BAB I PENDAHULUAN

A. Latar Belakang Masalah Metode Pembelajaran dapat didefinisikan sebagai cara yang digunakan guru untuk mencapai tujuan pembelajaran yang bersifat prosedural yaitu berisi tahapan tertentu. Suatu yang yang terpenting bagi seorang guru bukan hanya menyampaikan informasi dan bahan ajar kepada siswa, melainkan guru harus berusaha menciptakan agar siswa dapat memahami secara keseluruhan isi dari materi pelajaran yang disampaikan. Agar proses belajar-mengajar menjadi berhasil, untuk itu seorang guru harus mampu mempersiapkan bahan-bahan untuk kegiatan belajarmengajar di kelas serta merancang model-model pembelajaran yang sesuai agar siswa tidak bosan dan akan lebih menyenanginya. Banyak kejadian di lapangan siswa yang merasa bosan terhadap salah satu mata pelajaran dikarenakan metode yang digunakan oleh guru tidak mampu membuat siswa mengerti materi bahkan akan timbul persepsi yang negatif. Misalkan pada pelajaran IPS, siswa merasa jenuh dengan cara guru menerangkan materi karena siswa tidak diberi kesempatan bebas untuk mengeluarkan pendapat,tetapi hanya mendengarkan saja penjelasan dari guru sehingga siswa merasa jenuh. Dengan bekal kemampuan dan keterampilan dalam merancang model-model pembelajaran tentunya guru memahami dan menguasai materi serta mampu menentukan jenis model-model pembelajaran yang sesuai dengan materi yang akan digunakan dalam kegitan belajar mengajar di kelas. Salah satu model pembelajaran yang dapat diterapkan dalam kegitan belajar- mengajar IPS SD Kelas 3 adalah Model Pembelajaran Inkury. Model pembelajaran ini melatih siswa untuk belajar sendiri dan menemukan sendiri pengetahuan. Proses pembelajarannya lebih berpusat kepada siswa. Banks (1990) mengemukakan bahwamodel pembelajaran IPS dengan menggunakan inkury sosial untuk menghasilkan fakta, konsep, generalisasi, dan teori.namun tujuan utama inkury sosial adalah untuk membangun teori. Para ilmuwan sosial percaya salah satu cara membantu masyarakat adalah dengan membangun teori. Teori dapat digunakan untuk memehami, menjelaskan, memprekdisi, dan mengontrol perilaku masyarakat. Selain itu, tujuan inkuri sosial pun diharapkan dapat

berpikir kritis. Bagaimana penerapan model pembelajaran inkury dalam proses belajarmengajar pada mata pelajaran IPS SD Kelas 3? 3. masalah tersebut harus didasarkan pada suatu gagasan yang memang dapat ditemukan kebenarannya dan bukan hanya mengada-ada. Tujuan Makalah Dengan proses inquiry. Karena itu inquiry mengajaran yang berpusat pada siswa. dan dapat memecahkan masalah.membantu masyarakat dalam memecahkamn masalah ± masalah sosial sehingga mereka dapat memperoleh kehidupan yang lebih baik. . jika kurang terpimpin atau terarah. diasumsikan bahwa sekolah menyediakan pengajaran yang terbaik kepada siswa untuk mengarahkan diri. Apakah kelemahan dan kelebihan dari model pembelajran Inkuiry? C. dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya. Mengetahui pentingnya sebuah perencanaan yang matang agar proses belajr mengajar berjalan dengan baik. Pembelajaran inquiry dipandang lebih efektif karena secara pribadi terlibat ( baik fisik dan mental ) dalam kegitan belajar mengajar. Manfaat Bagi Mahasiswa a. b. Untuk itu inkuri harus difokuskan pada masalah-masalah praktis kemasyarakatan. Dengan proses inquiry siswa dilatih untuk melakukan proses . menghendaki siswa terlibat secara aktif dalam pengajaran. D. Adakah kesulitan guru dalam menentukan model pembelajaran yang sesuai dengan materi yang akan diajarkan? 2. Untuk mempersiapkan bahan ± bahan untuk kegiatan belajar mengajar di kelas. Bagaimana keaktifan siswa setelah guru menerapkan model pembelajaran Inkuiry ? 4. yang belum diketahui tetapi dapat menarik siswa. Rumusan Masalah 1. Namun model ini memakan waktu banyak (time consuming) dan. Dalam inkuiry siswa dihadapakan pada suatu yang bersifat misterius. yang berarti siswa berlatih dalam proses inquiry. penemuan (discovery) dan proses pemecahan masalah (problem solving). Siswa menemukan arti suatu konsep kemudian membuat suatu kesimpulan dan menyusun suatu generalisasi dari data yang mereka simpulkan. Manfaat Makalah 1. B.

belajar melakukan penelitian dalam pembelajaran. b. Siswa lebih berperan aktif. b. Melatih siswa untuk mampu memecahkan masalah damn menarik kesimpulan sendiri. Guru diharapkan sedapat mungkin memperbanyak latihan dalam merancang model-model pembelajaran. Manfaat Bagi Guru a. Manfaat Bagi Siswa a. . Menciptakan proses belajar mengajar yang lebih efektif dengan menerapan model pembelajaran Inkuiry.2. 3.

