IV E

S NEGERI SE MA ITA RS

N RA

UN

G

UNNES

PENDIDIKAN DAN LATIHAN PROFESI GURU (PLPG) SERTIFIKASI GURU DALAM JABATAN TAHUN 2008

TEKNIK ELEKTRO
(SMK)

PANITIA SERTIFIKASI GURU RAYON XII UNIVERSITAS NEGERI SEMARANG TAHUN 2008

REKTOR NEGERISEMARANG UNIVERSITAS SAMBUTAN REKTOR

As s alamu' alailstm Warahmatutlahi Wab arakatuh Salam sejahtera untuk kita semua. Puji syukur tidak putus selalu kami panjatkan kepada Tuhan Yang Maha Esa, dzat yang maha tinggi, atas rakhmat dan ilmuNya yang diturunkan kepada umat manusia. Sertifikasi guru sebagai upaya peningkatan mutu guru yang diikuti dengan peningkatan kesejahteraan guru, diharapkan dapat meningkatkan mutu pembelajaran yang pada akhirnya meningkatkan mutu pendidikan di Indonesia secara berkelanjutan. Sesuai dengan Peraturan Menteri Pendidikan Nasional No. 18 Tahun 2OO7, sertifikasi bagi guru dalam jabatan dilaksanakan

pelaksanaan uji melalui portofolio.

Berdasarkan prosedur pelaksanaan portofolio, bagi peserta yang belum dinyatakan lulus, LP|K Rayon merekomendasikan alternatif : (1) melakukan kegiatan mandiri untuk melengkapi kekurangan dokumen portofolio atau (2) mengikuti Pendidikan dan Pelatihan Profesi Guru ( PLPG ) yang diakhiri dengan ujian. Penyelenggaraan PLPG telah distandardisasikan oleh Konsorsium Sertilikasi Guru ( KSG ) Jakarta dalam bentuk pedoman PLPG secara Nasional. Berbagai upaya telah dilakukan oleh Panitia Sertifikasi Guru ( PSG ) Rayon 12 dalam rangka standardisasi penyelenggaraan PLPG mulai penyediaan tempat, ruang kelas, jumlah jam, sistem penilaian, kualitas instruktur dan ketersediaan bahan ajar. Bahan ajar yang ada di tangan Saudara ini salah satu upaya PSG Rayon 12 dalam memenuhi

standard pelaksanaan PLPG secara nasional untuk itu saya menyambut dengan baik atas terbitnya Bahan Ajar PLPG ini. Sukses PLPG tidak hanya tergantung ketersediaan buku, kualitas instruktur, sarana prasarana yang disediakan namun lebih daripada itu dengan baik sejak adalah kesiapan peserta baik mental maupun fisik, untuk itu harapan saya para peserta PLPG telah menyiapkannya keberangkatannya dari rumah masing-masing. Pada kesempatan ini ijinkan saya, memberikan penghargaan yang tinggi kepada Dosen/lnstruktur yang telah berkontribusi dan berusaha men)rusun buku ini, agar dapat membantu guru menempuh program PLPG dalam rangka sertihkasi guru. Buku ini menggunakan pilihan bahasa yang sederhana dan mudah dipahami sehingga pembaca dapat menikmatinya dengan seksama. Akhirnya kepada khalayak pembaca saya ucapkan selamat menikmati buku ini, semoga dapat memperoleh manfaat yang sebanyakbanyaknya.

