PAPER

NYERI

Disusun oleh : Ghariza Puspa Dinia G1A208023

Dokter Penguji : dr. Johny H. P. Silalahi, Sp.B, FinaCS

BAGIAN ILMU BEDAH RSUD PROF. DR. MARGONO SOEKARJO FAKULTAS KEDOKTERAN DAN ILMU-ILMU KESEHATAN JURUSAN KEDOKTERAN PURWOKERTO 2010

LEMBAR PENGESAHAN

PAPER

NYERI
Disusun sebagai tugas dalam ujian mayor stase Bedah di Bagian Bedah RSUD Prof. Dr. Margono Soekarjo Purwokerto Fakultas Kedokteran dan Ilmu-Ilmu Kesehatan Universitas Jenderal Soedirman Purwokerto

Disusun oleh : Ghariza Puspa Dinia G1A208023

Disetujui dan Disahkan, Pada tanggal, Oktober 2010

Dokter Penguji,

dr. Johny H. P. Silalahi, Sp. B, FinaCS

dan pada daerah viseral. karena letaknya yang berbeda-beda inilah. nyeri adalah sensori subyektif dan emosional yang tidak menyenangkan yang didapat terkait dengan kerusakan jaringan aktual maupun potensial. FISIOLOGI NYERI Reseptor nyeri adalah organ tubuh yang berfungsi untuk menerima rangsang nyeri. DEFINISI NYERI Nyeri didefinisikan sebagai suatu keadaan yang mempengaruhi seseorang dan ekstensinya diketahui bila seseorang pernah mengalaminya (Tamsuri. nyeri yang timbul juga memiliki sensasi yang berbeda. Reseptor nyeri disebut juga nosireceptor. Berdasarkan letaknya. II. Nosireceptor kutaneus berasal dari kulit dan sub kutan. a. atau menggambarkan kondisi terjadinya kerusakan. somatik dalam (deep somatic). Organ tubuh yang berperan sebagai reseptor nyeri adalah ujung syaraf bebas dalam kulit yang berespon hanya terhadap stimulus kuat yang secara potensial merusak. 2007. nosireseptor dapat dikelompokkan dalam beberapa bagaian tubuh yaitu pada kulit (Kutaneus). Reseptor jaringan kulit (kutaneus) terbagi dalam dua komponen yaitu : . secara anatomis reseptor nyeri (nosireceptor) ada yang bermielien dan ada juga yang tidak bermielin dari syaraf perifer.I. Menurut International Association for Study of Pain (IASP). nyeri yang berasal dari daerah ini biasanya mudah untuk dialokasi dan didefinisikan.

Pada nyeri nosiseptif. Banyak teori berusaha untuk menjelaskan dasar neurologis dari nyeri. iskemia dan inflamasi. fase pertamanya adalah transduksi.5 m/det) yang terdapat pada daerah yang lebih dalam. nyeri yang timbul merupakan nyeri yang tumpul dan sulit dilokalisasi. Struktur reseptor nyeri somatik dalam meliputi reseptor nyeri yang terdapat pada tulang. ginjal dan sebagainya. Serabut C. c. Karena struktur reseptornya komplek. merupakan serabut komponen cepat (kecepatan tranmisi 6-30 m/det) yang memungkinkan timbulnya nyeri tajam yang akan cepat hilang apabila penyebab nyeri dihilangkan. b. usus. otot. maka perlu mempelajari 3 (tiga) komponen fisiologis berikut ini: Resepsi : proses perjalanan nyeri Persepsi : kesadaran seseorang terhadap nyeri Reaksi : respon fisiologis & perilaku setelah mempersepsikan nyeri Fisiologi Nyeri : 1. nyeri biasanya bersifat tumpul dan sulit dilokalisasi. Reseptor A delta. dan jaringan penyangga lainnya. 2. Transduksi adalah proses dimana stimulus noksius àaktivitas elektrik reseptor terkait. syaraf. merupakan serabut komponen lambat (kecepatan tranmisi 0. . tetapi sangat sensitif terhadap penekanan. Untuk memudahkan memahami fisiologi nyeri. hati.1. Nyeri yang timbul pada reseptor ini biasanya tidak sensitif terhadap pemotongan organ. Reseptor nyeri jenis ketiga adalah reseptor viseral. reseptor ini meliputi organ-organ viseral seperti jantung. meskipun tidak ada satu teori yang menjelaskan secara sempurna bagaimana nyeri ditransmisikan atau diserap. pembuluh darah.

konversi stimulus yang intens apakah itu stimuli kimiawi seperti pH rendah yang terjadi pada jaringan yang meradang . atau proses ini. stimulus panas diatas 420C. atau kekuatan mekanis. tidak dipengaruhi oleh penghambat enzim COX-2. membuat depolarisasi membran dan mengaktifkan terminal perifer. . Proses ini tidak melibatkan prostanoid atau produksi prostaglandin oleh siklo -oksigenase. Disini didapati adanya protein transducer spesifik yang diekspresikan dalam neuron nosiseptif ini dan mengkonversi stimulus noksious menjadi aliran yang menembus membran. sehingga nyeri ini.

