Streptococcus Beta Hemolyticus Grup A

A. Morfologi dan IdentifikasiStreptococcus Streptococcus merupakan bakteri berbentuk bulat atau bulat telur, kadang menyerupai batang, tersusun berderet seperti rantai. Panjang rantai bervariasi dan sebagian besar

ditentukan oleh faktor lingkungan. Rantai akan lebih panjang pada media cair dibanding pada media padat. Pada pertum buhan tua atau bakteri yang mati sifat gram positifnya akan hilang dan menjadi gram negatif . Streptokokus terdiri dari kokus yang berdiameter 0,5 -1 m. Dalam bentuk rantai yang khas,

kokus agak memanjang pada arah sumbu rantai. Streptokokus patogen jika ditanam dalam perbenihan cair atau padat yang cocok sering membentuk rantai panjang yang terdiri dari 8 buah kokus atau lebih. Streptokokus yang menimbulkan infeksi pada manusia

adalah positif gram, tetapi varietas tertentu yang diasingkan dari tinja manusia dan

jaringan binatang ada yang negatif gram. Pada perbenihan yang baru kuman ini positif gram, bila perbenihan telah berumur beberapa hari dapat berubah menjadi negatif gram. Tidak membentuk spora, kecuali beberapa strain yang hidupnya saprofitik. Gerakny a negatif. Strain yang virulen membuat selubung yang mengandung hyaluronic acid dan M type specific protein.

B. Sifat Pertumbuhan Umumnya streptokokus bersifat anaerob fakultatif, hanya

beberapa jenis yangbersifat anaerob obligat. Pada umumnya tekanan O2 harus dikurangi, kecuali untuk enterokokus. Pada perbenihan dalamnya biasa, pertumbuhannya darah kurang atau subur jika Kuman ke ini

tidak

ditambahkan

serum.

tumbuh baik pada pH 7,4 -7,6, suhu optimum untuk pertumbuhan 37oC, pertumbuhannya cepat berkurang pada 40oC.

1

Untuk isolasi primer harus dipakai media yang mengandung darah lengkap. zona tidak ada sel darah bertambah merah yang setelah lebar disimpan dalam peti es. Untuk membedakan hemolisis yang jelas sehingga mudah 2 . Hemolisis tipe beta. Streptococcus pyogenes mudah tumbuh dalam semua enriched media. kol oni tampak sebagai setitik cairan .2 g. Streptokokus membentuk 2 macam koloni. S treptococcus hemolyticus grup A juga sensitif pada cakram basitrasin 0. hemolisis tipe alfa.Streptococcus hemolyticus memfermentasi glukosa dengan membentuk asam laktat yang dapat menghambat pertumbuhannya. c. pada permukaan media. Dalam 0. kuman ini dibagi dalam: a. Berdasarkan sifat hemolitiknya pada lempeng agar darah. membentuk zona bening di sekeliling koloninya. Hemolisis tipe gamma. membentuk warna kehijau -hijauan dan hemolisis dalam sebagian peti es disekeliling zona yang koloninya. pinggir rata. bentuknya bulat. b. mucoid dan glossy. tidak menyebabkan hemolisis. Tumbuhnya diberikan akan bahan subur yang bila dapat diberi glukosa asam berlebih laktat dan yang menetralkan terbentuk. tak masih utuh. sifat ini digunakan untuk membedakan dengan grup lainnya yang resisten terhadap basitrasin.5% meningkatkan daya agar pertumbuh annya terhadap dieram sel pada penurunan lempeng lisisnya darah yang setelah 18-24 jam akan membentuk koloni kecil ke abu -abuan dan agak opalesen. Koloni berbentuk berselubung streptokokus asam ini mucoid dibentuk oleh kuman yang Tes katalasa dengan negatif untuk di hialuronat. paling luar bila akan disimpan berubah menjadi tidak berwarna. serum atautransudat misalnya cairan asites atau pleura. dapat membedakan stafilokokus mana tes katalase positif. Penambahan glukosa dalam tetapi darah 37 0C konsentrasi menyebabkan merah.

