahuan sains pribadi dengan konsep komunitas sains. Siswa membuat perencanaan mengumpulkan data yang bermakana yang ditujukan pada pertanyaan. Menyusun aturan atau penjelasan. dan observasi proses koneksi melalui : konsiliasai. Tahap Lima : Analisis Proses inquiry Analisis strategi inquiry dan mengembangkan proses inquiry lebih efektif.  guru memantauketepatanaktifitassiswa 3.  Dilakukan dengan diskusi bersama. Desain   Proses desain melalui prosedur materi. E. Karakteristik Model Inquiry 1.Tahap Empat : Mengorganisir. Disini terjadi integrasi konsep sains dengan proses sains.

danprediksi. adalah latihan inquiry yang dianjurkan oleh Bruce Joyce dan Marsha Weil (1986). Aplikasi inquiry Salah satu model inquiry yang berangkat dari fakta sampai pada teori. mengorganisasi data dengan cara yang logis dan bermakna. Yang diutamakan dalam hal ini ialah pengalaman proses berfikir secara inquiry. ialah verifikasi. Di dalam penjelasan diaturkan tentang tujuan. konsep yang dilakukan dengan eksperimen akan memberi arti yang lebih bermakna dan mampu berfikir kritis. Tahap kedua. MembangunPengetahuan   proses melalui reflektif ± konstruksi ± prediksi. Tahap ketiga. guru memberi permasalahan. Ia harus menghubungkan antara interpretasi ilmiah yang diterima. Namun permulaan pelaksanaan inquiry dapat dimulai dengan masalah yanmg sederhana. generalisasi. dan akan dijawab oleh guru dengan ³jawaban ya atau tidak´. dan prosesnya dilakukan dengan ³yes and no questions´ yaitu pertanyaan yang diajukan siswa. dimana para siswa mengumpulkan data atau informasi tentang peristiwa (masalah) yang telah mereka lihat atau alami. Tahap pertama. c. dan menjelaskan prosedur pelaksanaan inquiry kepada siswa. ialah melakukan eksperimentasi. ide atau pikiran yang sederhana.  gurubertukarpendapatterhadappemahamansiswa. dengan mengajukan pertanyaan kepada guru sedemikian rupa sehingga guru terpaksa menjawab ³ya atau tidak´. dan dapat juga berbentuk tekai ± teki. Kelima tahap pelaksanaan inquiry adalah sebagai berikut : a. 4. dan memperjelas hasil penyelidikan. yang F. teka ± teki yang sederhana yang tidak banyak memerlukan latar belakang pengetahuan tentang teka ± teki tersebut. siswa dapat membaca data secara akurat. b. Siswa mengajukan faktor atau unsur yang baru ke dalam permasalahan untuk dapat .  siswadapatmengaplikasikanpemahamannyapadasituasibaru mengembangkaninferensi. Dalam memberikan permasalahan dapat berupa peristiwa yang kontradiksi.

siswa diminta untuk menganalisis proses inquiry. Tahap ini penting jika kita ingin membuat proses inquiry secara sadar dan secara sistematis mencoba untuk memperbaikinya. Proses merubah hipotesa kedalam eksperimentasi adalah tidak mudah dan memerlukan latihan atau praktek. G. Tahap keempat. Eksperimen memiliki dua fungsi. Tahap kelima. Biasanya siswa mendapatkan kesulitan dalam membuat lompatan intelektual. pertanyaan itu produktif atau tidak produktif. ada informasi yang diperlukan tapi tidak diperoleh. Prosedur Inquiry Di dalam sistem belajar ± mengajar ini. yaitu eksplorasi dan menguji langsung. Mereka boleh menentukan bahwa pertanyaan itu efektif atau tidak efektif. Tugas berikutnya dari guru ialah memperdalam proses inquiry siswa dengan memperluas jenis-jenis informasi yang mereka peroleh. dari informasi yang komprehen yang mereka kumpulkan menjadi suatu penjelasan yang cukup jelas. namun cara berpikir siswa dan bentuk pertanyaan yang diajukan umumnya berada di antara dua tahap ini. guru meminta siswa untuk mengorganisir data dan menyusun suatu penjelasan. Eksplorasi adalah merubah sesuatu untuk melihat apa yang akan terjadi dan tidak perlu bimbingan teori atau hipotesis. Mereka diperkenankan memberi penjelasan yang kurang dengan menghilangkan beberapa bagian yang penting. Dalam proses verifikasi mereka boleh mengajukan pertanyaan tentang : 1) Benda (obyects) 2) Sifat (properties) 3) Kondisi (conditions) 4) Peristiwa (events) d. Banyak pertanyaan verifikasi dan eksperimen diperlukan hanya untuk meneliti suatu teori. Walaupun tahap kedua dan ketiga terpisah. Seringkali ada beberapa teori atau penjelasan yang didasarkan pada data yang sama. guru menyajikan bahan pelajaran tidak dalam bentuknya yang final. e. tetapi peserta didik yang diberi peluang . Menguji secara langsung terjadi bila siswa melakukan uji coba teori atau hipotesa. tetapi dapat memberi saran untuk suatu teori.melihat apakah peristiwa itu dapat terjadi secara berbeda.