Pengertian Inquiry Inquiri berasal dari kata to inquire yang berarti ikut serta. tujuan dari penggunaan strategi pembelajaran inkuiri adalah mengembangkan kemampuan intelektual sebagai bagian dari proses mental. . sehingga kemampuan guru dalam menggunakan teknik bertanya merupakan syarat utama dalam melakukan inkuiri. siswa tidak hanya berperan sebagai penerima pelajaran melalui penjelasan guru secara verbal. akan tetapi bagaimana mereka dapat menggunakan potensi yang dimilikinya. mencari informasi. seluruh aktivitas yang dilakukan siswa diarahkan untuk mencari dan menemukan sendiri dari sesuatu yang dipertanyakan. strategi inkuiri menekankan kepada aktifitas siswa secara maksimal untuk mencari dan menemukan. dalam mengajukan pertanyaan-pertanyaan. Dalam proses pembelajaran. sehingga diharapkan dapat menumbuhkan sikap percaya diri (self belief). Hingga dewasa keingintahuan manusia secara terus menerus berkembang dengan menggunakan otak dan pikirannya. Sejak kecil manusia memiliki keinginan untuk mengenal segala sesuatu melalui indera penglihatan. Ketiga. Didasari hal inilah suatu model pembelajaran yang dikenal dengan inkuiri dikembangkan. Selanjutnya Sanjaya (2008. Jika berpikir menjadi tujuan utama dari pendidikan. maka harus ditemukan cara-cara untuk membantu individu untuk membangun kemampuan itu. Pengetahuan yang dimiliki manusia akan bermakna (meaningfull) apabila didasari oleh keingintahuan itu. akan tetapi sebagai fasilitator dan motivator belajar siswa.(---------------------Sejak manusia lahir ke dunia. tetapi mereka berperan untuk menemukan sendiri inti dari materi pelajaran itu sendiri. manusia memiliki dorongan untuk menemukan sendiri pengetahuannya. artinya pendekatan inkuiri menempatkan siswa sebagai subjek belajar. Aktvitas pembelajaran biasanya dilakukan melalui proses tanya jawab antara guru dan siswa. Pertama. pendengaran. Artinya dalam pendekatan inkuiri menempatkan guru bukan sebagai sumber belajar. pengecapan dan indera-indera lainnya. dan melakukan penyelidikan.196) menyatakan bahwa ada beberapa hal yang menjadi ciri utama strategi pembelajaran inkuiri. Ia menambahkan bahwa pembelajaran inkuiri ini bertujuan untuk memberikan cara bagi siswa untuk membangun kecakapan-kecakapan intelektual (kecakapan berpikir) terkait dengan proses-proses berpikir reflektif. Rasa ingin tahu tentang alam sekitar di sekelilingnya merupakan kodrat manusia sejak ia lahir ke dunia.BAB II KAJIAN PUSTAKA 1. akibatnya dalam pembelajaran inkuiri siswa tidak hanya dituntut agar menguasai pelajaran. Kedua. atau terlibat.

Di dalam pembelajaran berdasarkan inquiry. dan pemecahan . mengevaluasi ide dan proposisi. dan melakukan penyelidikan. dan pengujian untuk pemecahan. suatu kemungkinan pemecahan atau suatu hipotesa diajukan. Siswa menghadapi atau dihadapkan pada suatu permasalahan.masalah adalah salah satu dari kegiatan inquiry yang paling sering digunakan. dan sampai pada pengambilan kesimpulan yang masih tentatif. Dengan dasar kata yang telah terkumpul. siswa belajar menggunakan ketrampilan berpikir kritis saat mereka berdiskusi dan menganalisis bukti. Proses ini terdiri dari 5 tahap. Yang di awalai dari pengamatan dari pertanyaan yang muncul. Dalam proses itu. . membuat pengamatan lebih jauh. kemudian siswa bekerja untuk memecahkan masalah itu dengan meneliti untuk suatu pemecahan. merefleksi validitas data. memproses. dan menyusun teori serta konsep yang berdasar pada data dan pengetahuan. Dalam pelaksanaan siswa bertanggung jawab untuk memberikan ide atau pemikiran dan pertanyaan untuk eksplorasi. menguji hipotesa. Inquiry adalah proses perpindahan dari pengamatan menjadi pemahaman. mencari informasi. Pengertian Inquiry dalam Pembelajaran Inquiry merupakan komponen dari CTL. dan menghubungkan ide ± ide atau teori untuk mendapatkan konsep. Jawaban pertanyaan ± Pertanyaan tersebut didapat melalui siklus menyusun dugaan. mengajukan hipotesa untuk diuji. Melakukan inquiry berarti melibatkan diri dalam tanya jawab. atau menolak hipotesa itu dan melanjutkan penyelidikan sampai menemukan pemecahan masalah yang memuaskan. membuat kesimpulan. kemudian penyelidikan dilakukan untuk membuktikan apakah kemungkinan pemecahan atau hipotesa itu diterima atau ditolak. menyusun hipotesis. Kemudian menentukan bagaimana mempresentasikan dan menjelaskan penemuannya. Karena itu strategi inquiri dalam proses belajar mengajar adalah strategi yang melibatkan siswa dalam tanya jawab. Inquiry ada banyak bentuk dan model.BAB III PEMBAHASAN A. mencari informasi dan melakukan penyelidikan. siswa akan sampai pada suatu kesimpulan yang masih tentatif.