Prostaglandin E 2 termasuk dalam golongan metabotropik.2. Jaras ini diaktifkan oleh stress atau obat analgetika seperti morfin (Dewanto). Pada fase modulasi . Ada dua jenis transmisi saraf : a) Ionotropik dimana mediator bekerja langsung pada pintu ion ke dalam sel. Yang terakhir hubungan timbal balik antara thalamus dan cortex. Trauma mekanik rupa-rupanya langsung merusak integritas membran dan tergolong ionotropik . Suatu jaras tertentu telah diteruskan di sistem saran pusat yang secara selektif menghambat transmisi nyeri di medulla spinalis. Ciri jenis transmisi itu adalah (i) proses berlangsung cepat dan (ii) masa proses singkat. tetapi obat-obat ini menghambat hiperalgesia ² bekerjanya juga lambat dan berlangsung lama. Hiperalgesia karena prostaglandin E 2 terjadi lambat tapi berlangsung lama. kecuali bila kerusakan yang ditimbulkannya hebat tentu rasa nyeri dapat berlangsung lama. Rasa nyeri timbul cepat dan berlangsung singkat. b) Metabotropik dimana mediator bekerja lewat perubahan biokimia pada membrane post-sinaps. 3. Transmisi. dari medulla spinalis ke batang otak dan thalamus. dalam proses ini terlibat tiga komponen saraf yaitu saraf sensorik perifer yang meneruskan impuls ke medulla spinalis. bersama bradykinin. Morfin dan obat-opiat lainnya juga masuk golongan metabotropik. Modulasi yaitu aktivitas saraf utk mengontrol transmisi nyeri. Ciri transmisi cara ini adalah (i) lambat dan (ii) berlangsung lama. kemudian jaringan saraf yang meneruskan impuls yang menuju ke atas (ascendens).

dan morfologi dari sirkuit yang termasuk koneksi antara periaqueductal gray matter dan nucleus raphe magnus dan formasi retikuler sekitar dan menuju ke medulla spinalis. Persepsi.Opiat endogen . pada saat individu menjadi sadar akan adanya suatu nyeri. Konsep dari system ini yaitu berdasarkan dari suatu sifat. maka akan terjadi suatu reak si yang kompleks. fisiologik.terdapat suatu interaksi dengan system inhibisi dari transmisi nosisepsi berupa suatu analgesic endogen.Serotonergik . Fase ini merupakan titik kesadaran seseorang terhadap nyeri. Proses modulasi ini dipengaruhi oleh kepribadian. Analgesik endogen meliputi : . status emosional & kultur seseorang. Persepsi ini menyadarkan individu dan mengartikan nyeri itu sehingga kemudian individu itu dapat bereaksi. 4. motivasi. . pendidikan. bahkan struktur otak yang menimbulkan persepsi tersebut juga tidak jelas. kornu posterior diibaratkan sebagai pintu gerbang yang dapat tertutup adalah terbuka dalam menyalurkan input nyeri. Proses impuls nyeri yang ditransmisikan hingga menimbulkan perasaan subyektif dari nyeri sama sekali belum jelas. Sangat disayangkan karena nyeri secara mendasar merupakan pengalaman subyektif sehingga tidak terhindarkan keterbatasan untuk memahaminya (Dewanto).Noradrenergik (Norepinephric) Sistem analgesik endogen ini memiliki kemampuan menekan input nyeri di kornu posterior dan proses desendern yang dikontrol oleh otak seseorang.