Rektor Universitas Negeri Semarang

Sudijono Sastroatmodjo

BUKU AJAR

PENGEMBANGAN PROFESIONALITAS GURU

PENDAHULUAN
Fakta tentang kualitas guru menunjukkan bahwa sedikitnya 50 persen guru di Indonesia tidak memiliki kualitas sesuai standardisasi pendidikan nasional (SPN). Berdasarkan catatan Human Development Index (HDI), fakta ini menunjukkan bahwa mutu guru di Indonesia belum memadai untuk melakukan perubahan yang sifatnya mendasar pada pelaksanaan kurikulum berbasis kompetensi (KBK). Dari data statistik HDI terdapat 60% guru SD, 40% SMP, 43% SMA, 34% SMK dianggap belum layak untuk mengajar di jenjang masing-masing. Selain itu, 17,2% guru atau setara dengan 69.477 guru mengajar bukan pada bidang studinya. Dengan demikian, kualitas SDM guru kita adalah urutan 109 dari 179 negara di dunia. Untuk itu, perlu dibangun landasan kuat untuk meningkatkan kualitas guru dengan standardisasi rata-rata bukan standardisasi minimal (Toharudin 2006:1). Pernyataan ini juga diperkuat oleh Rektor UNJ sebagai berikut. "Saat ini baru 50 persen dari guru se-Indonesia yang memiliki standardisasi dan kompetensi. Kondisi seperti ini masih dirasa kurang. Sehingga kualitas pendidikan kita belum menunjukkan peningkatan yang signifikan," (Sutjipto dalam Jurnalnet, 16/10/2005). Fakta lain yang diungkap oleh Ditjen Peningkatan Mutu Pendidik dan Tenaga Kependidikan, Dr. Fasli Djalal, bahwa sejumlah guru mendapatkan nilai nol untuk materi mata pelajaran yang sesungguhnya mereka ajarkan kepada murid-muridnya. Fakta itu terungkap berdasarkan ujian kompetensi yang dilakukan terhadap tenaga kependidikan tahun 2004 lalu. Secara nasional, penguasaan materi pelajaran oleh guru ternyata tidak mencapai 50 persen dari seluruh materi keilmuan yang harus menjadi kompetensi guru. Beliau juga mengatakan skor mentah yang diperoleh guru untuk semua jenis pelajaran juga memprihatinkan. Guru PPKN, sejarah, bahasa Indonesia, bahasa Inggris, matematika, fisika, biologi, kimia, ekonomi, sosiologi, geografi, dan pendidikan seni

1-2

Pengembangan Profesionalitas Guru

hanya mendapatkan skor sekitar 20-an dengan rentang antara 13 hingga 23 dari 40 soal. "Artinya, rata-rata nilai yang diperoleh adalah 30 hingga 46 untuk skor nilai tertinggi 100," (Tempo Interaktif, 5 Januari 2006). Mengacu pada data kasar kondisi guru saat ini tentulah kita sangat prihatin dengan buruknya kompetensi guru itu. Padahal, memasuki tahun 2006 tuntutan minimal kepada siswa untuk memenuhi syarat kelulusan harus menguasai 42,5 persen. Untuk itu, layak kiranya pada tulisan ini dicari format bagaimanakah seharusnya mengembangkan guru yang profesional?

A. Guru sebagai Profesi Djojonegoro (1998:350) menyatakan bahwa profesionalisme dalam suatu pekerjaan atau jabatan ditentukan oleh tiga faktor penting, yaitu: (1) memiliki keahlian khusus yang dipersiapkan oleh program pendidikan keahlian atau spesilaisasi, (2) kemampuan untuk

memperbaiki kemampuan (keterampilan dan keahlian khusus) yang dimiliki, (3) penghasilan yang memadai sebagai imbalan terhadap keahlian yang dimiliki itu. Menurut Vollmer & Mills (1991:4) profesi adalah sebuah pekerjaan/jabatan yang memerlukan kemampuan intelektual khusus, yang diperoleh melalui kegiatan belajar dan pelatihan untuk menguasai keterampilan atau keahlian dalam melayani atau memberikan advis pada orang lain dengan memperoleh upah atau gaji dalam jumlah tertentu. Usman (1990:4) mengatakan bahwa guru merupakan suatu profesi yang artinya suatu jabatan atau pekerjaan yang memerlukan keahlian khusus sebagai guru. Suatu profesi memiliki persyaratan tertentu, yaitu: (1) menuntut adanya keterampilan yang mendasarkan pada konsep dan teori ilmu pengetahuan yang mendasar, (2) menekankan pada suatu keahlian dalam bidang tertentu sesuai dengan profesinya, (3) menuntut tingkat pendidikan yang memadai, (4) menuntut adanya kepekaan terhadap dampak kemasyarakatan dari