2. menemukan dan menyelesaikan masalah secara mandiri. Selama berlangsungnya proses belajar guru harus memantau kelompok diskusi siswa. Pada pendekatan ini siswa akan dihadapkan pada tugas-tugas yang relevan untuk diselesaikan baik melalui diskusi kelompok maupun secara individual agar mampu menyelesaikan masalah dan menarik suatu kesimpulan secara mandiri. Bimbingan yang diberikan dapat berupa pertanyaan-pertanyaan dan diskusi multi arah yang dapat menggiring siswa agar dapat memahami konsep pelajaran matematika. guru banyak memberikan bimbingan. kemudian pada tahap-tahap berikutnya. Guru mempunyai peran aktif dalam menentukan permasalahan dan tahap-tahap pemecahannya. sehingga guru dapat mengetahui dan memberikan petunjuk-petunjuk dan scafolding yang diperlukan oleh siswa. sehingga siswa mampu melakukan proses inkuiri secara mandiri. Pendekatan inkuiri terbimbing ini digunakan bagi siswa yang kurang berpengalaman belajar dengan pendekatan inkuiri. Pada tahap awal. Pada umumnya pendekatan ini digunakan bagi siswa yang telah berpengalaman belajar dengan pendekatan inkuiri. Salah satu keuntungan belajar dengan metode ini adalah adanya kemungkinan siswa dalam memecahkan masalah open ended dan mempunyai alternatif pemecahan masalah lebih . Pada dasarnya siswa selama proses belajar berlangsung akan memperoleh pedoman sesuai dengan yang diperlukan. Siswa diberi kebebasan menentukan permasalahan untuk diselidiki. bimbingan dari guru sangat sedikit diberikan atau bahkan tidak diberikan sama sekali.B. Inquiri Bebas (free inquiry approach). Inquiry Terbimbing (guided inquiry approach) Pendekatan inquiry terbimbing yaitu pendekatan inquiry dimana guru membimbing siswa melakukan kegiatan dengan memberi pertanyaan awal dan mengarahkan pada suatu diskusi. Di samping itu. 1. merancang prosedur atau langkah-langkah yang diperlukan. bimbingan tersebut dikurangi. Selama proses ini. Karena dalam pendekatan inkuiri bebas ini menempatkan siswa seolah-olah bekerja seperti seorang ilmuwan. bimbingan dapat pula diberikan melalui lembar kerja siswa yang terstruktur. Jenis ± Jenis Inquiry Inquiry terbagi menjadi tiga jenis berdasarkan besarnya intervensi guru terhadap siswa atau besarnya bimbingan yang diberikan oleh guru kepada siswanya. Dengan pendekatan ini siswa belajar lebih beorientasi pada bimbingan dan petunjuk dari guru hingga siswa dapat memahami konsep-konsep pelajaran.