Sinyal ini kemudian dilanjutkan ke area limbik. Neuron delta-A dan C melepaskan substansi C melepaskan substansi P untuk mentranmisi impuls melalui mekanisme pertahanan. Sampai saat ini dikenal berbagai teori yang mencoba menjelaskan bagaimana nyeri dapat timbul. namun teori gerbang kendali nyeri dianggap paling relevan (Tamsuri. yang lebih cepat yang melepaskan neurotransmiter penghambat. Suatu keseimbangan aktivitas dari neuron sensori dan serabut kontrol desenden dari otak mengatur proses pertahanan. Upaya menutup pertahanan tersebut merupakan dasar teori menghilangkan nyeri. III. Area ini yang akan memproses reaksi emosi terhadap suatu nyeri. Area ini mengandung sel sel yang bisa mengatur emosi. Apabila masukan yang dominan berasal dari serabut beta-A. 2007) Teori gate control dari Melzack dan Wall (1965) mengusulkan bahwa impuls nyeri dapat diatur atau dihambat oleh mekanisme pertahanan di sepanjang sistem saraf pusat. Diyakini mekanisme penutupan ini dapat terlihat saat . sensasi nyeri memasuki pusat kesadaran dan afek. maka akan menutup mekanisme pertahanan. Proses ini berlangsung sangat cepat sehingga suatu stimulus nyeri dapat segera menghasilkan emosi. terdapat mekanoreseptor. Teori ini mengatakan bahwa impuls nyeri dihantarkan saat sebuah pertahanan dibuka dan impuls dihambat saat sebuah pertahanan tertutup. Selain itu. neuron beta-A yang lebih tebal.Fase ini dimulai pada saat dimana nosiseptor telah mengirimkan sinyal pada formatio reticularis dan thalamus. TEORI PENGONTROLAN NYERI (GATE CONTROL THEORY) Terdapat berbagai teori yang berusaha menggambarkan bagaimana nosireseptor dapat menghasilkan rangsang nyeri.

RESPON TERHADAP NYERI Individu yang mengalami nyeri dengan awitan mendadak dapat bereaksi sangat berbeda terhadap nyeri yang berlangsung selama beberapa menit atau menjadi kronis. maka akan membuka pertahanan tersebut dan klien mempersepsikan sensasi nyeri.seorang perawat menggosok punggung klien dengan lembut. suatu pembunuh nyeri alami yang berasal dari tubuh. Neuromedulator ini menutup mekanisme pertahanan dengan menghambat pelepasan substansi P. Fase antisipasi (terjadi sebelum nyeri diterima) Fase ini mungkin bukan merupakan fase yg paling penting. terutama dalam memberikan informasi pada klien. Bahkan jika impuls nyeri dihantarkan ke otak. tehnik distraksi. Nyeri dapat menyebabkan keletihan dan membuat individu terlalu letih untuk merintih atau menangis. . Peran perawat dalam fase ini sangat penting. seperti endorfin dan dinorfin. apabila masukan yang dominan berasal dari serabut delta A dan serabut C. Pada fase ini memungkinkan seseorang belajar tentang nyeri dan upaya untuk menghilangkan nyeri tersebut. bahkan dengan nyeri hebat. karena fase ini bisa mempengaruhi dua fase lain. 2005). konseling dan pemberian plasebo merupakan upaya untuk melepaskan endorfin (Potter. Pesan yang dihasilkan akan menstimulasi mekanoreseptor. Alur saraf desenden melepaskan opiat endogen. terdapat pusat kortek yang lebih tinggi di otak yang memodifikasi nyeri. Meinhart & McCaffery mendiskripsikan 3 fase pengalaman nyeri: a. Pasien dapat tampak rileks dan terlibat dalam aktivitas karena menjadi mahir dalam mengalihkan perhatian terhadap nyeri. IV. Pasien dapat tidur.

Kasus-kasus seperti itu tentunya membutuhkan bantuan perawat untuk membantu klien mengkomunikasikan nyeri secara efektif. vokalisasi dan gerakan tubuh. c. Fase sensasi (terjadi saat nyeri terasa) Fase ini terjadi ketika klien merasakan nyeri. sebelum nyeri datang. Toleraransi terhadap nyeri juga akan berbeda antara satu orang dengan orang lain. Ekspresi yang ditunjukan klien itulah yang digunakan perawat untuk mengenali pola perilaku yang menunjukkan nyeri. sebaliknya orang yang toleransi terhadap nyerinya rendah sudah mencari upaya mencegah nyeri. Kadar endorfin berbeda tiap individu. mulai dari ekspresi wajah. orang yang mempunyai tingkat toleransi tinggi terhadap nyeri tidak akan mengeluh nyeri dengan stimulus kecil. Keberadaan enkefalin dan endorfin membantu menjelaskan bagaimana orang yang berbeda merasakan tingkat nyeri dari stimulus yang sama. individu dengan endorfin tinggi sedikit merasakan nyeri dan individu dengan sedikit endorfin merasakan nyeri lebih besar. maka tiap orang dalam menyikapi nyeri juga berbeda-beda. Fase akibat (terjadi ketika nyeri berkurang atau berhenti) . karena nyeri itu bersifat subyektif.b. Klien bisa mengungkapkan nyerinya dengan berbagai jalan. Klien dengan tingkat toleransi tinggi terhadap nyeri mampu menahan nyeri tanpa bantuan. Perawat harus melakukan pengkajian secara teliti apabila klien sedikit mengekspresikan nyerinya. karena belum tentu orang yang tidak mengekspresikan nyeri itu tidak mengalami nyeri. sebaliknya orang yang toleransi terhadap nyerinya rendah akan mudah merasa nyeri dengan stimulus nyeri kecil.

