P. 1
Makalah Inquiry

Makalah Inquiry

|Views: 1,661|Likes:

More info:

Published by: HuNny T'ciptahanyauntuk Cayoo on Dec 27, 2010
Copyright:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as DOCX, PDF, TXT or read online from Scribd
See more
See less

07/03/2014

pdf

text

original

BAB I PENDAHULUAN

A. Latar Belakang Masalah Metode Pembelajaran dapat didefinisikan sebagai cara yang digunakan guru untuk mencapai tujuan pembelajaran yang bersifat prosedural yaitu berisi tahapan tertentu. Suatu yang yang terpenting bagi seorang guru bukan hanya menyampaikan informasi dan bahan ajar kepada siswa, melainkan guru harus berusaha menciptakan agar siswa dapat memahami secara keseluruhan isi dari materi pelajaran yang disampaikan. Agar proses belajar-mengajar menjadi berhasil, untuk itu seorang guru harus mampu mempersiapkan bahan-bahan untuk kegiatan belajarmengajar di kelas serta merancang model-model pembelajaran yang sesuai agar siswa tidak bosan dan akan lebih menyenanginya. Banyak kejadian di lapangan siswa yang merasa bosan terhadap salah satu mata pelajaran dikarenakan metode yang digunakan oleh guru tidak mampu membuat siswa mengerti materi bahkan akan timbul persepsi yang negatif. Misalkan pada pelajaran IPS, siswa merasa jenuh dengan cara guru menerangkan materi karena siswa tidak diberi kesempatan bebas untuk mengeluarkan pendapat,tetapi hanya mendengarkan saja penjelasan dari guru sehingga siswa merasa jenuh. Dengan bekal kemampuan dan keterampilan dalam merancang model-model pembelajaran tentunya guru memahami dan menguasai materi serta mampu menentukan jenis model-model pembelajaran yang sesuai dengan materi yang akan digunakan dalam kegitan belajar mengajar di kelas. Salah satu model pembelajaran yang dapat diterapkan dalam kegitan belajar- mengajar IPS SD Kelas 3 adalah Model Pembelajaran Inkury. Model pembelajaran ini melatih siswa untuk belajar sendiri dan menemukan sendiri pengetahuan. Proses pembelajarannya lebih berpusat kepada siswa. Banks (1990) mengemukakan bahwamodel pembelajaran IPS dengan menggunakan inkury sosial untuk menghasilkan fakta, konsep, generalisasi, dan teori.namun tujuan utama inkury sosial adalah untuk membangun teori. Para ilmuwan sosial percaya salah satu cara membantu masyarakat adalah dengan membangun teori. Teori dapat digunakan untuk memehami, menjelaskan, memprekdisi, dan mengontrol perilaku masyarakat. Selain itu, tujuan inkuri sosial pun diharapkan dapat

Bagaimana keaktifan siswa setelah guru menerapkan model pembelajaran Inkuiry ? 4. D. Untuk mempersiapkan bahan ± bahan untuk kegiatan belajar mengajar di kelas. yang berarti siswa berlatih dalam proses inquiry. Pembelajaran inquiry dipandang lebih efektif karena secara pribadi terlibat ( baik fisik dan mental ) dalam kegitan belajar mengajar. menghendaki siswa terlibat secara aktif dalam pengajaran. dan dapat memecahkan masalah. Rumusan Masalah 1. Mengetahui pentingnya sebuah perencanaan yang matang agar proses belajr mengajar berjalan dengan baik. berpikir kritis. B. Manfaat Bagi Mahasiswa a. . Untuk itu inkuri harus difokuskan pada masalah-masalah praktis kemasyarakatan. Dalam inkuiry siswa dihadapakan pada suatu yang bersifat misterius. Dengan proses inquiry siswa dilatih untuk melakukan proses . b. Siswa menemukan arti suatu konsep kemudian membuat suatu kesimpulan dan menyusun suatu generalisasi dari data yang mereka simpulkan. Apakah kelemahan dan kelebihan dari model pembelajran Inkuiry? C. Manfaat Makalah 1.membantu masyarakat dalam memecahkamn masalah ± masalah sosial sehingga mereka dapat memperoleh kehidupan yang lebih baik. Adakah kesulitan guru dalam menentukan model pembelajaran yang sesuai dengan materi yang akan diajarkan? 2. Bagaimana penerapan model pembelajaran inkury dalam proses belajarmengajar pada mata pelajaran IPS SD Kelas 3? 3. Karena itu inquiry mengajaran yang berpusat pada siswa. Tujuan Makalah Dengan proses inquiry. jika kurang terpimpin atau terarah. dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya. yang belum diketahui tetapi dapat menarik siswa. diasumsikan bahwa sekolah menyediakan pengajaran yang terbaik kepada siswa untuk mengarahkan diri. masalah tersebut harus didasarkan pada suatu gagasan yang memang dapat ditemukan kebenarannya dan bukan hanya mengada-ada. penemuan (discovery) dan proses pemecahan masalah (problem solving). Namun model ini memakan waktu banyak (time consuming) dan.

