Streptococcus Beta Hemolyticus Grup A

A. Morfologi dan IdentifikasiStreptococcus Streptococcus merupakan bakteri berbentuk bulat atau bulat telur, kadang menyerupai batang, tersusun berderet seperti rantai. Panjang rantai bervariasi dan sebagian besar

ditentukan oleh faktor lingkungan. Rantai akan lebih panjang pada media cair dibanding pada media padat. Pada pertum buhan tua atau bakteri yang mati sifat gram positifnya akan hilang dan menjadi gram negatif . Streptokokus terdiri dari kokus yang berdiameter 0,5 -1 m. Dalam bentuk rantai yang khas,

kokus agak memanjang pada arah sumbu rantai. Streptokokus patogen jika ditanam dalam perbenihan cair atau padat yang cocok sering membentuk rantai panjang yang terdiri dari 8 buah kokus atau lebih. Streptokokus yang menimbulkan infeksi pada manusia

adalah positif gram, tetapi varietas tertentu yang diasingkan dari tinja manusia dan

jaringan binatang ada yang negatif gram. Pada perbenihan yang baru kuman ini positif gram, bila perbenihan telah berumur beberapa hari dapat berubah menjadi negatif gram. Tidak membentuk spora, kecuali beberapa strain yang hidupnya saprofitik. Gerakny a negatif. Strain yang virulen membuat selubung yang mengandung hyaluronic acid dan M type specific protein.

B. Sifat Pertumbuhan Umumnya streptokokus bersifat anaerob fakultatif, hanya

beberapa jenis yangbersifat anaerob obligat. Pada umumnya tekanan O2 harus dikurangi, kecuali untuk enterokokus. Pada perbenihan dalamnya biasa, pertumbuhannya darah kurang atau subur jika Kuman ke ini

tidak

ditambahkan

serum.

tumbuh baik pada pH 7,4 -7,6, suhu optimum untuk pertumbuhan 37oC, pertumbuhannya cepat berkurang pada 40oC.

1

Streptococcus hemolyticus memfermentasi glukosa dengan membentuk asam laktat yang dapat menghambat pertumbuhannya. kol oni tampak sebagai setitik cairan . membentuk zona bening di sekeliling koloninya. S treptococcus hemolyticus grup A juga sensitif pada cakram basitrasin 0. kuman ini dibagi dalam: a. c. Untuk membedakan hemolisis yang jelas sehingga mudah 2 . Untuk isolasi primer harus dipakai media yang mengandung darah lengkap. Hemolisis tipe gamma. serum atautransudat misalnya cairan asites atau pleura. Penambahan glukosa dalam tetapi darah 37 0C konsentrasi menyebabkan merah. Koloni berbentuk berselubung streptokokus asam ini mucoid dibentuk oleh kuman yang Tes katalasa dengan negatif untuk di hialuronat. Streptokokus membentuk 2 macam koloni. paling luar bila akan disimpan berubah menjadi tidak berwarna. dapat membedakan stafilokokus mana tes katalase positif. Berdasarkan sifat hemolitiknya pada lempeng agar darah. pada permukaan media. sifat ini digunakan untuk membedakan dengan grup lainnya yang resisten terhadap basitrasin. b.2 g. Hemolisis tipe beta. zona tidak ada sel darah bertambah merah yang setelah lebar disimpan dalam peti es. Streptococcus pyogenes mudah tumbuh dalam semua enriched media. Tumbuhnya diberikan akan bahan subur yang bila dapat diberi glukosa asam berlebih laktat dan yang menetralkan terbentuk. hemolisis tipe alfa. tak masih utuh. bentuknya bulat.5% meningkatkan daya agar pertumbuh annya terhadap dieram sel pada penurunan lempeng lisisnya darah yang setelah 18-24 jam akan membentuk koloni kecil ke abu -abuan dan agak opalesen. pinggir rata. mucoid dan glossy. tidak menyebabkan hemolisis. Dalam 0. membentuk warna kehijau -hijauan dan hemolisis dalam sebagian peti es disekeliling zona yang koloninya.