maka respon akibat (aftermath) dapat menjadi masalah kesehatan yang berat. Pemahaman dan pemberian arti nyeri sangat dipengaruhi tingkat pengetahuan. sehingga dimungkinkan klien mengalami gejala sisa pasca nyeri. Pada fase ini klien masih membutuhkan kontrol dari perawat. karena nyeri bersifat krisis.Fase ini terjadi saat nyeri sudah berkurang atau hilang. pengalaman masa lalu dan juga faktor sosial budaya. persepsi. Arti nyeri bagi setiap individu berbedabeda antara lain : 1) Bahaya atau merusak 2) Komplikasi seperti infeksi 3) Penyakit yang berulang 4) Penyakit baru 5) Penyakit yang fatal 6) Peningkatan ketidakmampuan 7) Kehilangan mobilitas 8) Menjadi tua 9) Sembuh 10) Perlu untuk penyembuhan 11) Hukuman untuk berdosa . Apabila klien mengalami episode nyeri berulang. Respon Psikologis Respon psikologis sangat berkaitan dengan pemahaman klien terhadap nyeri yang terjadi atau arti nyeri bagi klien. Perawat berperan dalam membantu memperoleh kontrol diri untuk meminimalkan rasa takut akan kemungkinan nyeri berulang. A.

Mendengkur) . dan superficial) a) Dilatasi saluran bronkhial dan peningkatan respirasi rate b) Peningkatan heart rate c) Vasokonstriksi perifer. Sesak Nafas. moderat. Stimulasi Simpatik:(nyeri ringan. peningkatan BP d) Peningkatan nilai gula darah e) Diaphoresis f) Peningkatan kekuatan otot g) Dilatasi pupil h) Penurunan motilitas GI 2.12) Tantangan 13) Penghargaan terhadap penderitaan orang lain 14) Sesuatu yang harus ditoleransi 15) Bebas dari tanggung jawab yang tidak dikehendaki B. Respon Tingkah Laku Terhadap Nyeri 1) Respon perilaku terhadap nyeri dapat mencakup: 2) Pernyataan verbal (Mengaduh. Stimulus Parasimpatik (nyeri berat dan dalam) a) Muka pucat b) Otot mengeras c) Penurunan heart rate dan tekanan darah d) Nafas cepat dan irreguler e) Nausea dan vomitus f) Kelelahan dan keletihan C. Menangis. Respon Fisiologis Terhadap Nyeri 1.

Pada orang dewasa kadang melaporkan nyeri jika sudah patologis dan mengalami kerusakan fungsi. Faktor Yang Mempengaruhi Respon Nyeri 1) Usia Anak belum bisa mengungkapkan nyeri. peningkatan gerakan jari & tangan 5) Kontak dengan orang lain/interaksi sosial (Menghindari percakapan. Imobilisasi. Menghindari kontak sosial. 3) Kultur Orang belajar dari budayanya. Ketegangan otot. karena mereka mengangnggap nyeri adalah hal alamiah yang harus dijalani dan mereka takut kalau mengalami penyakit berat atau meninggal jika nyeri diperiksakan.3) Ekspresi wajah (Meringis. . sehingga perawat harus mengkaji respon nyeri pada anak. bagaimana seharusnya mereka berespon terhadap nyeri misalnya seperti suatu daerah menganut kepercayaan bahwa nyeri adalah akibat yang harus diterima karena mereka melakukan kesalahan. Menggigit bibir) 4) Gerakan tubuh (Gelisah. Penurunan rentang perhatian. 2) Jenis kelamin Gill (1990) mengungkapkan laki-laki dan wnita tidak berbeda secara signifikan dalam merespon nyeri. Menggeletukkan gigi. justru lebih dipengaruhi faktor budaya (ex: tidak pantas kalo laki-laki mengeluh nyeri. wanita boleh mengeluh nyeri). Fokus pd aktivitas menghilangkan nyeri) D. jadi mereka tidak mengeluh jika ada nyeri. Pada lansia cenderung memendam nyeri yang dialami.