Menciptakan proses belajar mengajar yang lebih efektif dengan menerapan model pembelajaran Inkuiry. Manfaat Bagi Siswa a. Siswa lebih berperan aktif. 3.2. b. . belajar melakukan penelitian dalam pembelajaran. Manfaat Bagi Guru a. Guru diharapkan sedapat mungkin memperbanyak latihan dalam merancang model-model pembelajaran. b. Melatih siswa untuk mampu memecahkan masalah damn menarik kesimpulan sendiri.

Artinya dalam pendekatan inkuiri menempatkan guru bukan sebagai sumber belajar. akibatnya dalam pembelajaran inkuiri siswa tidak hanya dituntut agar menguasai pelajaran. manusia memiliki dorongan untuk menemukan sendiri pengetahuannya. Pengertian Inquiry Inquiri berasal dari kata to inquire yang berarti ikut serta. Aktvitas pembelajaran biasanya dilakukan melalui proses tanya jawab antara guru dan siswa. tujuan dari penggunaan strategi pembelajaran inkuiri adalah mengembangkan kemampuan intelektual sebagai bagian dari proses mental. Sejak kecil manusia memiliki keinginan untuk mengenal segala sesuatu melalui indera penglihatan. sehingga diharapkan dapat menumbuhkan sikap percaya diri (self belief). Didasari hal inilah suatu model pembelajaran yang dikenal dengan inkuiri dikembangkan.BAB II KAJIAN PUSTAKA 1. Pengetahuan yang dimiliki manusia akan bermakna (meaningfull) apabila didasari oleh keingintahuan itu. siswa tidak hanya berperan sebagai penerima pelajaran melalui penjelasan guru secara verbal.196) menyatakan bahwa ada beberapa hal yang menjadi ciri utama strategi pembelajaran inkuiri. Ia menambahkan bahwa pembelajaran inkuiri ini bertujuan untuk memberikan cara bagi siswa untuk membangun kecakapan-kecakapan intelektual (kecakapan berpikir) terkait dengan proses-proses berpikir reflektif. dan melakukan penyelidikan. mencari informasi.(---------------------Sejak manusia lahir ke dunia. Jika berpikir menjadi tujuan utama dari pendidikan. Hingga dewasa keingintahuan manusia secara terus menerus berkembang dengan menggunakan otak dan pikirannya. tetapi mereka berperan untuk menemukan sendiri inti dari materi pelajaran itu sendiri. pendengaran. atau terlibat. seluruh aktivitas yang dilakukan siswa diarahkan untuk mencari dan menemukan sendiri dari sesuatu yang dipertanyakan. akan tetapi sebagai fasilitator dan motivator belajar siswa. akan tetapi bagaimana mereka dapat menggunakan potensi yang dimilikinya. sehingga kemampuan guru dalam menggunakan teknik bertanya merupakan syarat utama dalam melakukan inkuiri. . Pertama. Dalam proses pembelajaran. Kedua. dalam mengajukan pertanyaan-pertanyaan. artinya pendekatan inkuiri menempatkan siswa sebagai subjek belajar. Ketiga. maka harus ditemukan cara-cara untuk membantu individu untuk membangun kemampuan itu. strategi inkuiri menekankan kepada aktifitas siswa secara maksimal untuk mencari dan menemukan. pengecapan dan indera-indera lainnya. Rasa ingin tahu tentang alam sekitar di sekelilingnya merupakan kodrat manusia sejak ia lahir ke dunia. Selanjutnya Sanjaya (2008.

BAB III PEMBAHASAN A. suatu kemungkinan pemecahan atau suatu hipotesa diajukan. mencari informasi dan melakukan penyelidikan. siswa belajar menggunakan ketrampilan berpikir kritis saat mereka berdiskusi dan menganalisis bukti. Pengertian Inquiry dalam Pembelajaran Inquiry merupakan komponen dari CTL. mengajukan hipotesa untuk diuji.masalah adalah salah satu dari kegiatan inquiry yang paling sering digunakan. Kemudian menentukan bagaimana mempresentasikan dan menjelaskan penemuannya. kemudian penyelidikan dilakukan untuk membuktikan apakah kemungkinan pemecahan atau hipotesa itu diterima atau ditolak. Proses ini terdiri dari 5 tahap. Siswa menghadapi atau dihadapkan pada suatu permasalahan. menguji hipotesa. mengevaluasi ide dan proposisi. memproses. dan melakukan penyelidikan. Inquiry adalah proses perpindahan dari pengamatan menjadi pemahaman. atau menolak hipotesa itu dan melanjutkan penyelidikan sampai menemukan pemecahan masalah yang memuaskan. membuat kesimpulan. Dengan dasar kata yang telah terkumpul. Melakukan inquiry berarti melibatkan diri dalam tanya jawab. Dalam proses itu. dan pemecahan . Inquiry ada banyak bentuk dan model. membuat pengamatan lebih jauh. . Jawaban pertanyaan ± Pertanyaan tersebut didapat melalui siklus menyusun dugaan. dan menyusun teori serta konsep yang berdasar pada data dan pengetahuan. merefleksi validitas data. Karena itu strategi inquiri dalam proses belajar mengajar adalah strategi yang melibatkan siswa dalam tanya jawab. menyusun hipotesis. Yang di awalai dari pengamatan dari pertanyaan yang muncul. Di dalam pembelajaran berdasarkan inquiry. kemudian siswa bekerja untuk memecahkan masalah itu dengan meneliti untuk suatu pemecahan. dan pengujian untuk pemecahan. dan menghubungkan ide ± ide atau teori untuk mendapatkan konsep. dan sampai pada pengambilan kesimpulan yang masih tentatif. Dalam pelaksanaan siswa bertanggung jawab untuk memberikan ide atau pemikiran dan pertanyaan untuk eksplorasi. siswa akan sampai pada suatu kesimpulan yang masih tentatif. mencari informasi.