Yang memberikan hemolisis tipe beta disebut streptococcus hemolyticus dan tipe gamma sering disebut sebagai anhemolyticus. Pengertian Demam Rematik DemamReumatikatau rheumatic fever merupakan sequelae infeksi streptococcushemolyticus yang paling serius. Hubunganetiologisantarakuman dengandemamreumatikadalah sebagaiberikut: Streptococcus faring. Untukmenyebabkanserangandemamreumatik. sebab dapat Demam beta - mengakibatkan kerusakan pada otot dankatup jantung. C. susunan saraf pusat. D. Etiologi Demam individu reumatikmerupakanpenyakit (house). rematik ini biasanya hemoliticus terjadi grup A akibat pada infeksi streptococus bagian atas. baikpadaseranganpertamamaupunseranganulangan. Infeksi beta (agent)danfaktorlingkungan Streptococcus hemolyticusgrupApadatenggorok menyebabkanterjadinyademamreuma tik. 3 . akibatinteraksiantara penyebabpenyakit (envirotment). saluran pernafasan Demam rematik terjadi s ebagai sekuele lambat radang non supuratifsistemik yang dapat melibatkan sendi. Bakteri Streptoccocus beta hemolyticus grup A streptoccocus merupakan penyebab terjadinya penyakit demam rematik .dibeda-bedakan kelinci dan maka dipergunakan tidak boleh darah kuda atau media mengandung glukosa. Streptokokus yang memberikan hemolisis tipe alfa juga disebut streptoccocus viridans . jantung.jaringan subkutan dan kulit dengan frekuensi yang bervariasi. StreptokokusgrupAharus menyebabkaninfeksipada bukanhanyakolonisasi superficial.

Str eptococcus yang FaktorPredisposisi 1. Insidensdemamreumatik tinggibiasanyabersamaandenganinsidensoleh Streptococcus hemolyticusgrupA 3% yang tinggi yang beta pula.Tidakbiasaditemukanpadaanakantaraumur tahundansangatjarangsebelumumur 20 tahun. 4 . yang Streptococcus beta -Streptococcus Diperkirakanhanyasekitar dariindividu belumpernahmenderitadem amreumatikakanmenderitakomplika siinisetelahmenderitafaringitis tidakdiobati. 2. 3.1. FaktorIndividu  FaktorGenetik Didugavariasigenetikmerupakanalasanpentingmengapaha nyasebagianpasien yang terkenainfeksi Streptococcus menderitademamreumatik. Padasebagianbesarkasusdemamreumatikakutterdapatpeningg iankadarantiboditerhadap ataudapatdiisolasikuman hemolyticusgrup A. Faktor-faktorLingkungan  Keadaansosialekonomi yang buruk Hal ini merupakanfaktorlingkungan 3 tahunatausetelah yang terpentingsebagaipredisposisiun tukterjadinyademamre umatik. seperti:sanitasilingkungan yang buruk. Seranganulangdemamreumatikakansangatmenurunbilapenderi tamendapatpencegahan yang teraturdenganantibiotika. ataukeduanya . sedangkancarapenuru nannyabelumdapatdipastikan . rumah-rumahdenganpenghunipadat.  Umur Paling seringterjadi padaumurantara 5-15 8 3 -5 tahundenganpuncaksekitarumur tahun. 2.

yang terpentingdiantaranyaialahstreptolisin O.Produkproduktersebutmerangsangtimb ulnyaantibodi. lebihtingg idaripada yang didugasemula . streptokinase. tetapi data di akhir pun akhirinimenunjukkanbahwadaerahtropis mempunyaiinsidens yang tinggi. streptolisin S. hialuronidase.  IklimdanGeografi Penyakitiniterbanyakdidapatkan daerahberiklimsedang. sehinggainsidensdemamreumatikjugameningkat . difosforidinnukleotidase.Reaksisilangimunkomlekstersebutdengans arcolemakardiakmenimbulkan responperadangan myocardial 5 . Patofisiologi Demamreumatikadalahsuatuhasilresponimunologi abnormal yang disebabkanolehkelompokkumanA beta -hemolitictreptoco ccus yang menyerangpadafaring.rendahnyapendidikansehinggapengertianuntuksegeramen gobatianak yang sakitsangatkurang.  Cuaca Perubahancuaca yang mendadakseringmengakibatkaninsidensinfeksi saluranna fasmeningkat. pendapatan yang rendahsehinggabiayauntukperawatan kesehatankurangdan lain-lain. E. Sensitivitassel B antibodimemproduksiantistreptococcus yang membentukimunkompleks. deoksiribonukleasesertastreptococcaerythrogenic toxin. Streptococcus diketahuidapat menghasilkantidakkurangdari 20 prodakekstrasel.Demamreumatikdidug a terjadiakibatkepekaantubuh yang berlebihanterhadapbeberapaproduktersebut.