Pengembangan Profesionalitas Guru

1-3

pekerjaan yang dilaksanakan, (5) memungkinkan perkembangan sejalan dengan dinamika kehidupan, (6) memiliki kode etik sebagai acuan dalam melaksanakan tugas dan fungsinya, (7) memiliki obyek tetap seperti dokter dengan pasiennya, guru dengan siswanya, dan (8) diakui di masyarakat karena memang diperlukan jasanya di

masyarakat. Pengertian di atas menunjukkan bahwa unsur-unsur terpenting dalam sebuah profesi adalah penguasaan sejumlah kompetensi sebagai keahlian khusus, yang diperoleh melalui pendidikan dan pelatihan khusus, untuk melaksanakan pembelajaran secara efektif dan efisien. Kompetensi guru berkaitan dengan profesionalisme adalah guru yang kompeten (memiliki kemampuan) di bidangnya. Karena itu kompetensi profesionalisme guru dapat diartikan sebagai kemampuan memiliki keahlian dan kewenangan dalam menjalankan profesi keguruan.

B. Kompetensi Guru Sejalan dengan uraian pengertian kompetensi guru di atas, Sahertian (1990:4) mengatakan kompetensi adalah pemilikan,

penguasaan, keterampilan dan kemampuan yang dituntut jabatan seseorang. Oleh sebab itu seorang calon guru agar menguasai kompetensi guru dengan mengikuti pendidikan khusus yang

diselenggarakan oleh LPTK. Kompetensi guru untuk melaksanakan kewenangan profesionalnya, mencakup tiga komponen sebagai berikut: (1) kemampuan kognitif, yakni kemampuan guru menguasai pengetahuan serta keterampilan/keahlian kependidikan dan

pengatahuan materi bidang studi yang diajarkan, (2) kemampuan afektif, yakni kemampuan yang meliputi seluruh fenomena perasaan dan emosi serta sikap-sikap tertentu terhadap diri sendiri dan orang lain, (3) kemampuan psikomotor, yakni kemampuan yang berkaitan dengan keterampilan atau kecakapan yang bersifat jasmaniah yang

1-4

Pengembangan Profesionalitas Guru

pelaksanaannya pengajar.

berhubungan

dengan

tugas-tugasnya

sebagai

Dalam UU Guru dan Dosen disebutkan bahwa kompetensi guru mencakup kompetensi pedagogik, kepribadian, profesional dan sosial sesuai dengan Standar Nasional Pendidikan yang diperoleh melalui pendidikan profesi guru setelah program sarjana atau D4. Kompetensi pribadi meliputi: (1) pengembangan kepribadian, (2) berinteraksi dan berkomunikasi, (3) melaksanakan bimbingan dan penyuluhan, (4) melaksanakan administrasi sekolah, (5) melaksanakan tulisan sederhana untuk keperluan pengajaran.

1. Kompetensi Profesional Profesi adalah suatu jabatan atau pekerjaan yang menuntut keahlian (expertise) para anggotanya. Artinya pekerjaan itu tidak bisa dilakukan oleh sembarang orang yang tidak terlatih dan tidak disiapkan secara khusus untuk melakukan pekerjaan itu. Profesional menunjuk pada dua hal, yaitu (1) orang yang menyandang profesi, (2) penampilan seseorang dalam melakukan pekerjaan sesuai dengan profesinya (seperti misalnya dokter). Makmum (1996: 82) menyatakan bahwa teacher performance diartikan kinerja guru atau hasil kerja atau penampilan kerja. Secara konseptual dan umum penampilan kerja guru itu mencakup aspekaspek; (1) kemampuan profesional, (2) kemampuan sosial, dan (3) kemampuan personal. Johnson (dalam Sanusi, 1991:36) menyatakan bahwa standar umum itu sering dijabarkan sebagai berikut; (1) kemampuan profesional mencakup, (a) penguasaan materi pelajaran, (b)

penguasaan penghayatan atas landasan dan wawasan kependidikan dan keguruan, dan (c) penguasaan proses-proses pendidikan. (2) kemampuan sosial mencakup kemampuan untuk menyesuaikan diri kepada tuntutan kerja dan lingkungan sekitar pada waktu

Pengembangan Profesionalitas Guru

1-5

membawakan tugasnya sebagai guru. (3) kemampuan personal (pribadi) yang beraspek afektif mencakup, (a) penampilan sikap positif terhadap keseluruhan tugas sebagai guru, (b) pemahaman,

penghayatan, dan penampilan nilai-nilai yang seyogyanya dianut oleh seorang guru, dan (c) penampilan untuk menjadikan dirinya sebagai panutan dan keteladanan bagi peserta didik.