kemudian pada tahap-tahap berikutnya. 2. Pada tahap awal. bimbingan tersebut dikurangi. Salah satu keuntungan belajar dengan metode ini adalah adanya kemungkinan siswa dalam memecahkan masalah open ended dan mempunyai alternatif pemecahan masalah lebih . Selama proses ini.B. Karena dalam pendekatan inkuiri bebas ini menempatkan siswa seolah-olah bekerja seperti seorang ilmuwan. Bimbingan yang diberikan dapat berupa pertanyaan-pertanyaan dan diskusi multi arah yang dapat menggiring siswa agar dapat memahami konsep pelajaran matematika. Pada umumnya pendekatan ini digunakan bagi siswa yang telah berpengalaman belajar dengan pendekatan inkuiri. 1. Siswa diberi kebebasan menentukan permasalahan untuk diselidiki. Inquiri Bebas (free inquiry approach). Guru mempunyai peran aktif dalam menentukan permasalahan dan tahap-tahap pemecahannya. bimbingan dapat pula diberikan melalui lembar kerja siswa yang terstruktur. Pada dasarnya siswa selama proses belajar berlangsung akan memperoleh pedoman sesuai dengan yang diperlukan. Inquiry Terbimbing (guided inquiry approach) Pendekatan inquiry terbimbing yaitu pendekatan inquiry dimana guru membimbing siswa melakukan kegiatan dengan memberi pertanyaan awal dan mengarahkan pada suatu diskusi. bimbingan dari guru sangat sedikit diberikan atau bahkan tidak diberikan sama sekali. Jenis ± Jenis Inquiry Inquiry terbagi menjadi tiga jenis berdasarkan besarnya intervensi guru terhadap siswa atau besarnya bimbingan yang diberikan oleh guru kepada siswanya. Di samping itu. Pendekatan inkuiri terbimbing ini digunakan bagi siswa yang kurang berpengalaman belajar dengan pendekatan inkuiri. Dengan pendekatan ini siswa belajar lebih beorientasi pada bimbingan dan petunjuk dari guru hingga siswa dapat memahami konsep-konsep pelajaran. Selama berlangsungnya proses belajar guru harus memantau kelompok diskusi siswa. Pada pendekatan ini siswa akan dihadapkan pada tugas-tugas yang relevan untuk diselesaikan baik melalui diskusi kelompok maupun secara individual agar mampu menyelesaikan masalah dan menarik suatu kesimpulan secara mandiri. guru banyak memberikan bimbingan. merancang prosedur atau langkah-langkah yang diperlukan. sehingga guru dapat mengetahui dan memberikan petunjuk-petunjuk dan scafolding yang diperlukan oleh siswa. sehingga siswa mampu melakukan proses inkuiri secara mandiri. menemukan dan menyelesaikan masalah secara mandiri.