perhatian yang meningkat dihubungkan dengan nyeri yang meningkat. Mudah tidaknya seseorang mengatasi nyeri tergantung pengalaman di masa lalu dalam mengatasi nyeri. Tehnik relaksasi. maka ia akan lebih mudah mengatasi nyerinya. Menurut Gill (1990).4) Makna nyeri Berhubungan dengan bagaimana pengalaman seseorang terhadap nyeri dan dan bagaimana mengatasinya. dan saat ini nyeri yang sama timbul. guided imagery merupakan tehnik untuk mengatasi nyeri. 7) Pengalaman masa lalu Seseorang yang pernah berhasil mengatasi nyeri dimasa lampau. 6) Ansietas Cemas meningkatkan persepsi terhadap nyeri dan nyeri bisa menyebabkan seseorang cemas. 9) Support keluarga dan sosial Individu yang mengalami nyeri seringkali bergantung kepada anggota keluarga atau teman dekat untuk memperoleh dukungan dan perlindungan . sedangkan upaya distraksi dihubungkan dengan respon nyeri yang menurun. 5) Perhatian Tingkat seorang klien memfokuskan perhatiannya pada nyeri dapat mempengaruhi persepsi nyeri. 8) Pola koping Pola koping adaptif akan mempermudah seseorang mengatasi nyeri dan sebaliknya pola koping yang maladaptive akan menyulitkan seseorang mengatasi nyeri.

Skala Identitas Nyeri Numerik c. Skala Anal Visual . pengukuran dengan tehnik ini juga tidak dapat memberikan gambaran pasti tentang nyeri itu sendiri (Tamsuri. Menurut Smelt er. Skala Intensitas Nyeri Deskritif . INTENSIT S NYE I Int nsit s nyeri adalah gambaran tentang seberapa parah nyeri dirasakan oleh indi idu.V. Namun. Pengukuran nyeri dengan a pendekatan objekti yang paling mungkin adalah menggunakan respon fisiologik tubuh terhadap nyeri itu sendiri.G (2002) adalah sebagai berikut : a. 2007). S. pengukuran intensitas nyeri sangat subjekti dan indi idual dan kemungkinan nyeri dalam intensitas yang sama dirasakan sangat berbeda oleh dua orang yang berbeda oleh du orang yang berbeda.C bare B.

menyeringai. dapat mendeskripsikannya. dapat menunjukkan lokasi nyeri.d. memukul. Skala Nyeri Menurut B urbanis Keterangan : 0 :Tidak nyeri 1-3 : Nyeri ringan : secara obyektif klien dapat berkomunikasi dengan baik. 7-9 : Nyeri berat : secara obyektif klien terkadang tidak dapat mengikuti perintah tapi masih respon terhadap tindakan. Karakteristik paling subyektif pada nyeri adlah tingkat keparahan atau intensitas nyeri tersebut. Klien seringkali diminta untuk mendeskripsikan nyeri . 4-6 : Nyeri sedang : Secara obyektif klien mendesis. dapat mengikuti perintah dengan baik. dapat menunjukkan lokasi nyeri. tidak dapat diatasi dengan alih posisi nafas panjang dan distraksi 10 : Nyeri sangat berat : Pasien sudah tidak mampu lagi berkomunikasi. tidak dapat mendeskripsikannya.

klien menilai nyeri dengan menggunakan skala 0-10. maka direkomendasikan patokan 10 cm (AHCPR. NRS) lebih digunakan sebagai pengganti alat pendeskripsi kata. Alat VDS ini memungkinkan klien memilih sebuah kategori untuk mendeskripsikan nyeri. VDS) merupakan sebuah garis yang terdiri dari tiga sampai lima kata pendeskripsi yang tersusun dengan jarak yang sama di sepanjang garis. VAS dapat merupakan pengukuran keparahan nyeri yang lebih sensitif karena klien dapat . Apabila digunakan skala untuk menilai nyeri. Skala deskritif merupakan alat pengukuran tingkat keparahan nyeri yang lebih obyektif. Skala analog visual (Visual analog scale. Skala paling efektif digunakan saat mengkaji intensitas nyeri sebelum dan setelah intervensi terapeutik. Skala ini memberi klien kebebasan penuh untuk mengidentifikasi keparahan nyeri. Perawat juga menanyakan seberapa jauh nyeri terasa paling menyakitkan dan seberapa jauh nyeri terasa paling tidak menyakitkan.sebagai yang ringan. Dalam hal ini. Perawat menunjukkan klien skala tersebut dan meminta klien untuk memilih intensitas nyeri trbaru yang ia rasakan. 1992). Dari waktu ke waktu informasi jenis ini juga sulit untuk dipastikan. VAS adalah suatu garis lurus. Pendeskripsi ini diranking dari ³tidak terasa nyeri´ sampai ³nyeri yang tidak tertahankan´. Skala pendeskripsi verbal (Verbal Descriptor Scale. sedang atau parah. Skala penilaian numerik (Numerical rating scales. makna istilah-istilah ini berbeda bagi perawat dan klien. yang mewakili intensitas nyeri yang terus menerus dan pendeskripsi verbal pada setiap ujungnya. VAS) tidak melebel subdivisi. Namun.