2. Kompetensi Kepribadian Kompetensi kepribadian menurut Suparno (2002:47) adalah mencakup kepribadian yang utuh, berbudi luhur, jujur, dewasa, beriman, bermoral; kemampuan mengaktualisasikan diri seperti disiplin, tanggung jawab, peka, objekti, luwes, berwawasan luas, dapat berkomunikasi dengan orang lain; kemampuan mengembangkan profesi seperti berpikir kreatif, kritis, reflektif, mau belajar sepanjang hayat, dapat ambil keputusan dll. (Depdiknas,2001). Kemampuan kepribadian lebih menyangkut jati diri seorang guru sebagai pribadi yang baik, tanggung jawab, terbuka, dan terus mau belajar untuk maju. Yang pertama ditekankan adalah guru itu bermoral dan beriman. Hal ini jelas merupakan kompetensi yang sangat penting karena salah satu tugas guru adalah membantu anak didik yang bertaqwa dan beriman serta menjadi anak yang baik. Bila guru sendiri tidak beriman kepada Tuhan dan tidak bermoral, maka menjadi sulit untuk dapat membantu anak didik beriman dan bermoral. Bila guru tidak percaya akan Allah, maka proses membantu anak didik percaya akan lebih sulit. Disini guru perlu menjadi teladan dalam beriman dan bertaqwa. Pernah terjadi seorang guru beragama berbuat skandal sex dengan muridnya, sehingga para murid yang lain tidak percaya kepadanya lagi. Para murid tidak dapat mengerti bahwa seorang guru yang mengajarkan moral, justru ia sendiri tidak bermoral. Syukurlah guru itu akhirnya dipecat dari sekolah.

1-6

Pengembangan Profesionalitas Guru

Yang kedua, guru harus mempunyai aktualisasi diri yang tinggi. Aktualisasi diri yang sangat penting adalah sikap bertanggungjawab. Seluruh tugas pendidikan dan bantuan kepada anak didik memerlukan tanggungjawab yang besar. Pendidikan yang menyangkut

perkembangan anak didik tidak dapat dilakukan seenaknya, tetapi perlu direncanakan, perlu dikembangkan dan perlu dilakukan dengan tanggungjawab. Meskipun tugas guru lebih sebagai fasilitator, tetapi tetap bertanggung jawab penuh terhadap perkembangan siswa. Dari pengalaman lapangan pendidikan anak menjadi rusak karena beberapa guru tidak bertanggungjawab. Misalnya, terjadi pelecehan seksual guru terhadap anak didik, guru meninggalkan kelas

seenaknya, guru tidak mempersiapkan pelajaran dengan baik, guru tidak berani mengarahkan anak didik, dll. Kemampuan untuk berkomunikasi dengan orang lain sangat

penting bagi seorang guru karena tugasnya memang selalu berkaitan dengan orang lain seperti anak didik, guru lain, karyawan, orang tua murid, kepala sekolah dll. Kemampuan ini sangat penting untuk dikembangkan karena dalam pengalaman, sering terjadi guru yang sungguh pandai, tetapi karena kemampuan komunikasi dengan siswa tidak baik, ia sulit membantu anak didik maju. Komunikasi yang baik akan membantu proses pembelajaran dan pendidikan terutama pada pendidikan tingkat dasar sampai menengah. Kedisiplinan juga menjadi unsur penting bagi seorang guru. Kedisiplinan ini memang menjadi kelemahan bangsa Indonesia, yang perlu diberantas sejak bangku sekolah dasar. Untuk itu guru sendiri harus hidup dalam kedisiplinan sehingga anak didik dapat

meneladannya. Di lapangan sering terlihat beberapa guru tidak disiplin mengatur waktu, seenaknya bolos; tidak disiplin dalam mengoreksi pekerjaan siswa sehingga siswa tidak mendapat masukan dari pekerjaan mereka. Ketidakdisiplinan guru tersebut membuat siswa ikut-ikutan suka bolos dan tidak tepat mengumpulkan perkerjaan