ada kemungkinan siswa menemukan cara dan solusi yang baru atau belum pernah ditemukan oleh orang lain dari masalah yang diselidiki. atau melalui diskusi dengan siswa dalam kelompok lain. Inquiri Bebas yang Dimodifikasikan ( modified free inquiry approach) Pendekatan ini merupakan kolaborasi atau modifikasi dari dua pendekatan inkuiri sebelumnya. 3. ada kemungkinan kelompok atau individual lainnya kurang memahami topik yang diselidiki oleh kelompok atau individual tertentu. Berikut ini adalah postulat yang diajukan oleh Suchman untuk mendukung teori yang mendasari model pembelajaran ini. 4) karena topik yang diselidiki antara kelompok atau individual berbeda. Artinya. apabila ada siswa yang tidak dapat menyelesaikan permasalahannya. sehingga guru akan membutuhkan waktu yang lama untuk memeriksa hasil yang diperoleh siswa.dari satu cara. karena tergantung bagaimana cara mereka mengkonstruksi jawabannya sendiri. Dalam pendekatan inkuiri jenis ini guru membatasi memberi bimbingan. sehingga diskusi tidak berjalan sebagaimana yang diharapkan. Meskipun begitu permasalahan yang akan dijadikan topik untuk diselidiki tetap diberikan atau mempedomani acuan kurikulum yang telah ada. Inquiry Training Model pembelajaran ini dikembangkan oleh seoranh tokoh yang bernama Suchman. dengan harapan agar siswa dapat menemukan sendiri penyelesaiannya. . 2) karena diberi kebebasan untuk menentukan sendiri permasalahan yang diselidiki. Suchman menyakinkani bahwa anak-anak merupakan individu yang penuh rasa ingin tahu akan segala sesuatu. prosedur ilmiah dapat diajarkan secara langsung kepada mereka. 4. Namun. Sedangkan belajar dengan metode ini mempunyai beberapa kelemahan. ada kemungkinan topik yang diplih oleh siswa di luar konteks yang ada dalam kurikulum. dalam pendekatan ini siswa tidak dapat memilih atau menentukan masalah untuk diselidiki secara sendiri. Namun bimbingan yang diberikan lebih sedikit dari Inkuiri terbimbing dan tidak terstruktur. namun siswa yang belajar dengan pendekatan ini menerima masalah dari gurunya untuk dipecahkan dan tetap memperoleh bimbingan. maka bimbingan dapat diberikan secara tidak langsung dengan memberikan contoh-contoh yang relevan dengan permasalahan yang dihadapi. agar siswa berupaya terlebih dahulu secara mandiri. 3) ada kemungkinan setiap kelompok atau individual mempunyai topik berbeda. antara lain: 1) waktu yang diperlukan untuk menemukan sesuatu relatif lama sehingga melebihi waktu yang sudah ditetapkan dalam kurikulum. Oleh karena itu. Selain itu. yaitu: pendekatan inkuiri terbimbing dan pendekatan inkuiri bebas.

Penelitian kooperatif (cooperative inquiry) dapat memperkaya kemampuan berpikir dan membantu siswa belajar tentang suatu ilmu yang senantiasa bersifat tentatif dan belajar menghargai penjelasan atau solusi alternatif. Tujuan Utama. 3. 4. fenomena. Secara singkat model ini bertujuan untuk melatih kemampuan siswa dalam meniliti. Syarat ± syarat inquiry 1. 2. C. berkarya. Guru harus terampil memilih persoalan ± persoalan yang relevan untuk diajukan kepada kelas (persoalan bersumber pada bahan pelajaran yang menantang siswa atau yang problematis) dan sesuai dengan daya nalar siswa. Strategi baru dapat diajarkan secara langsung dan ditambahkan/digabungkan dengan strategi lama yang telah dimiliki siswa. Apabila berpikir merupakan tujuan pendidikan. Secara alami manusia mempunyai kecenderungan untuk selalu mencari tahu segala sesuatu yang menarik perhatiannya. dan memecahakan masalah secara almiah.1. 6. 1. 3. Penggunaan Sumber Pengajaran Evaluasi Inquiry. Guru tidak banyak campur tangan dan intervensi terhadap kegiatan siswa. Peranan Siswa. Guru harus terampil menumbuhkan motivasi belajar siswa dan menciptakan situasi belajar yang menyenangkan. Adanya kebebasan siswa untuk berpendapat. Mereka akan menyadari keingintahuan akan segala sesuatu tersebut dan akan belajar untuk menganalisis strategi berpikirnya. menjelaskan. maka cara yang harus dipikirkan . Adanya fasilitas dan sumber belajar yang cukup 4. 5. Partisipasi setiap siswa dalam setiap kegiatan belajar. 2. Peranan Guru. D. Tujuan Utama Tujuan utama pengajaran inquiry adalah menyediakan peralatan atau cara bagi siswa untuk mengembangkan ketrampilan intelektualnya yang berkaitan dengan berfikir kritis dan memecahkan masalah. berdiskusi.