susunan saraf pusat. Untukmenyebabkanserangandemamreumatik. baikpadaseranganpertamamaupunseranganulangan.dibeda-bedakan kelinci dan maka dipergunakan tidak boleh darah kuda atau media mengandung glukosa. Pengertian Demam Rematik DemamReumatikatau rheumatic fever merupakan sequelae infeksi streptococcushemolyticus yang paling serius. D. Hubunganetiologisantarakuman dengandemamreumatikadalah sebagaiberikut: Streptococcus faring.jaringan subkutan dan kulit dengan frekuensi yang bervariasi. Streptokokus yang memberikan hemolisis tipe alfa juga disebut streptoccocus viridans . saluran pernafasan Demam rematik terjadi s ebagai sekuele lambat radang non supuratifsistemik yang dapat melibatkan sendi. akibatinteraksiantara penyebabpenyakit (envirotment). Bakteri Streptoccocus beta hemolyticus grup A streptoccocus merupakan penyebab terjadinya penyakit demam rematik . rematik ini biasanya hemoliticus terjadi grup A akibat pada infeksi streptococus bagian atas. C. Etiologi Demam individu reumatikmerupakanpenyakit (house). 3 . sebab dapat Demam beta - mengakibatkan kerusakan pada otot dankatup jantung. Infeksi beta (agent)danfaktorlingkungan Streptococcus hemolyticusgrupApadatenggorok menyebabkanterjadinyademamreuma tik. jantung. StreptokokusgrupAharus menyebabkaninfeksipada bukanhanyakolonisasi superficial. Yang memberikan hemolisis tipe beta disebut streptococcus hemolyticus dan tipe gamma sering disebut sebagai anhemolyticus.

Insidensdemamreumatik tinggibiasanyabersamaandenganinsidensoleh Streptococcus hemolyticusgrupA 3% yang tinggi yang beta pula. FaktorIndividu  FaktorGenetik Didugavariasigenetikmerupakanalasanpentingmengapaha nyasebagianpasien yang terkenainfeksi Streptococcus menderitademamreumatik. Faktor-faktorLingkungan  Keadaansosialekonomi yang buruk Hal ini merupakanfaktorlingkungan 3 tahunatausetelah yang terpentingsebagaipredisposisiun tukterjadinyademamre umatik. 3. Str eptococcus yang FaktorPredisposisi 1. sedangkancarapenuru nannyabelumdapatdipastikan . yang Streptococcus beta -Streptococcus Diperkirakanhanyasekitar dariindividu belumpernahmenderitadem amreumatikakanmenderitakomplika siinisetelahmenderitafaringitis tidakdiobati. rumah-rumahdenganpenghunipadat. 2. 4 . ataukeduanya .  Umur Paling seringterjadi padaumurantara 5-15 8 3 -5 tahundenganpuncaksekitarumur tahun. seperti:sanitasilingkungan yang buruk. Padasebagianbesarkasusdemamreumatikakutterdapatpeningg iankadarantiboditerhadap ataudapatdiisolasikuman hemolyticusgrup A. Seranganulangdemamreumatikakansangatmenurunbilapenderi tamendapatpencegahan yang teraturdenganantibiotika.Tidakbiasaditemukanpadaanakantaraumur tahundansangatjarangsebelumumur 20 tahun. 2.1.

streptolisin S. streptokinase. sehinggainsidensdemamreumatikjugameningkat . E. pendapatan yang rendahsehinggabiayauntukperawatan kesehatankurangdan lain-lain. difosforidinnukleotidase.  IklimdanGeografi Penyakitiniterbanyakdidapatkan daerahberiklimsedang. hialuronidase.Produkproduktersebutmerangsangtimb ulnyaantibodi.  Cuaca Perubahancuaca yang mendadakseringmengakibatkaninsidensinfeksi saluranna fasmeningkat.Demamreumatikdidug a terjadiakibatkepekaantubuh yang berlebihanterhadapbeberapaproduktersebut. Sensitivitassel B antibodimemproduksiantistreptococcus yang membentukimunkompleks. yang terpentingdiantaranyaialahstreptolisin O. lebihtingg idaripada yang didugasemula . Patofisiologi Demamreumatikadalahsuatuhasilresponimunologi abnormal yang disebabkanolehkelompokkumanA beta -hemolitictreptoco ccus yang menyerangpadafaring.rendahnyapendidikansehinggapengertianuntuksegeramen gobatianak yang sakitsangatkurang. tetapi data di akhir pun akhirinimenunjukkanbahwadaerahtropis mempunyaiinsidens yang tinggi. Streptococcus diketahuidapat menghasilkantidakkurangdari 20 prodakekstrasel. deoksiribonukleasesertastreptococcaerythrogenic toxin.Reaksisilangimunkomlekstersebutdengans arcolemakardiakmenimbulkan responperadangan myocardial 5 .