namun siswa yang belajar dengan pendekatan ini menerima masalah dari gurunya untuk dipecahkan dan tetap memperoleh bimbingan. Inquiri Bebas yang Dimodifikasikan ( modified free inquiry approach) Pendekatan ini merupakan kolaborasi atau modifikasi dari dua pendekatan inkuiri sebelumnya. sehingga diskusi tidak berjalan sebagaimana yang diharapkan. Artinya. 4. Namun. apabila ada siswa yang tidak dapat menyelesaikan permasalahannya. agar siswa berupaya terlebih dahulu secara mandiri. antara lain: 1) waktu yang diperlukan untuk menemukan sesuatu relatif lama sehingga melebihi waktu yang sudah ditetapkan dalam kurikulum. yaitu: pendekatan inkuiri terbimbing dan pendekatan inkuiri bebas. ada kemungkinan topik yang diplih oleh siswa di luar konteks yang ada dalam kurikulum. 3) ada kemungkinan setiap kelompok atau individual mempunyai topik berbeda. atau melalui diskusi dengan siswa dalam kelompok lain. Meskipun begitu permasalahan yang akan dijadikan topik untuk diselidiki tetap diberikan atau mempedomani acuan kurikulum yang telah ada. Sedangkan belajar dengan metode ini mempunyai beberapa kelemahan.dari satu cara. 4) karena topik yang diselidiki antara kelompok atau individual berbeda. Suchman menyakinkani bahwa anak-anak merupakan individu yang penuh rasa ingin tahu akan segala sesuatu. Oleh karena itu. ada kemungkinan siswa menemukan cara dan solusi yang baru atau belum pernah ditemukan oleh orang lain dari masalah yang diselidiki. prosedur ilmiah dapat diajarkan secara langsung kepada mereka. Inquiry Training Model pembelajaran ini dikembangkan oleh seoranh tokoh yang bernama Suchman. 2) karena diberi kebebasan untuk menentukan sendiri permasalahan yang diselidiki. karena tergantung bagaimana cara mereka mengkonstruksi jawabannya sendiri. Berikut ini adalah postulat yang diajukan oleh Suchman untuk mendukung teori yang mendasari model pembelajaran ini. . Namun bimbingan yang diberikan lebih sedikit dari Inkuiri terbimbing dan tidak terstruktur. ada kemungkinan kelompok atau individual lainnya kurang memahami topik yang diselidiki oleh kelompok atau individual tertentu. dalam pendekatan ini siswa tidak dapat memilih atau menentukan masalah untuk diselidiki secara sendiri. Selain itu. sehingga guru akan membutuhkan waktu yang lama untuk memeriksa hasil yang diperoleh siswa. maka bimbingan dapat diberikan secara tidak langsung dengan memberikan contoh-contoh yang relevan dengan permasalahan yang dihadapi. 3. dengan harapan agar siswa dapat menemukan sendiri penyelesaiannya. Dalam pendekatan inkuiri jenis ini guru membatasi memberi bimbingan.

berdiskusi. D. Mereka akan menyadari keingintahuan akan segala sesuatu tersebut dan akan belajar untuk menganalisis strategi berpikirnya.1. 5. Secara singkat model ini bertujuan untuk melatih kemampuan siswa dalam meniliti. Tujuan Utama Tujuan utama pengajaran inquiry adalah menyediakan peralatan atau cara bagi siswa untuk mengembangkan ketrampilan intelektualnya yang berkaitan dengan berfikir kritis dan memecahkan masalah. Penggunaan Sumber Pengajaran Evaluasi Inquiry. menjelaskan. Adanya fasilitas dan sumber belajar yang cukup 4. 4. fenomena. 3. C. 3. 1. Adanya kebebasan siswa untuk berpendapat. Partisipasi setiap siswa dalam setiap kegiatan belajar. maka cara yang harus dipikirkan . Penelitian kooperatif (cooperative inquiry) dapat memperkaya kemampuan berpikir dan membantu siswa belajar tentang suatu ilmu yang senantiasa bersifat tentatif dan belajar menghargai penjelasan atau solusi alternatif. 2. Peranan Guru. berkarya. 2. Guru tidak banyak campur tangan dan intervensi terhadap kegiatan siswa. Apabila berpikir merupakan tujuan pendidikan. dan memecahakan masalah secara almiah. Guru harus terampil memilih persoalan ± persoalan yang relevan untuk diajukan kepada kelas (persoalan bersumber pada bahan pelajaran yang menantang siswa atau yang problematis) dan sesuai dengan daya nalar siswa. Syarat ± syarat inquiry 1. Secara alami manusia mempunyai kecenderungan untuk selalu mencari tahu segala sesuatu yang menarik perhatiannya. 6. Guru harus terampil menumbuhkan motivasi belajar siswa dan menciptakan situasi belajar yang menyenangkan. Tujuan Utama. Peranan Siswa. Strategi baru dapat diajarkan secara langsung dan ditambahkan/digabungkan dengan strategi lama yang telah dimiliki siswa.