Guru membantu siswa dalam menemukan sumber informasi yang tepat dan bertanggung jawab bahwa sejumlah sumber pengajaran itu cukup dan digunakan. mengumpulkan dan mengklasifikasi data yang relevan. Guru harus memilikiketrampilan khusus dalam bertanya yang dapat meningkatkan berfikir kritis dan dapat memecahkan masalah. Perhatian utama pada inquiry adalah pengembangan proses mental seperti mengidentifikasi dan menganalisis masalah. dan bersamaan dengan itu diperlukan bantuan psycologis. Guru menyusun kembali dan mengklarifikasi respon siswa. Guru membuat suasana yang menjamin kebebasan untuk melakukan eksplorasi. dan menyarankan suatu alternatif penafsiran terhadap data. Sesungguhnya. Inquiry meminta siswa untuk berfikir secara bebas. 3. untuk merespon masalah yang diberikan. Guru tidak menekankan kebenaran jawaban. tetapi diharapkan bahwa mereka ditingkatkan keberanian mengajukan pertanyaan. menguji hipotesa dan sampai pada suatu kesimpulan. menafsirkan dan meferivikasi data. tidak mencakup menspesifikasi faktor ± faktor dari suatu ilmu. tetapi membantu siswa menemukan dan mengklarifikasi jawaban yang tepat. dan berfikir untuk alternatif pemecahan. Karena itu siswa tidak secara keseluruhan bebas mengluyur sendiri melakukan inquiry. menyusun hipotesa. sebagai fasilitator yang berhadapan dengan siswa membantu mereka mengidentifikasi pertanyaan dan masalah. Siswa ditingkatkan kemampuannya untuk dapat menemukan sesuatu untuk diri mereka sendiri dengan mengaplikasikan prinsip metode ilmiah inquiry. dan membimbing dalam melakukan penyelidikan.adalah untuk membantu mengembangkan kemampuan individual. Peranan Guru Karena inquiry adalah pembelajaran yang terpusat pada siswa. Melalui inquiry. melakukan hubungan pribadi yang baik. Peranan Siswa Peranan siswa dalam pengajaran inquiry adalah sebagai pengambil inisiatif atau prakarsa dalam menemukan sesuatu untuk mereka sendiri. Situasinya dibuat sedemikian rupa sehingga inquiry dapat berjalan dengan baik. Inquiry menekankan menemukan sesuatu untuk diri mereka sendiri. siswa dengan bantuan guru . maka peranan guru adalah sebagai pembimbing dan sebagai stimulator. mereka akan ³belajar bagaimana belajar´. Sejauh mungkin guru berusaha untuk meningkatkan cara kerja siswa secara bebas. 2. Mereka aktif menggunakan cara belajar mereka sendiri. Dengan keterbatasannya. tidak diharapkan bahwa mereka tidak dibimbing dalam penyelidikan mereka. Tujuan inquiry adalah memberi latihan untuk mengembangkan ketrampilan intelektual yang khusus.

model inquiri tidak memerlukan menggunakan materi pengajaran. Menyampaikan peristiwa peristiwa yang kontradiksi. tetapi bagaimana mereka menggunakan sumber pengajara itu. Penggunaan Sumber Pengajaran Berlawanan seperti apa yang sering dianggap. tetapi juga mengajukan pertanyaan dan menemukan jawabannya melalui penyelidikan. Tahap Dua Tahap Tiga . Siswa bebas melakukan eksplorasi. SINTAKSIS MODEL INQUIRY Tahap Satu : Menghadapkan pemasalahan. gambar. nara sumber. : Pengumpulan data eksperimentasi. Siswa tidak hanya dievaluasi pada kemampuan mengingat (recall) dan mereproduksi informasi. Evaluasi Evaluasi hasil belajar siswa pada model inquiry dipusatkan pada sampai sejauh mana siswa dapat menggunakan ketrampilan intelektual yang berhubungan dengan pengajaran inquiry. dan diberi kesempatan untuk malakukan pemilihan alternatif pemecahan masalah. Sumber pengajaran itu digunakan untuk membuka tabir pertanyaan yang berupa hipotesa. film strip.menyusun tujuan mereka sendiri. Mengisolasi variabel yang relevan. 5. : Pengumpulan data dan verivikasi. film. Hubungan sebab akibat. Peranan siswa tidak hanya merespon pertanyaan yang diajukan guru. Tes yang berstandart memusatkan pada pengukuran berfikir kritis dan ketrampilan memecahkan masalah adalah lebih tepat dibandingkan dengan evaluasi yang mendasarkan diri terutama pada penguasaan suatu bidang ilmu. buku pertanyaan atau anjuran. 4. Menyusun dan menguji hipotesa. Inquiry memerlukan data untuk penafsiran. Tetapi inquiry mengutamakan bagaimana siswa itu menghasilkan dan meferivikasi permasalahan. perpustakaan dapat digunakan secara efektif untuk penyelidikan inquiry. Memverifikasi benda. Seringkali. bila inquiry digunakan maka evaluasinya didasarkan pada banyak pengetahuan yang dipindahkan. keadaan. sifat dan peristiwa. Penjelasan prosedur inquiry. Dalam pengajaran inquiry seperti halnya dengan model yang lain. Sumber ± sumber seperti buku teks. masalahnya bukan sumber pengajaran apa.

eksplorasi fenomena  Guru mendorong untuk mendiskusikan suatu dan menjelaskan bekerja. Menyusun aturan atau penjelasan.  guru memantauketepatanaktifitassiswa 3. pemahaman mereka bagaimana fenomena menggunakan contoh dari pengalaman pribadi. Koneksi    proses koneksi melalui : konsiliasai. Siswa membuat perencanaan mengumpulkan data yang bermakana yang ditujukan pada pertanyaan. Disini terjadi integrasi konsep sains dengan proses sains. E. dan observasi siswa mampu menghubungkan pengetahuan sains pribadi dengan konsep komunitas sains.  Dilakukan dengan diskusi bersama. Investigasi  proses melalui koleksi dan mempresentasikan data . Formulasi dan Penjelasan. Karakteristik Model Inquiry 1. pertanyaan. dan observasi proses koneksi melalui : konsiliasai. dan observasi proses koneksi melalui : konsiliasai. 2. Desain   Proses desain melalui prosedur materi. Tahap Lima : Analisis Proses inquiry Analisis strategi inquiry dan mengembangkan proses inquiry lebih efektif. pertanyaan. menemukan hubungan dengan literature. pertanyaan.Tahap Empat : Mengorganisir.