VI. Nyeri yang dirasakan pendek. itulah nyeri jaras cepat dari nocireseptor mekanik dan thermal. tajam. dan mudah dilokalisasi. Itulah jaras nyeri lambat. Perawat dapat menggunakan setelah terapi atau saat gejala menjadi lebih memburuk atau menilai apakah nyeri mengalami penurunan atau peningkatan (Potter. tapi juga. Perasaan ini akan diikuti dengan sakit yang tumpul. Sinyal yang berasal dari nocireseptor mekanik dan thermal akan ditransmisikan melalui serat A -delta dengan kecepatan 30 m/s (jaras nyeri cepat). Skala nyeri harus dirancang sehingga skala tersebut mudah digunakan dan tidak mengkomsumsi banyak waktu saat klien melengkapinya.mengidentifikasi setiap titik pada rangkaian dari pada dipaksa memilih satu kata atau satu angka (Potter. menusuk. Impuls dari plimodal akan melalui serat C yang tidak bermielin. akan terasa nyeri yang berdenyut awalnya yang kemudian akan muncul rasa tidak sakit yang tidak enak. Skala deskritif bermanfaat bukan saja dalam upaya mengkaji tingkat keparahan nyeri. KATEGORI NYERI A. mengevaluasi perubahan kondisi klien. dengan kecepatan 12m/s (jaras pelan). Apabila klien dapat membaca dan memahami skala. maka deskripsi nyeri akan lebih akurat. 2005). 2005). yang diaktivasi oleh bradikinin. sukar dilokalisasi dan bertahan untuk waktu yang relatif lama dan lebih tidak enak. Serat Nyeri Fast dan Slow Ada dua cara impuls diteruskan ke CNS. Saat terisis atau terbakar. . Kimia yang berperan dalam proses peradangan ini juga bisa menyebabkan nyeri yang berlanjut meski telah dilakukan penghilangan stimulus termal dan mekanis.

Nyeri Akut dan Nyeri Kronik 1. disebut nyeri somatik superfisial sedangkan stimulasi reseptor di otot tulang. Traktus spinotalamikus untuk rasa nyeri cepat. dan fascia menyebabkan nyeri somatik dalam. Nyeri Akut Nyeri akut tidak berlangsung lama dan biasanya hilang saat perbaikan tubuh. Misalnya batu ginjal yang mungkin menyebabkan nyeri berat dengan menghambat atau menggelembungkan ureter atau saluran empedu. atau bahkan di daerah permukaan yang jauh dari organ tersebut. Jika nyeri visceral tersebut diffuse. serat sensorik dari jantung. nyeri yang dirasakan di kulit atau di kulit bagian dalam yang ada di atas organ yang distimulasi. Serabut rasa nyeri cepat tipe A terutama dilalui oleh rasa nyeri mekanik dan rasa nyeri suhu akut. Serabut ini berakhir pada lamina I (lamina marginalis) pada kornu dorsalis dan merangsang neuron pengantar kedua dari traktus neospinotalamikus. kulit di atas jantung. Misalnya. Neuron ini akan mengirimkan sinyal ke serabut .B. dan di sepanjang aspek medial lengan kiri akan masuk spinal cord segmen T1 sampai T5. Nyeri visceral dihasilkan dari stimulasi nocireseptor di organ visceral. tendon. D. Itulah yang dinamakan referred pain. Nyeri Superficial dan Deep Nyeri yang muncul dari stimulasi reseptor di kulit. ada kemungkinan itu tanda bahaya karena mungkin disebabkan oleh ischemia organ dalam. nyeri pada serangan jantung dirasakan di kulit di atas jantung serta di sepanjang lengan kiri. Referred Pain Pada beberapa contoh nyeri visceral. C. sendi. Oleh karena itu.