menguji hipotesa dan sampai pada suatu kesimpulan. tidak mencakup menspesifikasi faktor ± faktor dari suatu ilmu. tetapi membantu siswa menemukan dan mengklarifikasi jawaban yang tepat. Dengan keterbatasannya. tidak diharapkan bahwa mereka tidak dibimbing dalam penyelidikan mereka. Tujuan inquiry adalah memberi latihan untuk mengembangkan ketrampilan intelektual yang khusus. siswa dengan bantuan guru . 2. tetapi diharapkan bahwa mereka ditingkatkan keberanian mengajukan pertanyaan.adalah untuk membantu mengembangkan kemampuan individual. menyusun hipotesa. Inquiry meminta siswa untuk berfikir secara bebas. Sejauh mungkin guru berusaha untuk meningkatkan cara kerja siswa secara bebas. menafsirkan dan meferivikasi data. sebagai fasilitator yang berhadapan dengan siswa membantu mereka mengidentifikasi pertanyaan dan masalah. Guru membuat suasana yang menjamin kebebasan untuk melakukan eksplorasi. dan berfikir untuk alternatif pemecahan. 3. Situasinya dibuat sedemikian rupa sehingga inquiry dapat berjalan dengan baik. Peranan Guru Karena inquiry adalah pembelajaran yang terpusat pada siswa. melakukan hubungan pribadi yang baik. Sesungguhnya. maka peranan guru adalah sebagai pembimbing dan sebagai stimulator. mereka akan ³belajar bagaimana belajar´. dan menyarankan suatu alternatif penafsiran terhadap data. Melalui inquiry. Peranan Siswa Peranan siswa dalam pengajaran inquiry adalah sebagai pengambil inisiatif atau prakarsa dalam menemukan sesuatu untuk mereka sendiri. untuk merespon masalah yang diberikan. mengumpulkan dan mengklasifikasi data yang relevan. Mereka aktif menggunakan cara belajar mereka sendiri. Guru menyusun kembali dan mengklarifikasi respon siswa. Inquiry menekankan menemukan sesuatu untuk diri mereka sendiri. Guru tidak menekankan kebenaran jawaban. dan bersamaan dengan itu diperlukan bantuan psycologis. Perhatian utama pada inquiry adalah pengembangan proses mental seperti mengidentifikasi dan menganalisis masalah. Siswa ditingkatkan kemampuannya untuk dapat menemukan sesuatu untuk diri mereka sendiri dengan mengaplikasikan prinsip metode ilmiah inquiry. Guru harus memilikiketrampilan khusus dalam bertanya yang dapat meningkatkan berfikir kritis dan dapat memecahkan masalah. dan membimbing dalam melakukan penyelidikan. Karena itu siswa tidak secara keseluruhan bebas mengluyur sendiri melakukan inquiry. Guru membantu siswa dalam menemukan sumber informasi yang tepat dan bertanggung jawab bahwa sejumlah sumber pengajaran itu cukup dan digunakan.

sifat dan peristiwa. gambar. Sumber ± sumber seperti buku teks. : Pengumpulan data eksperimentasi. SINTAKSIS MODEL INQUIRY Tahap Satu : Menghadapkan pemasalahan. Mengisolasi variabel yang relevan. Penjelasan prosedur inquiry. masalahnya bukan sumber pengajaran apa. film.menyusun tujuan mereka sendiri. perpustakaan dapat digunakan secara efektif untuk penyelidikan inquiry. Hubungan sebab akibat. Sumber pengajaran itu digunakan untuk membuka tabir pertanyaan yang berupa hipotesa. Siswa bebas melakukan eksplorasi. Seringkali. keadaan. Menyampaikan peristiwa peristiwa yang kontradiksi. Peranan siswa tidak hanya merespon pertanyaan yang diajukan guru. Inquiry memerlukan data untuk penafsiran. tetapi bagaimana mereka menggunakan sumber pengajara itu. 5. Penggunaan Sumber Pengajaran Berlawanan seperti apa yang sering dianggap. Dalam pengajaran inquiry seperti halnya dengan model yang lain. Menyusun dan menguji hipotesa. Siswa tidak hanya dievaluasi pada kemampuan mengingat (recall) dan mereproduksi informasi. Tahap Dua Tahap Tiga . bila inquiry digunakan maka evaluasinya didasarkan pada banyak pengetahuan yang dipindahkan. Evaluasi Evaluasi hasil belajar siswa pada model inquiry dipusatkan pada sampai sejauh mana siswa dapat menggunakan ketrampilan intelektual yang berhubungan dengan pengajaran inquiry. film strip. nara sumber. 4. Tetapi inquiry mengutamakan bagaimana siswa itu menghasilkan dan meferivikasi permasalahan. model inquiri tidak memerlukan menggunakan materi pengajaran. tetapi juga mengajukan pertanyaan dan menemukan jawabannya melalui penyelidikan. buku pertanyaan atau anjuran. Tes yang berstandart memusatkan pada pengukuran berfikir kritis dan ketrampilan memecahkan masalah adalah lebih tepat dibandingkan dengan evaluasi yang mendasarkan diri terutama pada penguasaan suatu bidang ilmu. : Pengumpulan data dan verivikasi. dan diberi kesempatan untuk malakukan pemilihan alternatif pemecahan masalah. Memverifikasi benda.

E. Karakteristik Model Inquiry 1. Investigasi  proses melalui koleksi dan mempresentasikan data . dan observasi proses koneksi melalui : konsiliasai. pertanyaan. menemukan hubungan dengan literature. Koneksi    proses koneksi melalui : konsiliasai. pemahaman mereka bagaimana fenomena menggunakan contoh dari pengalaman pribadi. dan observasi proses koneksi melalui : konsiliasai. pertanyaan.Tahap Empat : Mengorganisir. Menyusun aturan atau penjelasan. Desain   Proses desain melalui prosedur materi. Siswa membuat perencanaan mengumpulkan data yang bermakana yang ditujukan pada pertanyaan. dan observasi siswa mampu menghubungkan pengetahuan sains pribadi dengan konsep komunitas sains. Tahap Lima : Analisis Proses inquiry Analisis strategi inquiry dan mengembangkan proses inquiry lebih efektif. pertanyaan. Formulasi dan Penjelasan.  Dilakukan dengan diskusi bersama.  guru memantauketepatanaktifitassiswa 3. Disini terjadi integrasi konsep sains dengan proses sains. 2. eksplorasi fenomena  Guru mendorong untuk mendiskusikan suatu dan menjelaskan bekerja.