ini terdapat danpembentukan badan-badan Aschoff dalam miokardium.Peradanganbiasanyaterjadipadakatup mitral. Poliartralgia 3. Khorea Sydenham 3. Karditis 2. 6. F. deformitas Pada katup penyakit jantung. yang berupa granuloma perivaskuler yang kecil -kecil yang selanjutnya diganti oleh jaringan parut. Eritema marginatum 5. ManifestasiKlinis Perjalanan klinis penyakit demam reumatik/penyakit jantung reumatik dapat dibagi dalam 4 stadium: 1. Stadium 1 6 . Meningkatkan laju endap darah dan C-reaktive protein 5. yang manaakanmenjadiskardankerusakanpermanen. Demamrematikterjadi minggusetelahtidakadapengobatanataupengobatan 2 -6 yang tidaktuntaskarenainfeksisalurannafasatasolehkelompok kumanAbe tahemolytic. Bukti adanya infeksi streptococcus beta hemolyticus sebelumnya.danvalvular. Perpanjangan P -R interval pada EKG 4. Demam 2. Riwayat adanya demam rheuma atau lesi katup rematik Kriteria minor rheuma dari Diagnosis jantung rheuma hampir pasti jika ditemukan 2 kriteria penebalan mayor dan ataulebih. Kriteria untukmenegakkan diagnosis jantung Jones yang telah dimodifikasi adalah : Kriteria mayor 1. Poliartritis migrans 1. Nodulus subkutan 4.

Infeksi ini biasanya berlangsung 2 -4 hari dan dapat sembuh sendiri tanpa pengobatan. 3. ialah masa antara infeksi Streptococcus dengan permulaan gejala demam reumatik. tidak jarang disertai muntah dan bahkan pada anak kecil dapat terjadi diare. kecuali korea yang dapat timbul 6 minggu atau bahkan berbulan -bulan kemudian.Padafasei nibaikpenderitademamreumatikmaupunpenyakitjantungreuma tiksewaktu-waktudapatmengalamireaktivasipenyakitnya . biasanya periode ini berlangsung 1 -3 minggu. rasa sakit waktu menelan. 4. dalam reumatik/penyakit tersebut umum dapat Manifestasi gejala klinik digolongkan peradangan (gejala minor) dan manifestasi spesifik (gejala mayor) demam reumatik/penyakit jantung reumatik. padakatuptidakmenunjukkangejalaapa -apa. Padapenderitapenyakitjantungreumatikdengan gejalasisake lainankatupjantung.Pada stadium inipenderitademamreumatiktanpakelainanjantungataupende ritapenyakitjantungreumatiktanpagejalasisa . 2. Stadium 4 Disebutjuga stadium inaktif. gejala yang timbulsesuaidenganjenissertaberatnyakelainan. Kelenjar getah bening submandibular seringkali membesar. Stadium 2 Stadium ini disebut juga periode laten. 7 . Pada pemerik saan fisik sering didapatkan eksudat di tonsil yang menyertai tanda-tanda peradangan lainnya. Stadium 3 Merupakan berbagai jantung fase akut demam klinik reumatik.Stadium ini berupa infeksi saluran napas bagian atas oleh kuman beta-Streptococcus hemolyticus grup A. Keluhan biasanya berupa demam. demam saat timbulnya manifestasi reumatik. batuk.

Eritema marginatum 5. Evaluasi terhadap riwayat infeksi 8 . Bila terdapat kenaikan ya ng bermakna (yang titer ASTO akibat tidak infeksi Streptococcus sebelumnya sebenarnya menyebabkan demam reumatik). disokong adanya adanya 2 bukti infeksi Streptokokus adanya 1 manifestasi mayor atau manifestasi mayor ditambah 2 manifestasi minormenunjukkan kemungkinan besar adanya demam rematik. Diagnosa Banding Tidak ada satupun gejala klinis maupun kelainan laboratorium yang khas untuk demam reumatik/penyakit jantung reumatik. Nodulus subkutan Manifestasi mino r Klinis 1. Peninggian reaksi fase akut(LED meningkat dan atau C reactive protein) 2. Artralgia 2. maka seolah -olah kriteria Jones sudah terpenuhi. Interval PR memanjang Kemudian Streptokokus ditambah sebelumnya dengan berupa adanya bukti infeksi yang kultur apus tenggorok positip atau tes antigen streptokokus yang cepat atau titer ASTOyang meningkat. Yang perlu diperhatikan ialah infeksi piogen pada sendi yang sering disertai demam serta reaksi fase akut. Kriteria Jones (Updated 1992) Manifestasi mayor 1. Poliartritis 3.Tabel 1. KoreaSydenham 4. G. Banyak penyakit lain yang mungkin memberi gejala yang sama atau hampir sama dengan demam reumatik /penyakit jantung reumatik. Demam Laboratorium 1. Karditis 2. Jika sebelumnya.