Dengan mengerti hal-hal itu guru akan mudah mengerti kesulitan dan kemudahan anak didik dalam belajar dan mengembangkan diri. Pendidikan dan perkembangan pengetahuan di Indonesia kurang cepat salah satunya karena disiplin yang kurang tinggi termasuk disiplin dalam mengembangkan ilmu pengetahuan dan dalam belajar. guru dituntut untuk terus belajar agar pengetahuannya tetap segar. Yang perlu diperhatikan di sini adalah. mengerti beberapa konsep pendidikan yang berguna untuk membantu siswa. ia harus tetap membangun komunikasi dan hubungan yang baik dengan siswa. sangat jelas bahwa guru perlu mengenal anak didik yang mau dibantunya. karakter. menguasai beberapa metodologi mengajar yang sesuai dengan bahan dan perkambangan siswa.Pengembangan Profesionalitas Guru 1-7 rumah. Di jaman kemajuan ilmu pengetahuan sangat cepat seperti sekarang ini. Guru bila tidak ingin ketinggalan jaman dan juga dapat membantu anak didik terus terbuka terhadap kemajuan pengetahuan. meski guru sangat disiplin. Yang ketiga adalah sikap mau mengembangkan pengetahuan. Untuk itu diperlukan pendekatan yang baik. Kompetensi Paedagogik Selanjutnya kemampuan paedagogik menurut Suparno (2002:52) disebut juga kemampuan dalam pembelajaran atau pendidikan yang memuat pemahaman akan sifat. ciri anak didik dan perkembangannya. mau tidak mau harus mengembangkan sikap ingin terus maju dengan terus belajar. perkembangan fisik dan psikis anak didik. Dengan demikian guru akan lebih mudah membantu siswa berkembang. Pertama. Guru tidak boleh berhenti belajar karena merasa sudah lulus sarjana. Guru diharapkan memahami sifat-sifat. 3. serta menguasai sistem evaluasi yang tepat dan baik yang pada gilirannya semakin meningkatkan kemampuan siswa. tahu ilmu . tingkat pemikiran.

1-8 Pengembangan Profesionalitas Guru psikologi anak dan perkembangan anak dan tahu bagaimana perkembangan pengetahuan anak. diharapkan guru dapat memilih mana yang paling baik untuk membantu perkembangan anak didik. (4) melaksanakan program pembelajaran. Kedua. Ketiga. maka teori dan filsafat pendidikan yang lebih bersifat demokratis perlu didalami dan dikuasai. . guru perlu juga menguasai beberapa teori tentang pendidikan terlebih pendidikan di jaman modern ini. maka dia akan lebih mudah mengajar pada anak sesuai dengan situasi anak didiknya. Dengan semakin mengerti banyak model pembelajaran. (2) menguasai bahan pembelajaran. Untuk itu guru diharapkan memiliki kreatifititas untuk selalu menyesuaikan teori yang digunakan dengan situasi belajar siswa secara nyata. Dan yang tidak kalah penting dalam pembelajaran adalah guru dapat membuat evaluasi yang tepat sehingga dapat sungguh memantau dan mengerti apakah siswa sungguh berkembang seperti yang direncanakan sebelumnya. Kompetensi profesional meliputi: (1) menguasai landasan pendidikan. Biasanya selama kuliah di FKIP guru mendalami teori-teori psikologi tersebut. Apakah proses pendidikan sudah dilaksanakan dengan baik dan membantu anak berkembang secara efisien dan efektif. diharapkan guru dapat meramu teori-teori itu sehingga cocok dengan situasi anak didik yang diasuhnya. Oleh karena guru kelaslah yang sungguh mengerti situasi kongrit siswa mereka. dan (5) menilai proses serta hasil pembelajaran. guru juga diharapkan memahami bermacam-macam model pembelajaran. Oleh karena sistem pendidikan di Indonesia lebih dikembangkan kearah pendidikan yang demokratis. Dengan mengerti bermacammacam teori pendidikan. (3) menyusun program pembelajaran. Namun yang sangat penting adalah memahami anak secara tepat di sekolah yang nyata.