 siswadapatmengaplikasikanpemahamannyapadasituasibaru mengembangkaninferensi. dan menjelaskan prosedur pelaksanaan inquiry kepada siswa. yang F. Namun permulaan pelaksanaan inquiry dapat dimulai dengan masalah yanmg sederhana. b. Siswa mengajukan faktor atau unsur yang baru ke dalam permasalahan untuk dapat . generalisasi. Kelima tahap pelaksanaan inquiry adalah sebagai berikut : a. Yang diutamakan dalam hal ini ialah pengalaman proses berfikir secara inquiry. Aplikasi inquiry Salah satu model inquiry yang berangkat dari fakta sampai pada teori. Tahap pertama. konsep yang dilakukan dengan eksperimen akan memberi arti yang lebih bermakna dan mampu berfikir kritis. ide atau pikiran yang sederhana. dan dapat juga berbentuk tekai ± teki. siswa dapat membaca data secara akurat. Tahap kedua. dan akan dijawab oleh guru dengan ³jawaban ya atau tidak´. dan prosesnya dilakukan dengan ³yes and no questions´ yaitu pertanyaan yang diajukan siswa. dan memperjelas hasil penyelidikan. ialah verifikasi.  gurubertukarpendapatterhadappemahamansiswa. 4. guru memberi permasalahan. Dalam memberikan permasalahan dapat berupa peristiwa yang kontradiksi. Ia harus menghubungkan antara interpretasi ilmiah yang diterima. mengorganisasi data dengan cara yang logis dan bermakna. ialah melakukan eksperimentasi. c. adalah latihan inquiry yang dianjurkan oleh Bruce Joyce dan Marsha Weil (1986). teka ± teki yang sederhana yang tidak banyak memerlukan latar belakang pengetahuan tentang teka ± teki tersebut. MembangunPengetahuan   proses melalui reflektif ± konstruksi ± prediksi. Di dalam penjelasan diaturkan tentang tujuan. Tahap ketiga. dengan mengajukan pertanyaan kepada guru sedemikian rupa sehingga guru terpaksa menjawab ³ya atau tidak´. danprediksi. dimana para siswa mengumpulkan data atau informasi tentang peristiwa (masalah) yang telah mereka lihat atau alami.

melihat apakah peristiwa itu dapat terjadi secara berbeda. Dalam proses verifikasi mereka boleh mengajukan pertanyaan tentang : 1) Benda (obyects) 2) Sifat (properties) 3) Kondisi (conditions) 4) Peristiwa (events) d. Prosedur Inquiry Di dalam sistem belajar ± mengajar ini. Tahap ini penting jika kita ingin membuat proses inquiry secara sadar dan secara sistematis mencoba untuk memperbaikinya. Biasanya siswa mendapatkan kesulitan dalam membuat lompatan intelektual. Mereka boleh menentukan bahwa pertanyaan itu efektif atau tidak efektif. namun cara berpikir siswa dan bentuk pertanyaan yang diajukan umumnya berada di antara dua tahap ini. tetapi peserta didik yang diberi peluang . ada informasi yang diperlukan tapi tidak diperoleh. pertanyaan itu produktif atau tidak produktif. Tahap kelima. dari informasi yang komprehen yang mereka kumpulkan menjadi suatu penjelasan yang cukup jelas. guru meminta siswa untuk mengorganisir data dan menyusun suatu penjelasan. Mereka diperkenankan memberi penjelasan yang kurang dengan menghilangkan beberapa bagian yang penting. G. siswa diminta untuk menganalisis proses inquiry. Seringkali ada beberapa teori atau penjelasan yang didasarkan pada data yang sama. Tugas berikutnya dari guru ialah memperdalam proses inquiry siswa dengan memperluas jenis-jenis informasi yang mereka peroleh. Banyak pertanyaan verifikasi dan eksperimen diperlukan hanya untuk meneliti suatu teori. Tahap keempat. yaitu eksplorasi dan menguji langsung. Menguji secara langsung terjadi bila siswa melakukan uji coba teori atau hipotesa. Walaupun tahap kedua dan ketiga terpisah. e. Eksperimen memiliki dua fungsi. tetapi dapat memberi saran untuk suatu teori. Eksplorasi adalah merubah sesuatu untuk melihat apa yang akan terjadi dan tidak perlu bimbingan teori atau hipotesis. guru menyajikan bahan pelajaran tidak dalam bentuknya yang final. Proses merubah hipotesa kedalam eksperimentasi adalah tidak mudah dan memerlukan latihan atau praktek.