Streptococcus kelainan sendi serta harus pemeriksaan dilakukan yang t eliti cermat terhadap tidak dengan agar terjadi diagnosis berlebihan. anemia sel sabit.5:1 Kelainansendi Sakit Bengkak Kelainan Ro Hebat Non spesifik Tidakada Sedang Non spesifik Sering (lanjut) KelainanKulit Eritemamargi natum Karditis Laboratorium ± 10% ± 10% cepat ± 5% Biasanyalam bat Lambat/ya jarang lanjut Kadang-kadang makular Lesikupu-kupu Biasanyaringan Non spesifik Kadang-kandang 10 tahun Wanita 5:1 Lateks Aglutinasiseldom ba SediaanSel LE Responterhadapsa lisilat 9 . Diagnosis banding lainnya ialah purpura Henoch -Schoenlein. leukimia dan endokarditis bakterialis sub akut . artritis pasca infeksi. artritis septik. hemoglobinopati. Reumatoid artritis serta lupus eritrmatosus sistemik juga dapat memberi gejala ya ng mirip dengan demam reumatik. TABEL DIAGNOSIS BANDING DEMAM REUMATIK DemamReumati AtritisReum Lupus k atoid EritomatosusSi stemik Umur RasioKelamin 5-15 tahun sama 5 tahun Wanita 1. reaksi serum.

H. Penatalaksanaanteraupetik y y y Pemberianantibiotik Mengobatigejalaperadangan. Penatalaksanaanperawatan 1. Pengkajian y Riwayatpenyakit y Monitor komplikasijantung (CHF dan arrhythmia) y Auskultasijantung. bunyijantungmelemahdenganiramaderap diastole y Tanda-tanda vital y Kajiadanyanyeri y Kajiadanyaperadangansendi y Kajiadanyalesipadakulit 10 . J. gagaljantung. meningkatnyasedimenseldarahmerah (eritrosit) y y y Fotorontgenmenunjukkanpembesaranjantung Elektrokardiogrammenunjukkanarrhtythmia E Ehocardiogrammenunjukkanpembesaranjantungdanlesi I. aspirin atau penggantinyauntuk 2 -6 minggu. dan chorea Pilihanpengobatanadalahantibiotikpencillindan anti peradanganmisalnya. Pemeriksaandiagnostik y y y y y Riwayatadanyainfeksisalurannafasatasdan gejala Positifantistretolysin titer O Positifstretozymepositif anti ujiDNAase B Meningkatnya C-reaktif protein Meningkatnya anti hyaluronidase.

Kajikeinginanuntukbermainsesuaidenganusiadankondi si b. Pembatasanaktivitassampaimanifestasiklinisdemamre umatiktidakadadanberikanperiodeistirahat. Pemberianantibiotiksesuai program c. Buatjadualaktivitasdanistirahat 11 . Diagnosakeperawatan y Kurangnyapengetahuan orang tua/ anakberhubungandenganpengobatan. y Anakakanmemperlihatkantidakadanyagejala - gejalasakitmenelanuntukpertama injury 4. Auskultasibunyijantunguntukmengetahiadanyaperubah anirama b. pembatasanaktivitas. d. y Anaktidakakanmenunjukakan stress yang emosionaldandapatmenggunakanstrategikoping efektif y Anakdapatmenunjukkandalam pengontrolannyerisesuaiting katkesanggupan. y Support anakdalampembatasanaktivitas yang a. Berikanterapibermain sesuaidantidakmembuatlelah.2. Intervensi y Orang tuadananakakanmemahamitentang regimen pengobatandanpembatasanaktivitas. Implementasi y Mencegahataumendeteksikomplikasi kali atautidakada a. risikokomplikasijantung y Tidakefektifkopingindividuberhubungandengankondisipe nyakit y Nyeriberhubungandenganpolyartritis y Risiko injury berhubungandenganinfeksi streptococcus 3.

Istirahat 2-6 minggu. Kajinyeridenganskala b. Berikaninformasitentangkebutuhanaktivitasbermain yang sesuaidenganpembatasan. dosis. Jelaskanterapi yang diberikan. janganbiarkananaktidur di lantai f. Instruksikanuntukmenginformasikanjikaadatandasakitm enelan g. Pemberiananalgeik. Ajarkanpadaanak/ orang tuabahwapergerakan yang Chorea tidakdisadariadalahdihubungkandengan dantemporer. Tekankanpentingnyakontrolulang. Perencanaanpemulangan a. Lihatjugadalamperencanaanpemulangan d. y Mencegahinfeksidan injury anti a. d. Jelaskanpentingnyaistirahatdanmembuatjadualistiraha tdanaktivitassampaitanda -tandaklinistidakada. Anakdiistirahatkan 5. Ajarkanuntukpartisipasidalamaktivitaskebutuhanseh ari-hari d. efeksamping. Reposisiuntukmengurangi stress sendi d. risikokomplikasijantung e. Lakukandistraksimisalnya. 12 . teknikrelaksasidanhayalan. bantu segalapemenuhanaktivitaskebutuhansehari -hari c. peradangandanantipiretiksesuai program c.c. Pemberianantibiotiksesuai program c. aktivitas b. b. Monitor temperatursetiap 4 jam selamadirawat. Berikanterapihangatdandinginpadasendi yang sakit e. y Memberikankontrolnyeri yang adekuat a. Berikan support lingkungan yang aman.

Sign up to vote on this title
UsefulNot useful