2. Jaras paleosinoltalamikus adalah sistem yang menjalarkan rasa nyeri terutama dari serabut tipe C lambat-kronik perifer. Ada beberapa serabut yang berakhir di kelompok nuklear posterior. Glutamat merupakan substansi neurotransmitter yang disekresikan di medulla spinalis pada ujung-ujung serabut saraf nyeri tipe A . sakit kronis dapat menyebabkan rendah diri. Kadang-kadang. tetapi sebagian besar melewati semua jalur ke talamus tanpa hambatan. Nyeri kronik Sakit kronis merupakan nyeri yang masih muncul bahkan lama setelah tubuh Anda telah sembuh. sinyal akan dijalarkan ke daerah lain pada basal otak seperti juga ke korteks somatosensorik. Dalam jaras ini.panjang yang terletak di dekat sisi lain medula spinalis dalam komisura anterior dan selanjutnya berbelok naik ke otak dalam kolumna anterolateralis. depresi dan kemarahan. walaupun jaras ini menjalarkan beberapa sinyal dari serabut tipe A juga. nyeri ini sering muncul pada kondisi seperti radang sendi. Biasanya memiliki masa kerja yang berlangsung hanya beberapa milidetik. . fibromyalgia dan kanker. Dari daerah talamus ini. Hal ini juga dapat mengganggu aktivitas harian. berakhir di kompleks ventro-basal di sepanjang kolumna dorsalis-traktus lemniskus medialis untuk sensasi raba. orang yang memiliki sakit kronis tidak tahu apa penyebabnya. Namun. Beberapa serabut neospinotalamikus berakhir di daerah retikularis batang otak. Seiring dengan rasa tidak nyaman.

kemudian naik ke otak dalam jaras anterolateral. atau (3) daerah periakueduktus substansia grisea. serabut-serabut ini kebanyakan berakhir di satu dari tiga derah berikut: (1) nukleus retikularis medula. karena hewan yang otaknya mengalami pemotongan di atas mesensefalon . Jaras paleosinotalamikus lambat-kronik berakhir secara luas dalam batang otak. sepertinya telah jelas kalau glutamat berperan dalam menjalarkan rasa nyeri cepat ke dalam sistem saraf pusat. Sebagian besar sinyal kemudian melewati satu atau lebih neuron serabut pendek tambahan di dalam kornu dorsalisnya sebelum terutama memasuki lamina A . yang mula-mula melewati komisura anterior ke sisi berlawanan dari medula spinalis. Walaupun secara terperinci belum diketahui. neuron-neuron berakhir dalam rangkaian merangsang akson-akson panjang yang sebagian besar menyambungkan serabut-serabut dari jaras rsa nyeri cepat.serabut-serabut perifer berakhir di dalam medula spinalis hampir di seluruhnya di lamina II dan III kornu dorsalis. Namun demikian. pons. dan substansi P berhubungan dengan rasa nyeri lambat kronik. juga di kornu dorsalis. Daerah yang lebih rendah dari batang otak ini tampatknya penting untuk merasakan rasa nyeri . dan mesensefalon (2) area tektal dari mesensefalon dalam sampai kolikuli superior dan inferior. Percobaan penelitian menunjukkan bahwa ujung serabut nyeri tipe C yang memasuki medula spinalis mungkin mengeluarkan transmiter glutamat dan transmiter substansi P. yang bersama-sama disebut substansia gelatinosa. Substansi P dilepaskan lebih lambat. Di sini. Hanya sepersepuluh sampai seperempat serabut yang melewati seluruh jalur ke talamus. yang mengelilingi aqueduktus sylvii.

atau cedera tulang belakang. Saraf tersebut adalah semua saraf selain yang ada di otak dan urat saraf tulang belakang (perifer berarti jauh dari pusat). disfungsional. akan menghilang setelah cedera telah sembuh. Nyeri otot disebabkan oleh cedera fisik. sindrom carpal tunnel. banyak neuron berserabut pendek yang memancarkan sinyal nyeri naik ke intralaminar dan nukleus ventrolateral dari talamus dan ke dalam bagian tertentu hipotalamus dan daerah basal lain dari otak. kanker dan perawatan nya.untuk menghambat semua sinyal rasa nyeri dalam mencapai serebrum masih menunjukkan dengan jelas bukti-bukti yang tidak dapat disangkal dari rasa nyeri batang otak. orang merasa tidak nyaman dengan gejala yang digambarkan sebagai kesemutan atau seperti ditusuk paku dan jarum atau gejala nyeri lebih seperti membakar. herpes zoster.8 Nyeri neuropatik merupakan keadaan kompleks nyeri kronis yang biasanya disertai dengan cedera jaringan. Akibatnya. Dampak dari cedera serabut saraf meliputi perubahan dalam fungsi syaraf baik. Nyeri Neuropati Neuropati perifer (peripheral neuropathy/PN) adalah penyakit pada saraf perifer. atau cedera. serat-serat saraf sendiri mungkin rusak. Nyeri saraf dapat dikaitkan dengan sejumlah kondisi medis seperti diabetes. di tempat cedera dan daerah sekitar cedera. Dengan nyeri neuropatik. seperti terjatuh. Di sisi . Rasa geli dan sensasi terbakar nyeri saraf sangat berbeda dari rasa sakit dan nyeri yang dirasakan dari nyeri otot. E. Serat saraf yang rusak ini mengirim sinyal yang salah ke pusat-pusat rasa sakit lain.