Data collection : Untuk menjawab pertanyaan atau membuktikan benar tidaknya hipotesis itu. terbukti atau tidak. Stimulation : Guru mulai dengan bertanya mengajukan mengajukan persoalan. 3. sebanyak mungkin memilihnya yang dipandang paling menarik dan fleksibel untuk dipecahkan. misalnya siswa mengawali dengan belajar bagaimana belajar dan bekerja dengan menggunakan peta dan globe. pertanyaan atau hipotesis yang telah dirumuskan terdahulu itu kemudian dicek. berdasarkan hasil verifikasi tadi siswa belajar menrik generalisasi atau kesimpulan tertentu. mencoba (uji coba) sendiri. . Permasalahan yang dipilih ini selanjutnya harus dirumuskan dalam bentuk pertanyaan atau hipotesis (pernyataan sebagai jawaban sementara atas pertanyaan tersebut). 4. Dibawah ini adalah contoh pembelajaran inquiry tentang ³Peta dan Globe´ pada kelas 3 SD. 2. mewawancarai orang sumber. observasi. apakah terjawab atau. Untuk siswa sekolah dasar pada kelas-kelas rendah dapat juga menggunakan pendekatan inquiry ini melalui pembelajaran-pembelajaran yang sederhana. dengan kata lain. 5. Data processing : Semua informasi (hasil bacaan wawancara. ditabulasikan. 6. Contoh Penerapan inquiry di SD kelas 3 Pembelajaran IPS dengan menggunakan pendekatan inquiry dapat di terapkan pada semua jenjang dan kelas. Verifikation : Berdasarkan hasil pengolahan dan tafsiran atau informasi yang ada tersebut (available information). dan sebagainya. diacak. bahkan kalu perlu dihitung dengan cara tertentu serta ditafsirkan pada tingkat kepercayaan tertentu. Generalization : Tahap selanjutnya. Problem statement : Peserta didik diberi kesempatan untuk mengidentifikasi berbagai permasalahan.. peserta didik diberi kesempatan untuk mengumpulkan berbagai informasi yang relevan. dengan jelas membaca literatur mengamati objeknya.untuk mencari dan menemukan sendiri dengan mempergunakan teknik pendekatan pemecahan masalah. H. diklasifikasikan. Secara garis besar prosedurnya sebagai berikut : 1. dan sebagainya) itu diolah. atau menyuruh peserta didik membaca atau mendengarkan uraian yang memuat permasalahan.

Ini ada di peta? Apa warnanya? (Siswa menjawab: ³biru´) Mari lihat pula Samudra Indonesia. (Pegang bola dinia ini) Coba berikan nama laut ini? (Apabila kamu tidak tahu coba bantu oleh yang lainnya) Baiklah. Mereka mungkin mewarnai bagian/tempat yang ada airnya. dan laut itu? (Siswa menjawab setiap pertanyaan.Tujuan: Pada akhir proses belajar mengajar diharapkan para siswa dapat (1) mengenal simbol-simbol yang ada di dalam peta dan (2) mengemukakan alasan mengapa harus menggunakan simbol yang berbeda-beda.) Tahukah kamu bahwa lautan lebih luas daripada daratan? Orang yang membuat peta dan globe mempunyai kesulitan karena harus dapat meyakinkan orang lain wilayah mana yang berupa daratan dan wilayah mana yang berbentuk lautan. mari kita lihat Laut Jawa. danau. y Tahap 3 Guru: Anggaplah bahwa kita adalah ilmuwan yang akan menguji pendapat siapa yang paling tepat. Kembangkan pertanyaan itu hingga para siswa menyebutkan bahwa semua tempat itu berisi air. Tahap 2 Guru: Bagaimana pembuat globe untuk mengatasi kesulitan ini? Bagaimana pendapatmu tentang cara menunjukkan lokasi perairan? Kemungkinan jawaban siswa: y y Mungkin siswa menuliskan kata ³air´ pada tempat yang ada airnya. Prosedur: Bimbinglah siswa melalui langkah-langkah berikut ini: Tahap 1 Guru: Siapa diantara kamu yang pernah melihat danau? Sungai? Adakah diantara kamu yang pernah melihat laut? Seperti apakah sungai. Apa warnanya? (Siswa menjawab: ³warnanya sama ± biru´) Tahap 4 Beri lagi pertanyaan untuk membuktikan bahwa mereka telah menguasainya. . Mari kita lihat bola dunia ini. Mungkin juga mereka menggambar gelombang pada tempat yang ada airnya. Beri pula dorongan agar mereka bercerita atau menjelaskan apa yang telah mereka ketahui. Inilah ada di peta.