F. ManifestasiKlinis Perjalanan klinis penyakit demam reumatik/penyakit jantung reumatik dapat dibagi dalam 4 stadium: 1. deformitas Pada katup penyakit jantung. Khorea Sydenham 3. Meningkatkan laju endap darah dan C-reaktive protein 5. Bukti adanya infeksi streptococcus beta hemolyticus sebelumnya. yang berupa granuloma perivaskuler yang kecil -kecil yang selanjutnya diganti oleh jaringan parut. Nodulus subkutan 4. Stadium 1 6 . Kriteria untukmenegakkan diagnosis jantung Jones yang telah dimodifikasi adalah : Kriteria mayor 1.Peradanganbiasanyaterjadipadakatup mitral. Eritema marginatum 5. Demamrematikterjadi minggusetelahtidakadapengobatanataupengobatan 2 -6 yang tidaktuntaskarenainfeksisalurannafasatasolehkelompok kumanAbe tahemolytic. ini terdapat danpembentukan badan-badan Aschoff dalam miokardium. Riwayat adanya demam rheuma atau lesi katup rematik Kriteria minor rheuma dari Diagnosis jantung rheuma hampir pasti jika ditemukan 2 kriteria penebalan mayor dan ataulebih. yang manaakanmenjadiskardankerusakanpermanen. Demam 2. Poliartritis migrans 1. Karditis 2.danvalvular. Poliartralgia 3. Perpanjangan P -R interval pada EKG 4. 6.

batuk.Stadium ini berupa infeksi saluran napas bagian atas oleh kuman beta-Streptococcus hemolyticus grup A.Pada stadium inipenderitademamreumatiktanpakelainanjantungataupende ritapenyakitjantungreumatiktanpagejalasisa . Stadium 3 Merupakan berbagai jantung fase akut demam klinik reumatik. 2. 3. 7 . Kelenjar getah bening submandibular seringkali membesar. Pada pemerik saan fisik sering didapatkan eksudat di tonsil yang menyertai tanda-tanda peradangan lainnya. Keluhan biasanya berupa demam. gejala yang timbulsesuaidenganjenissertaberatnyakelainan.Padafasei nibaikpenderitademamreumatikmaupunpenyakitjantungreuma tiksewaktu-waktudapatmengalamireaktivasipenyakitnya . rasa sakit waktu menelan. ialah masa antara infeksi Streptococcus dengan permulaan gejala demam reumatik. biasanya periode ini berlangsung 1 -3 minggu. 4. Stadium 4 Disebutjuga stadium inaktif. demam saat timbulnya manifestasi reumatik. padakatuptidakmenunjukkangejalaapa -apa. Stadium 2 Stadium ini disebut juga periode laten. Infeksi ini biasanya berlangsung 2 -4 hari dan dapat sembuh sendiri tanpa pengobatan. kecuali korea yang dapat timbul 6 minggu atau bahkan berbulan -bulan kemudian. Padapenderitapenyakitjantungreumatikdengan gejalasisake lainankatupjantung. dalam reumatik/penyakit tersebut umum dapat Manifestasi gejala klinik digolongkan peradangan (gejala minor) dan manifestasi spesifik (gejala mayor) demam reumatik/penyakit jantung reumatik. tidak jarang disertai muntah dan bahkan pada anak kecil dapat terjadi diare.

Diagnosa Banding Tidak ada satupun gejala klinis maupun kelainan laboratorium yang khas untuk demam reumatik/penyakit jantung reumatik. Demam Laboratorium 1. disokong adanya adanya 2 bukti infeksi Streptokokus adanya 1 manifestasi mayor atau manifestasi mayor ditambah 2 manifestasi minormenunjukkan kemungkinan besar adanya demam rematik. Bila terdapat kenaikan ya ng bermakna (yang titer ASTO akibat tidak infeksi Streptococcus sebelumnya sebenarnya menyebabkan demam reumatik). Kriteria Jones (Updated 1992) Manifestasi mayor 1. Jika sebelumnya. Poliartritis 3. Karditis 2. Banyak penyakit lain yang mungkin memberi gejala yang sama atau hampir sama dengan demam reumatik /penyakit jantung reumatik. Interval PR memanjang Kemudian Streptokokus ditambah sebelumnya dengan berupa adanya bukti infeksi yang kultur apus tenggorok positip atau tes antigen streptokokus yang cepat atau titer ASTOyang meningkat. Artralgia 2. maka seolah -olah kriteria Jones sudah terpenuhi.Tabel 1. Evaluasi terhadap riwayat infeksi 8 . G. Eritema marginatum 5. KoreaSydenham 4. Peninggian reaksi fase akut(LED meningkat dan atau C reactive protein) 2. Nodulus subkutan Manifestasi mino r Klinis 1. Yang perlu diperhatikan ialah infeksi piogen pada sendi yang sering disertai demam serta reaksi fase akut.