dengan kata lain. pertanyaan atau hipotesis yang telah dirumuskan terdahulu itu kemudian dicek. 2. Dibawah ini adalah contoh pembelajaran inquiry tentang ³Peta dan Globe´ pada kelas 3 SD. H. dan sebagainya.. Data processing : Semua informasi (hasil bacaan wawancara. Data collection : Untuk menjawab pertanyaan atau membuktikan benar tidaknya hipotesis itu. 5. Generalization : Tahap selanjutnya. dan sebagainya) itu diolah.untuk mencari dan menemukan sendiri dengan mempergunakan teknik pendekatan pemecahan masalah. 4. Verifikation : Berdasarkan hasil pengolahan dan tafsiran atau informasi yang ada tersebut (available information). peserta didik diberi kesempatan untuk mengumpulkan berbagai informasi yang relevan. misalnya siswa mengawali dengan belajar bagaimana belajar dan bekerja dengan menggunakan peta dan globe. terbukti atau tidak. Secara garis besar prosedurnya sebagai berikut : 1. dengan jelas membaca literatur mengamati objeknya. Permasalahan yang dipilih ini selanjutnya harus dirumuskan dalam bentuk pertanyaan atau hipotesis (pernyataan sebagai jawaban sementara atas pertanyaan tersebut). Untuk siswa sekolah dasar pada kelas-kelas rendah dapat juga menggunakan pendekatan inquiry ini melalui pembelajaran-pembelajaran yang sederhana. 6. mewawancarai orang sumber. ditabulasikan. Problem statement : Peserta didik diberi kesempatan untuk mengidentifikasi berbagai permasalahan. bahkan kalu perlu dihitung dengan cara tertentu serta ditafsirkan pada tingkat kepercayaan tertentu. atau menyuruh peserta didik membaca atau mendengarkan uraian yang memuat permasalahan. 3. observasi. berdasarkan hasil verifikasi tadi siswa belajar menrik generalisasi atau kesimpulan tertentu. mencoba (uji coba) sendiri. diacak. apakah terjawab atau. sebanyak mungkin memilihnya yang dipandang paling menarik dan fleksibel untuk dipecahkan. Contoh Penerapan inquiry di SD kelas 3 Pembelajaran IPS dengan menggunakan pendekatan inquiry dapat di terapkan pada semua jenjang dan kelas. Stimulation : Guru mulai dengan bertanya mengajukan mengajukan persoalan. diklasifikasikan. .

Kembangkan pertanyaan itu hingga para siswa menyebutkan bahwa semua tempat itu berisi air. y Tahap 3 Guru: Anggaplah bahwa kita adalah ilmuwan yang akan menguji pendapat siapa yang paling tepat. Ini ada di peta? Apa warnanya? (Siswa menjawab: ³biru´) Mari lihat pula Samudra Indonesia. Beri pula dorongan agar mereka bercerita atau menjelaskan apa yang telah mereka ketahui.) Tahukah kamu bahwa lautan lebih luas daripada daratan? Orang yang membuat peta dan globe mempunyai kesulitan karena harus dapat meyakinkan orang lain wilayah mana yang berupa daratan dan wilayah mana yang berbentuk lautan. Mari kita lihat bola dunia ini. Mungkin juga mereka menggambar gelombang pada tempat yang ada airnya. danau. dan laut itu? (Siswa menjawab setiap pertanyaan. Apa warnanya? (Siswa menjawab: ³warnanya sama ± biru´) Tahap 4 Beri lagi pertanyaan untuk membuktikan bahwa mereka telah menguasainya. Tahap 2 Guru: Bagaimana pembuat globe untuk mengatasi kesulitan ini? Bagaimana pendapatmu tentang cara menunjukkan lokasi perairan? Kemungkinan jawaban siswa: y y Mungkin siswa menuliskan kata ³air´ pada tempat yang ada airnya. Inilah ada di peta. Prosedur: Bimbinglah siswa melalui langkah-langkah berikut ini: Tahap 1 Guru: Siapa diantara kamu yang pernah melihat danau? Sungai? Adakah diantara kamu yang pernah melihat laut? Seperti apakah sungai. (Pegang bola dinia ini) Coba berikan nama laut ini? (Apabila kamu tidak tahu coba bantu oleh yang lainnya) Baiklah. Mereka mungkin mewarnai bagian/tempat yang ada airnya. .Tujuan: Pada akhir proses belajar mengajar diharapkan para siswa dapat (1) mengenal simbol-simbol yang ada di dalam peta dan (2) mengemukakan alasan mengapa harus menggunakan simbol yang berbeda-beda. mari kita lihat Laut Jawa.