dan obat-obatan. Fascia. sesorang bisa mengurangi rasa penderitaan dan meningkatkan kualitas hidupnya. Nyeri Muskuloskeletal Otot merupakan jaringan yang peka nyeri terhadap tekanan.lain. Misal trauma atau karena tindakan. Manifestasi inflamasi muskuloskeletal : bengkak . Sumber nyeri kronik tidak sederhana. nyeri saraf yang mungkin tidak disebabkan oleh trauma. Nyeri pada fraktur merupakan hasil dari stimulus pada jaringan. Dengan selalu aktif. tendon dan periosteum merupakan jaringan peka yeri terhadap tusukan. nyeri saraf dapat menyebar dari kaki bawah ke atas atau naik ke lengan dari tangan. Tidak ada obat untuk saraf rusak yang menyebabkan rasa sakit saraf. Nyeri muskuloskeletal harus dipastikan apakah nyerinya karena inflamasi atau bukan. F. Tetapi dengan program manajemen nyeri yang efektif yang mungkin mencakup latihan. Nyeri kronik dibedakan berdasarkan karena proses inflamasi (kelompok penyakit rematik) dan non inflamasi. Ada masalah psikologis yang disebabkan oleh masalah fisik. Sejalan dengan waktu. sering menghasilkan rasa sakit terus-menerus atau rutin.tulang kompakta adalah kurang peka nyeri. Nyeri akut karena rangsang nosisepsi akut yang lebih jelas. Perlu dicoba banyak metode. Over-the-counter-pain seringkali tidak cukup kuat untuk membuat nyeri saraf pergi. sayatan dan zat kimia. tekanan dan zat kimia iritatif sedangkan tulang. Ini adalah alasan mengapa memilih salah satu perawatan ini tidak dianjurkan. rasa sakit dapat dikurangi.jaringan tersebut. manajemen stres.

- nyeri kemerahan panas. Sulit dibedakan karena inflamasi atau bukan. Kadang disebut sebagai nyeri muskuloskleletal primer atau idiopatik. anxietas. dan kekakuan Nyeri muskuloskeletal kronik non inflamasi terutama yang lebih dari 3 bulan berhubungan dengan gangguan psikologis : depresi. . gangguan tingkah laku.

Neuropathic http://www. (2000).php?lino=555. Diunduh dari http://www. 12th ed. Perawatan Nyeri. Tamsuri. Jakarta : EGC hal : 87. (2007).nlm. p.gov/medlineplus/pain.DAFTAR PUSTAKA American Chronic Pain Ascociation. Many Causes http://www. Tortora GJ. Motor and Integrative System.org/conditionDetail. (2005). Ramali. Asia: Willey. Chronic Pain. Konsep dan penatalaksanaan nyeri.html NLM NIH. Perifer. pemenuhan aktivitas istirahat. Jakarta : EGC.nih. Priharjo. Jakarta : Djambatan.id/li/bacali. Pain. Derrickson BH. Pain. 7th ed. Jakarta: EGC. A. Diunduh dari Diunduh dari Family Doctor. A. Proses dan Praktik. Human Physiology: The Peripheral Nervous System.theacpa. Hlm 1-63 Potter.org/online/famdocen/home/common/pain/disorders/551. Diunduh dari http://familydoctor.or. of Pain.2009. 191-2. Kamus Kedokteran : Arti dan Keterangan Istilah. p. Diunduh dari . 574-5 Yayasan Spiritia. Sherwood L. Principles of Anatomy and Physiology: Sensory.html.paintreatmentblog.aspx?id=29.com/pain. Canada: Brooks/Cole.printer view. Fundamental Keperawatan Konsep. Anonymous.2010. R (1993). Hlm 1502-1533. Neuropati http://spiritia.