(3) memiliki sikap dan kepribadian yang positif serta melekat pada setiap kopetensi yang lain. dan (4) mampu bekerja sama dengan orang lain. Kecerdasan sosial merupakan salah satu dari sembilan kecerdasan (logika. mungkin beberapa di antaranya menonjol. alam. bahasa. (2) memiliki toleransi pada orang lain. pendekatan komperehensif. 1995). Uniknya lagi. atau pendekatan multidisiplin. raga. pribadi. Dewasa ini mulai disadari betapa pentingnya peran kecerdasan sosial dan kecerdasan emosi bagi seseorang dalam usahanya meniti .Pengembangan Profesionalitas Guru 1-9 4. 1998). 1994). Hal ini sejalan dengan kenyataan bahwa dewasa ini banyak muncul berbagai masalah sosial kemasyarakatan yang hanya dapat dipahami dan dipecahkan melalui pendekatan holistik. lebih khusus lagi kecerdasan emosi atau emotial intellegence (Goleman. musik. Hanya saja. ruang. Kompetensi Sosial Kompetensi sosial meliputi: (1) memiliki empati pada orang lain. beberapa kecerdasan itu bekerja secara padu dan simultan ketika seseorang berpikir dan atau mengerjakan sesuatu (Amstrong. 18 Maret 2006) kompetensi sosial itu sebagai social intellegence atau kecerdasan sosial. Semua kecerdasan itu dimiliki oleh seseorang. Kecerdasan lain yang terkait erat dengan kecerdasan sosial adalah kecerdasan pribadi (personal intellegence). sedangkan yang lain biasa atau bahkan kurang. Kecerdasan sosial juga berkaitan erat dengan kecerdasan keuangan (Kiyosaki. Banyak orang yang terkerdilkan kecerdasan sosialnya karena impitan kesulitan ekonomi. Menurut Gadner (1983) dalam Sumardi (Kompas. kita tidak boleh melepaskannya dengan kecerdasan-kecerdasan yang lain. dan kuliner) yang berhasil diidentifikasi oleh Gardner. Sehubungan dengan apa yang dikatakan oleh Amstrong itu ialah bahwa walau kita membahas dan berusaha mengembangkan kecerdasan sosial.

Untuk mengembangkan kompetensi sosial seseorang pendidik. dapat kita saring dari konsep life skills (www. Dari uraian dan contoh-contoh di atas dapat kita singkatkan bahwa kompetensi sosial adalah kemampuan seseorang berkomunikasi. Topik-topik ini dapat dikembangkan menjadi materi ajar yang dikaitkan dengan kasus-kasus yang aktual dan relevan atau kontekstual dengan kehidupan masyarakat kita. Inilah kompetensi sosial yang harus dimiliki oleh seorang pendidik yang diamanatkan oleh UU Guru dan Dosen. (2) melihat peluang.lifeskills4kids. Kelima belas kecerdasan hidup ini dapat dijadikan topik silabus dalam pembelajaran dan pengembangan kompetensi sosial bagi para pendidik dan calon pendidik. (6) relawan sosial. (10) kepedulian kepada sesama. dan memberi kepada orang lain. (3) peran dalam kegiatan kelompok. menjadi jelas bahwa pekerjaan/jabatan guru adalah sebagai profesi yang layak mendapatkan penghargaan. Beberapa dimensi ini. (9) berempati.1-10 Pengembangan Profesionalitas Guru karier di masyarakat. (5) kepemimpinan. kita perlu tahu target atau dimensi-dimensi kompetensi ini. yang pada gilirannya harus dapat ditularkan kepada anak-anak didiknya. atau perusahaan. (4) tanggung jawab sebagai warga. lembaga. (8) berbagi. (7) kedewasaan dalam bekreasi. berempati. bekerja sama. Banyak orang sukses yang kalau kita cermati ternyata mereka memiliki kemampuan bekerja sama. dan (15) komunikasi. bergaul. . ada 15 yang dapat dimasukkan kedalam dimensi kompetensi sosial. (14) kerja sama. misalnya. baik finansial maupun non finansial. (13) menerima perbedaan. (12) solusi konflik. Dari 35 life skills atau kecerdasan hidup itu. (11) toleransi. yaitu: (1) kerja tim. Dari uraian tentang profesi dan kompetensi guru.com). dan pengendalian diri yang menonjol.