Streptococcus kelainan sendi serta harus pemeriksaan dilakukan yang t eliti cermat terhadap tidak dengan agar terjadi diagnosis berlebihan. Reumatoid artritis serta lupus eritrmatosus sistemik juga dapat memberi gejala ya ng mirip dengan demam reumatik. TABEL DIAGNOSIS BANDING DEMAM REUMATIK DemamReumati AtritisReum Lupus k atoid EritomatosusSi stemik Umur RasioKelamin 5-15 tahun sama 5 tahun Wanita 1. Diagnosis banding lainnya ialah purpura Henoch -Schoenlein. artritis pasca infeksi.5:1 Kelainansendi Sakit Bengkak Kelainan Ro Hebat Non spesifik Tidakada Sedang Non spesifik Sering (lanjut) KelainanKulit Eritemamargi natum Karditis Laboratorium ± 10% ± 10% cepat ± 5% Biasanyalam bat Lambat/ya jarang lanjut Kadang-kadang makular Lesikupu-kupu Biasanyaringan Non spesifik Kadang-kandang 10 tahun Wanita 5:1 Lateks Aglutinasiseldom ba SediaanSel LE Responterhadapsa lisilat 9 . hemoglobinopati. reaksi serum. anemia sel sabit. leukimia dan endokarditis bakterialis sub akut . artritis septik.

bunyijantungmelemahdenganiramaderap diastole y Tanda-tanda vital y Kajiadanyanyeri y Kajiadanyaperadangansendi y Kajiadanyalesipadakulit 10 . Penatalaksanaanperawatan 1. Pemeriksaandiagnostik y y y y y Riwayatadanyainfeksisalurannafasatasdan gejala Positifantistretolysin titer O Positifstretozymepositif anti ujiDNAase B Meningkatnya C-reaktif protein Meningkatnya anti hyaluronidase. aspirin atau penggantinyauntuk 2 -6 minggu.H. J. dan chorea Pilihanpengobatanadalahantibiotikpencillindan anti peradanganmisalnya. gagaljantung. Penatalaksanaanteraupetik y y y Pemberianantibiotik Mengobatigejalaperadangan. meningkatnyasedimenseldarahmerah (eritrosit) y y y Fotorontgenmenunjukkanpembesaranjantung Elektrokardiogrammenunjukkanarrhtythmia E Ehocardiogrammenunjukkanpembesaranjantungdanlesi I. Pengkajian y Riwayatpenyakit y Monitor komplikasijantung (CHF dan arrhythmia) y Auskultasijantung.

2. Intervensi y Orang tuadananakakanmemahamitentang regimen pengobatandanpembatasanaktivitas. Kajikeinginanuntukbermainsesuaidenganusiadankondi si b. pembatasanaktivitas. Pembatasanaktivitassampaimanifestasiklinisdemamre umatiktidakadadanberikanperiodeistirahat. Auskultasibunyijantunguntukmengetahiadanyaperubah anirama b. Implementasi y Mencegahataumendeteksikomplikasi kali atautidakada a. Buatjadualaktivitasdanistirahat 11 . y Anakakanmemperlihatkantidakadanyagejala - gejalasakitmenelanuntukpertama injury 4. y Anaktidakakanmenunjukakan stress yang emosionaldandapatmenggunakanstrategikoping efektif y Anakdapatmenunjukkandalam pengontrolannyerisesuaiting katkesanggupan. y Support anakdalampembatasanaktivitas yang a. Berikanterapibermain sesuaidantidakmembuatlelah. d. Pemberianantibiotiksesuai program c. risikokomplikasijantung y Tidakefektifkopingindividuberhubungandengankondisipe nyakit y Nyeriberhubungandenganpolyartritis y Risiko injury berhubungandenganinfeksi streptococcus 3. Diagnosakeperawatan y Kurangnyapengetahuan orang tua/ anakberhubungandenganpengobatan.

dosis. Monitor temperatursetiap 4 jam selamadirawat. efeksamping. Reposisiuntukmengurangi stress sendi d. Instruksikanuntukmenginformasikanjikaadatandasakitm enelan g. Anakdiistirahatkan 5. Istirahat 2-6 minggu. Jelaskanpentingnyaistirahatdanmembuatjadualistiraha tdanaktivitassampaitanda -tandaklinistidakada. Ajarkanpadaanak/ orang tuabahwapergerakan yang Chorea tidakdisadariadalahdihubungkandengan dantemporer. aktivitas b. peradangandanantipiretiksesuai program c. Lakukandistraksimisalnya. teknikrelaksasidanhayalan. Ajarkanuntukpartisipasidalamaktivitaskebutuhanseh ari-hari d. d. y Mencegahinfeksidan injury anti a. Jelaskanterapi yang diberikan. Berikaninformasitentangkebutuhanaktivitasbermain yang sesuaidenganpembatasan. Perencanaanpemulangan a. Pemberiananalgeik. y Memberikankontrolnyeri yang adekuat a. Berikanterapihangatdandinginpadasendi yang sakit e. Berikan support lingkungan yang aman. b. Tekankanpentingnyakontrolulang. 12 . Lihatjugadalamperencanaanpemulangan d. risikokomplikasijantung e. janganbiarkananaktidur di lantai f. Pemberianantibiotiksesuai program c. bantu segalapemenuhanaktivitaskebutuhansehari -hari c.c. Kajinyeridenganskala b.

Sign up to vote on this title
UsefulNot useful