³Menggambarkan gelombang untuk lautan mungkin saja. Guru: Dari apa yang telah kita pelajari. I.) Kesimpulannya: ³Umumnya pada peta dan bola dunia. Karena ada wilayah perairan laut yang sempit sehingga akan sulit menuliskan kata ³air´ pada tempat itu´. Samakah simbol yang dibuat untuk wilayah perairan laut? (Guru dan siswa melihat-lihat peta dan bola dunia lainnya. warna biru digunakan untuk menunjukan perairan´. mengapa pembuat bola dunia memilih cara membuat simbol laut dengan warna biru? Maksud saya.Guru: Berdasarkan informasi yang telah kita diketahui. Pengetahuan dan kecakapan (intelektual potency) peserta didik yang bersangkutan lebih jauh lagi dapat menumbuhkan motif intrinsik (karena peserta didik merasa puas atas penggunannya sendiri). Kelemahan . mudah ditransfer (untuk menghadapi pemecahan masalah). dapatkah kamu mengemukakan simbol wilayah perairan pada peta dan bola dunia (globe)? (Siswa menjawab: ³Wilayah perairan itu digambarkan dengan warna biru´). ³Akan sulit juga menuliskan kata ³air´ untuk menunjukan suatu ³sungai´. Kelebihan dan Kelemahan Inquiry Kelebihan Bahwa hasil belajar dengan cara ini lebih mudah dihafal dan diingat. mengapa mereka tidak menuliskan ³air´ pada tempattempat yang menunjukan lautan atau menggambarkan gelombang? (Para siswa menjawab: ³Apabila pembuat bola dunia itu menuliskan kata µair´ maka ia harus menuliskan kata air beberapa kali´. namun kesulitan untuk sungai´. bagaimana pembuat bola dunia menggambar lautan agar berbeda dengan simbol lainnya? (Siswa menjawab: ³warnanya biru´) Tahukah kamu. Di bawah ini ditampilkan suatu contoh model inquiry untuk siswa SD kelas 6 dengan topik kependudukan.) Tahap 5 Tahap ini adalah kesimpulan dari seluruh pelajaran. Pembelajaran dengan menggunakan pendekatan inquiry di sekolah dasar untuk kelas yang lebih tinggi dapat dengan cara melakukan analisis terhadap suatu data . Selain itu. Marilah kita perhatikan peta dan bola dunia lainnya. pada tahap ini pun dirancang untuk membuat penjelasan umum yang dapat diterapkan dalam situasi lainnya.

kalau kurang terpimpin atau terarah. dapat menjurus pada kekacauan dan kekaburan atas materi yang dipelajarainya. baik secara individu ataupun secara kelompok 3a Siswa tidak banyak berusaha mencari informasi untuk membuktikan praduga . Bagan Penerapan Inquiry Guru memilih tingkah laku/tujuan 1 2 Guru mengajukan pertanyaan yang dapat menumbuhkan siswa menemukan pendapatnya 3 Siswa menetapkan hipotesis /praduga jawaban untuk dikaji lebih lanjut (alternatif jawaban) 4a Secara spontan siswa menjelajahi informasi/data untuk menguji praduga. J.Kelemahan dari inquiry antara lain memakan waktu banyak (time consuming) dan.

Kesimpulan Model pembelajaran inkuiry dapat dilakukan dengan cara. Misalnya manusia diminta mempelajari makna simbol yang terdapat pada mata uang bangsanya. y Inquiry berdasarkan isu ± isu yang kontroversial atau kejadian sekarang. Misalnya adanya protes dari penduduk suatu wilayah tentang pencemaran limbah industri terhadap sumber air penduduk. . mendorong melakukan kegiatan belajar untuk mencari informasi yang diperoleh Inquiry Siswa mengidentifikasi beberapa kemungkinan jawaban/menarik kesimpulan 5 Keterangan : Jalur 1 ± 2 ± 3 ± 4a ± 5 1 ± 2 ± 3 ± 3a ± 4b ± 5 BAB IV PENUTUP A. contoh untuk bentuk ini telah dikemukakan dalam perilaku pemecahan masalah. y Inquiry berdasarkan situasi masalah yang diminta pemecahan.Siswa menarik kesimpulan 4b Guru membantu siswa.cara sebagai beriktu : y Didasarkan pada artefak (artifact) yaitu benda ± benda hasil kepandaian manusia.

Untuk itu misalnya guru dapat mengajukan pertanyaan pada siswa misalnya: 1) Apa hubungan antara gambar atau ilustrasi tersebut dengan materi/konsep yang kita bicarakan ? atau 2) Kapan gambar tersebut dibuat? B. Saran . y Inquiry yang didasarkan pada potret dan ilustrasi. misalnya mempelajari bagaimana kontak dengan budaya lain mempengaruhi cara kehidupan. Gambar dan ilustrasi adalah untuk meningkatkan ketelitian terhadap konsep yang dikemukakan dalam buku teks IPS.y Inquiry yang berdasarkan pada konsep ± konsep yang ditemukan dalam pelajaran. Misalnya kontak ± kontak yang dilakukan oleh suku terasing dengan kelompok masyarakat lain dan pengaruhnya terhadap suku terasing tersebut.