Dalam pembahasan rancangan Undang-Undang ini (hingga disahkan pada 6 Desember 2005) tersirat keinginan Pemerintah untuk memperbaiki wajah suram nasib guru dari sisi kesejahteraan dan profesionalisme. baik di dalam dan di luar sekolah dengan menggunakan bahan ajar. Ketiga komponen ini saling terkait dan saling mempengaruhi. Sejak awal gagasan pembuatan RUU Guru dan Dosen dilatarbelakangi oleh komitmen bersama untuk mengangkat martabat guru dalam memajukan pendidikan nasional. peserta didik. dan hanya sebagian kecil guru dari sekolah negeri dan sekolah elit yang hidup berkecukupan.2 juta orang. Sertifikasi kompetensi guru sebagai tindak lanjut dari UndangUndang ini menyisakan persoalan sebagaimana disampaikan Mendiknas pada media masa pada saat pengesahan Undang-Undang ini. Mengandalkan penghasilan dan profesi guru. pemerintah telah memberikan perhatian khusus dengan merumuskan sebuah UndangUndang yang mengatur profesi guru dan dosen. antara lain kesepahaman akan ukuran uji kompetensi guru. dan menjadikan profesi ini menjadi pilihan utama bagi generasi guru berikutnya (Situmorang dan Budyanto 2005:1). Dari ketiga komponen tersebut. jauh dari cukup sehingga tidak sedikit guru yang mencari tambahan untuk memenuhi kebutuhan hidup. karena di tangan para gurulah proses belajar dan mengajar dilaksanakan. baik yang terdapat di dalam kurikulum nasional maupun kurikulum lokal.Pengembangan Profesionalitas Guru 1-11 C. . Memimpikan Guru yang Profesional Untuk memperbaiki kualitas pendidikan. serta tidak dapat dipisahkan antara satu komponen dengan komponen yang lainnya. faktor gurulah yang dinilai sebagai satu faktor yang paling penting dan strategis. Guru. Jumlah guru di Indonesia saat ini 2. dan kurikulum merupakan tiga komponen utama pendidikan.

tanggung jawab. mengawali dengan satu pertanyaan menggelitik “what is teacher?”. menilai hasil pembelajaran. dalam tulisannya bertajuk “The teachers as a Decision Maker”. dibentuk. guru harus memiliki kemampuan profesionalisme yang dapat dihandalkan. terutama bagi pendidik pada perguruan tinggi”. kebijakan dan program yang tepat. yakni orangnya dan kinerja dalam melaksanakan tugas dan pekerjaannya. melakukan pembimbingan dan pelatihan. atau dia bekerja secara profesional. seorang profesional muda. Kemampuan profesionalisme yang handal tersebut tidak dibawa sejak lahir oleh calon guru.1-12 Pengembangan Profesionalitas Guru Untuk melaksanakan proses belajar dan mengajar secara efektif. Misalnya. kebijakan. Cooper. guru sebagai profesi yang amat mulia. profesionalisme. Demikian pula. dan profesionalitas sebagai berikut ini Profesi menunjuk pada suatu pekerjaan atau jabatan yang menuntut keahlian. Cooper menjawab pertanyaan itu dengan menjelaskan tetang guru dari aspek pelaksanaan tugasnya sebagai tenaga profesional. dan kesetiaan terhadap pekerjaan itu. Sebagai contoh. strategi. Profesionalisme menunjuk kepada derajat atau tingkat kinerja seseorang sebagai seorang profesional dalam melaksanakan profesi yang mulia itu. dan program pembinaan guru di masa lalu perlu dirumuskan kembali (Suparlan 2006:1). serta melakukan tulisan dan pengabdian kepada masyarakat. dipupuk dan dikembangkan melalui satu proses. Dalam UU Nomor 20 Tahun 2003 dinyatakan bahwa “Pendidik merupakan tenaga profesional yang bertugas merencanakan dan melaksanakan proses pembelajaran. Dedi Supriadi dalam bukunya yang bertajuk “Mengangkat Citra dan Martabat Guru” telah menjelaskan (secara amat jelas) tentang makna profesi. strategi. Proses. Profesional menunjuk dua hal. tetapi harus dibangun. . profesional. James M.