dan memperjelas hasil penyelidikan. dan akan dijawab oleh guru dengan ³jawaban ya atau tidak´. Tahap pertama. guru memberi permasalahan. Siswa mengajukan faktor atau unsur yang baru ke dalam permasalahan untuk dapat . teka ± teki yang sederhana yang tidak banyak memerlukan latar belakang pengetahuan tentang teka ± teki tersebut. ide atau pikiran yang sederhana. Ia harus menghubungkan antara interpretasi ilmiah yang diterima. danprediksi. siswa dapat membaca data secara akurat. mengorganisasi data dengan cara yang logis dan bermakna. yang F. Aplikasi inquiry Salah satu model inquiry yang berangkat dari fakta sampai pada teori. Namun permulaan pelaksanaan inquiry dapat dimulai dengan masalah yanmg sederhana. b. 4. Tahap kedua. Yang diutamakan dalam hal ini ialah pengalaman proses berfikir secara inquiry. generalisasi. ialah verifikasi. Tahap ketiga. ialah melakukan eksperimentasi.  siswadapatmengaplikasikanpemahamannyapadasituasibaru mengembangkaninferensi. Dalam memberikan permasalahan dapat berupa peristiwa yang kontradiksi. dengan mengajukan pertanyaan kepada guru sedemikian rupa sehingga guru terpaksa menjawab ³ya atau tidak´. dan dapat juga berbentuk tekai ± teki. MembangunPengetahuan   proses melalui reflektif ± konstruksi ± prediksi.  gurubertukarpendapatterhadappemahamansiswa. Di dalam penjelasan diaturkan tentang tujuan. dan menjelaskan prosedur pelaksanaan inquiry kepada siswa. adalah latihan inquiry yang dianjurkan oleh Bruce Joyce dan Marsha Weil (1986). dimana para siswa mengumpulkan data atau informasi tentang peristiwa (masalah) yang telah mereka lihat atau alami. dan prosesnya dilakukan dengan ³yes and no questions´ yaitu pertanyaan yang diajukan siswa. konsep yang dilakukan dengan eksperimen akan memberi arti yang lebih bermakna dan mampu berfikir kritis. c. Kelima tahap pelaksanaan inquiry adalah sebagai berikut : a.

Menguji secara langsung terjadi bila siswa melakukan uji coba teori atau hipotesa. tetapi dapat memberi saran untuk suatu teori. yaitu eksplorasi dan menguji langsung. Tahap kelima. Eksplorasi adalah merubah sesuatu untuk melihat apa yang akan terjadi dan tidak perlu bimbingan teori atau hipotesis. Mereka boleh menentukan bahwa pertanyaan itu efektif atau tidak efektif. Tahap keempat. e. Eksperimen memiliki dua fungsi. tetapi peserta didik yang diberi peluang . Proses merubah hipotesa kedalam eksperimentasi adalah tidak mudah dan memerlukan latihan atau praktek.melihat apakah peristiwa itu dapat terjadi secara berbeda. siswa diminta untuk menganalisis proses inquiry. Walaupun tahap kedua dan ketiga terpisah. dari informasi yang komprehen yang mereka kumpulkan menjadi suatu penjelasan yang cukup jelas. Banyak pertanyaan verifikasi dan eksperimen diperlukan hanya untuk meneliti suatu teori. ada informasi yang diperlukan tapi tidak diperoleh. Prosedur Inquiry Di dalam sistem belajar ± mengajar ini. guru menyajikan bahan pelajaran tidak dalam bentuknya yang final. namun cara berpikir siswa dan bentuk pertanyaan yang diajukan umumnya berada di antara dua tahap ini. Dalam proses verifikasi mereka boleh mengajukan pertanyaan tentang : 1) Benda (obyects) 2) Sifat (properties) 3) Kondisi (conditions) 4) Peristiwa (events) d. G. Tahap ini penting jika kita ingin membuat proses inquiry secara sadar dan secara sistematis mencoba untuk memperbaikinya. Mereka diperkenankan memberi penjelasan yang kurang dengan menghilangkan beberapa bagian yang penting. Biasanya siswa mendapatkan kesulitan dalam membuat lompatan intelektual. Tugas berikutnya dari guru ialah memperdalam proses inquiry siswa dengan memperluas jenis-jenis informasi yang mereka peroleh. Seringkali ada beberapa teori atau penjelasan yang didasarkan pada data yang sama. pertanyaan itu produktif atau tidak produktif. guru meminta siswa untuk mengorganisir data dan menyusun suatu penjelasan.