Karena ada wilayah perairan laut yang sempit sehingga akan sulit menuliskan kata ³air´ pada tempat itu´.Guru: Berdasarkan informasi yang telah kita diketahui. Selain itu. Samakah simbol yang dibuat untuk wilayah perairan laut? (Guru dan siswa melihat-lihat peta dan bola dunia lainnya. ³Akan sulit juga menuliskan kata ³air´ untuk menunjukan suatu ³sungai´. warna biru digunakan untuk menunjukan perairan´. mengapa mereka tidak menuliskan ³air´ pada tempattempat yang menunjukan lautan atau menggambarkan gelombang? (Para siswa menjawab: ³Apabila pembuat bola dunia itu menuliskan kata µair´ maka ia harus menuliskan kata air beberapa kali´.) Kesimpulannya: ³Umumnya pada peta dan bola dunia. Di bawah ini ditampilkan suatu contoh model inquiry untuk siswa SD kelas 6 dengan topik kependudukan. namun kesulitan untuk sungai´. dapatkah kamu mengemukakan simbol wilayah perairan pada peta dan bola dunia (globe)? (Siswa menjawab: ³Wilayah perairan itu digambarkan dengan warna biru´). pada tahap ini pun dirancang untuk membuat penjelasan umum yang dapat diterapkan dalam situasi lainnya. Guru: Dari apa yang telah kita pelajari. Marilah kita perhatikan peta dan bola dunia lainnya. I. Pembelajaran dengan menggunakan pendekatan inquiry di sekolah dasar untuk kelas yang lebih tinggi dapat dengan cara melakukan analisis terhadap suatu data . mudah ditransfer (untuk menghadapi pemecahan masalah). mengapa pembuat bola dunia memilih cara membuat simbol laut dengan warna biru? Maksud saya. Kelebihan dan Kelemahan Inquiry Kelebihan Bahwa hasil belajar dengan cara ini lebih mudah dihafal dan diingat.) Tahap 5 Tahap ini adalah kesimpulan dari seluruh pelajaran. bagaimana pembuat bola dunia menggambar lautan agar berbeda dengan simbol lainnya? (Siswa menjawab: ³warnanya biru´) Tahukah kamu. Kelemahan . ³Menggambarkan gelombang untuk lautan mungkin saja. Pengetahuan dan kecakapan (intelektual potency) peserta didik yang bersangkutan lebih jauh lagi dapat menumbuhkan motif intrinsik (karena peserta didik merasa puas atas penggunannya sendiri).

dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya. J. baik secara individu ataupun secara kelompok 3a Siswa tidak banyak berusaha mencari informasi untuk membuktikan praduga .Kelemahan dari inquiry antara lain memakan waktu banyak (time consuming) dan. kalau kurang terpimpin atau terarah. Bagan Penerapan Inquiry Guru memilih tingkah laku/tujuan 1 2 Guru mengajukan pertanyaan yang dapat menumbuhkan siswa menemukan pendapatnya 3 Siswa menetapkan hipotesis /praduga jawaban untuk dikaji lebih lanjut (alternatif jawaban) 4a Secara spontan siswa menjelajahi informasi/data untuk menguji praduga.

y Inquiry berdasarkan situasi masalah yang diminta pemecahan. contoh untuk bentuk ini telah dikemukakan dalam perilaku pemecahan masalah. Misalnya manusia diminta mempelajari makna simbol yang terdapat pada mata uang bangsanya. mendorong melakukan kegiatan belajar untuk mencari informasi yang diperoleh Inquiry Siswa mengidentifikasi beberapa kemungkinan jawaban/menarik kesimpulan 5 Keterangan : Jalur 1 ± 2 ± 3 ± 4a ± 5 1 ± 2 ± 3 ± 3a ± 4b ± 5 BAB IV PENUTUP A.Siswa menarik kesimpulan 4b Guru membantu siswa. y Inquiry berdasarkan isu ± isu yang kontroversial atau kejadian sekarang.cara sebagai beriktu : y Didasarkan pada artefak (artifact) yaitu benda ± benda hasil kepandaian manusia. Misalnya adanya protes dari penduduk suatu wilayah tentang pencemaran limbah industri terhadap sumber air penduduk. . Kesimpulan Model pembelajaran inkuiry dapat dilakukan dengan cara.

Saran . Misalnya kontak ± kontak yang dilakukan oleh suku terasing dengan kelompok masyarakat lain dan pengaruhnya terhadap suku terasing tersebut. Untuk itu misalnya guru dapat mengajukan pertanyaan pada siswa misalnya: 1) Apa hubungan antara gambar atau ilustrasi tersebut dengan materi/konsep yang kita bicarakan ? atau 2) Kapan gambar tersebut dibuat? B. y Inquiry yang didasarkan pada potret dan ilustrasi. misalnya mempelajari bagaimana kontak dengan budaya lain mempengaruhi cara kehidupan. Gambar dan ilustrasi adalah untuk meningkatkan ketelitian terhadap konsep yang dikemukakan dalam buku teks IPS.y Inquiry yang berdasarkan pada konsep ± konsep yang ditemukan dalam pelajaran.

Sign up to vote on this title
UsefulNot useful