untuk mencari dan menemukan sendiri dengan mempergunakan teknik pendekatan pemecahan masalah. Dibawah ini adalah contoh pembelajaran inquiry tentang ³Peta dan Globe´ pada kelas 3 SD. . terbukti atau tidak.. dengan kata lain. Stimulation : Guru mulai dengan bertanya mengajukan mengajukan persoalan. pertanyaan atau hipotesis yang telah dirumuskan terdahulu itu kemudian dicek. atau menyuruh peserta didik membaca atau mendengarkan uraian yang memuat permasalahan. diklasifikasikan. dan sebagainya. apakah terjawab atau. observasi. Verifikation : Berdasarkan hasil pengolahan dan tafsiran atau informasi yang ada tersebut (available information). mencoba (uji coba) sendiri. Secara garis besar prosedurnya sebagai berikut : 1. dan sebagainya) itu diolah. Untuk siswa sekolah dasar pada kelas-kelas rendah dapat juga menggunakan pendekatan inquiry ini melalui pembelajaran-pembelajaran yang sederhana. Data collection : Untuk menjawab pertanyaan atau membuktikan benar tidaknya hipotesis itu. Generalization : Tahap selanjutnya. H. bahkan kalu perlu dihitung dengan cara tertentu serta ditafsirkan pada tingkat kepercayaan tertentu. 4. 5. Contoh Penerapan inquiry di SD kelas 3 Pembelajaran IPS dengan menggunakan pendekatan inquiry dapat di terapkan pada semua jenjang dan kelas. peserta didik diberi kesempatan untuk mengumpulkan berbagai informasi yang relevan. ditabulasikan. mewawancarai orang sumber. sebanyak mungkin memilihnya yang dipandang paling menarik dan fleksibel untuk dipecahkan. 2. dengan jelas membaca literatur mengamati objeknya. 6. berdasarkan hasil verifikasi tadi siswa belajar menrik generalisasi atau kesimpulan tertentu. misalnya siswa mengawali dengan belajar bagaimana belajar dan bekerja dengan menggunakan peta dan globe. Data processing : Semua informasi (hasil bacaan wawancara. diacak. Permasalahan yang dipilih ini selanjutnya harus dirumuskan dalam bentuk pertanyaan atau hipotesis (pernyataan sebagai jawaban sementara atas pertanyaan tersebut). 3. Problem statement : Peserta didik diberi kesempatan untuk mengidentifikasi berbagai permasalahan.

Prosedur: Bimbinglah siswa melalui langkah-langkah berikut ini: Tahap 1 Guru: Siapa diantara kamu yang pernah melihat danau? Sungai? Adakah diantara kamu yang pernah melihat laut? Seperti apakah sungai. Ini ada di peta? Apa warnanya? (Siswa menjawab: ³biru´) Mari lihat pula Samudra Indonesia. (Pegang bola dinia ini) Coba berikan nama laut ini? (Apabila kamu tidak tahu coba bantu oleh yang lainnya) Baiklah. Mereka mungkin mewarnai bagian/tempat yang ada airnya. Inilah ada di peta.Tujuan: Pada akhir proses belajar mengajar diharapkan para siswa dapat (1) mengenal simbol-simbol yang ada di dalam peta dan (2) mengemukakan alasan mengapa harus menggunakan simbol yang berbeda-beda. Mungkin juga mereka menggambar gelombang pada tempat yang ada airnya. danau.) Tahukah kamu bahwa lautan lebih luas daripada daratan? Orang yang membuat peta dan globe mempunyai kesulitan karena harus dapat meyakinkan orang lain wilayah mana yang berupa daratan dan wilayah mana yang berbentuk lautan. Beri pula dorongan agar mereka bercerita atau menjelaskan apa yang telah mereka ketahui. Tahap 2 Guru: Bagaimana pembuat globe untuk mengatasi kesulitan ini? Bagaimana pendapatmu tentang cara menunjukkan lokasi perairan? Kemungkinan jawaban siswa: y y Mungkin siswa menuliskan kata ³air´ pada tempat yang ada airnya. y Tahap 3 Guru: Anggaplah bahwa kita adalah ilmuwan yang akan menguji pendapat siapa yang paling tepat. dan laut itu? (Siswa menjawab setiap pertanyaan. Apa warnanya? (Siswa menjawab: ³warnanya sama ± biru´) Tahap 4 Beri lagi pertanyaan untuk membuktikan bahwa mereka telah menguasainya. Mari kita lihat bola dunia ini. mari kita lihat Laut Jawa. Kembangkan pertanyaan itu hingga para siswa menyebutkan bahwa semua tempat itu berisi air. .

mengapa mereka tidak menuliskan ³air´ pada tempattempat yang menunjukan lautan atau menggambarkan gelombang? (Para siswa menjawab: ³Apabila pembuat bola dunia itu menuliskan kata µair´ maka ia harus menuliskan kata air beberapa kali´.) Kesimpulannya: ³Umumnya pada peta dan bola dunia. ³Akan sulit juga menuliskan kata ³air´ untuk menunjukan suatu ³sungai´. Kelemahan .Guru: Berdasarkan informasi yang telah kita diketahui.) Tahap 5 Tahap ini adalah kesimpulan dari seluruh pelajaran. mudah ditransfer (untuk menghadapi pemecahan masalah). Di bawah ini ditampilkan suatu contoh model inquiry untuk siswa SD kelas 6 dengan topik kependudukan. Selain itu. Marilah kita perhatikan peta dan bola dunia lainnya. dapatkah kamu mengemukakan simbol wilayah perairan pada peta dan bola dunia (globe)? (Siswa menjawab: ³Wilayah perairan itu digambarkan dengan warna biru´). Kelebihan dan Kelemahan Inquiry Kelebihan Bahwa hasil belajar dengan cara ini lebih mudah dihafal dan diingat. Pengetahuan dan kecakapan (intelektual potency) peserta didik yang bersangkutan lebih jauh lagi dapat menumbuhkan motif intrinsik (karena peserta didik merasa puas atas penggunannya sendiri). mengapa pembuat bola dunia memilih cara membuat simbol laut dengan warna biru? Maksud saya. Karena ada wilayah perairan laut yang sempit sehingga akan sulit menuliskan kata ³air´ pada tempat itu´. Guru: Dari apa yang telah kita pelajari. Samakah simbol yang dibuat untuk wilayah perairan laut? (Guru dan siswa melihat-lihat peta dan bola dunia lainnya. namun kesulitan untuk sungai´. pada tahap ini pun dirancang untuk membuat penjelasan umum yang dapat diterapkan dalam situasi lainnya. ³Menggambarkan gelombang untuk lautan mungkin saja. bagaimana pembuat bola dunia menggambar lautan agar berbeda dengan simbol lainnya? (Siswa menjawab: ³warnanya biru´) Tahukah kamu. Pembelajaran dengan menggunakan pendekatan inquiry di sekolah dasar untuk kelas yang lebih tinggi dapat dengan cara melakukan analisis terhadap suatu data . warna biru digunakan untuk menunjukan perairan´. I.

Kelemahan dari inquiry antara lain memakan waktu banyak (time consuming) dan. kalau kurang terpimpin atau terarah. Bagan Penerapan Inquiry Guru memilih tingkah laku/tujuan 1 2 Guru mengajukan pertanyaan yang dapat menumbuhkan siswa menemukan pendapatnya 3 Siswa menetapkan hipotesis /praduga jawaban untuk dikaji lebih lanjut (alternatif jawaban) 4a Secara spontan siswa menjelajahi informasi/data untuk menguji praduga. baik secara individu ataupun secara kelompok 3a Siswa tidak banyak berusaha mencari informasi untuk membuktikan praduga . J. dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya.

contoh untuk bentuk ini telah dikemukakan dalam perilaku pemecahan masalah. y Inquiry berdasarkan isu ± isu yang kontroversial atau kejadian sekarang. y Inquiry berdasarkan situasi masalah yang diminta pemecahan. Kesimpulan Model pembelajaran inkuiry dapat dilakukan dengan cara. Misalnya adanya protes dari penduduk suatu wilayah tentang pencemaran limbah industri terhadap sumber air penduduk. Misalnya manusia diminta mempelajari makna simbol yang terdapat pada mata uang bangsanya. . mendorong melakukan kegiatan belajar untuk mencari informasi yang diperoleh Inquiry Siswa mengidentifikasi beberapa kemungkinan jawaban/menarik kesimpulan 5 Keterangan : Jalur 1 ± 2 ± 3 ± 4a ± 5 1 ± 2 ± 3 ± 3a ± 4b ± 5 BAB IV PENUTUP A.Siswa menarik kesimpulan 4b Guru membantu siswa.cara sebagai beriktu : y Didasarkan pada artefak (artifact) yaitu benda ± benda hasil kepandaian manusia.

y Inquiry yang berdasarkan pada konsep ± konsep yang ditemukan dalam pelajaran. Saran . misalnya mempelajari bagaimana kontak dengan budaya lain mempengaruhi cara kehidupan. Untuk itu misalnya guru dapat mengajukan pertanyaan pada siswa misalnya: 1) Apa hubungan antara gambar atau ilustrasi tersebut dengan materi/konsep yang kita bicarakan ? atau 2) Kapan gambar tersebut dibuat? B. y Inquiry yang didasarkan pada potret dan ilustrasi. Misalnya kontak ± kontak yang dilakukan oleh suku terasing dengan kelompok masyarakat lain dan pengaruhnya terhadap suku terasing tersebut. Gambar dan ilustrasi adalah untuk meningkatkan ketelitian terhadap konsep yang dikemukakan dalam buku teks IPS.

You're Reading a Free Preview

Download
scribd
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->