adanya pengakuan oleh masyarakat dan pemerintah mengenai bidang layanan tertentu yang hanya dapat dilakukan karena keahlian tertentu dengan kualifikasi tertentu yang berbeda dengan profesi lain. dan (3) keterampilan (Supriadi 1998:96). Keempat. maka kaidah itu dapat . yang ditandai dengan adanya standar kompetensi tertentu. guru memang dikenal sebagai salah satu jenis dari sekian banyak pekerjaan (occupation) yang memerlukan bidang keahlian khusus.Pengembangan Profesionalitas Guru 1-13 Sebagai tenaga profesional. Kelima. di samping melindungi kepentingan anggotanya. juga berfungsi untuk meyakinkan agar para anggotannya menyelenggarakan layanan keahlian yang terbaik yang dapat diberikan (Suparlan. bidang ilmu yang menjadi landasan teknik dan prosedur kerja yang unik. yang menyatakan bahwa. Untuk dapat melaksanakan tugas profesionalnya dengan baik. memiliki organisasi profesi yang. 2004:2). Dalam dunia yang sedemikian maju. pemerintah sejak lama telah berupaya untuk merumuskan perangkat standar komptensi guru. Soerjadi (2001:1-2) menyebutkan beberapa persyaratan suatu pekerjaan disebut sebagai profesi. memiliki mekanisme yang diperlukan untuk melakukan kompetitiflah seleksi yang secara efektif. Pertama. Ketiga. seperti dokter. insinyur. Profesionalisme guru didukung oleh tiga hal. yakni (1) keahlian. Kedua. dan bidang pekerjaan lain yang memerlukan bidang keahlian yang lebih spesifik. Westby-Gybson (1965). (2) komitmen. Dapat dianalogikan dengan pentingnya hakim dan UndangUndang. termasuk guru. sehingga yang dianggap bidang diperbolehkan dalam melaksanakan pekerjaan tersebut. yang dengan undang-undang yang kurang baik sekalipun akan dapat dihasilkan keputusan yang baik’. semua bidang pekerjaan memerlukan adanya spesialisasi. memerlukan persiapan yang sengaja dan sistematis sebelum orang mengerjakan pekerjaan profesional tersebut. Guru merupakan tenaga profesional dalam bidang pendidikan dan pengajaran. ‘berilah aku hakim dan jaksa yang baik.

Kelima. Ketiga. Standar Pengembangan Karir Guru Mutu pendidikan amat ditentukan oleh kualitas gurunya. yakni dengan ungkapan bijak ‘berilah aku guru yang baik. yang terpenting adalah manusianya. Supriadi mengutip laporan dari Jurnal Educational Leadership edisi Maret 1993. tetapi guru tidak dapat digantikan sepenuhnya oleh siapa atau alat apa . guru mampu berpikir sistematis tentang apa yang dilakukannya. guru mempunyai komitmen pada siswa dan proses belajarnya. Apabila kelima hal tersebut dapat dimiliki oleh guru. Belajar dapat dilakukan di mana saja. misalnya di PGRI dan organisasi profesi lainnya. bahwa aspek kualitas hakim dan jaksa masih jauh lebih penting dibandingkan dengan aspek undang-undangnya. Artinya. Sama dengan manusia dengan senjatanya. Keempat. guru seyogyanya merupakan bagian dari masyarakat belajar dalam lingkungan profesinya. aspek guru masih lebih penting dibandingkan aspek kurikulum. Ini berarti bahwa komitmen tertinggi guru adalah kepada kepentingan siswa. maka guru tersebut dapat disebut sebagai tenaga dan pendidik yang benar-benar profesional dalam menjalankan tugasnya (Supriadi 2003:14). Pertama. ‘man behind the gun’. dan belajar dari pengalamannya. guru menguasai secara mendalam bahan/materi pelajaran yang diajarkannya serta cara mengajarkannya kepada para siswa. Mendiknas memberikan penegasan bahwa “guru yang utama” (Republika 10 Februari 2003). D. bahwa guru profesional dituntut memiliki lima hal.1-14 Pengembangan Profesionalitas Guru dianalogikan dengan pentingnya guru. guru bertanggung jawab memantau hasil belajar siswa melalui berbagai teknik evaluasi. Kedua. Untuk menggambarkan guru profesional. Bagi guru hal ini merupakan dua hal yang tidak dapat dipisahkan. dan dengan kurikulum yang kurang baik sekali pun aku akan dapat menghasilkan peserta didik yang baik’. mulai cara pengamatan dalam perilaku siswa sampai tes hasil belajar. Hal yang sama.

yang paling penting bukan membangun gedung sekolah atau sarana dan prasarananya. Terjadilah lingkaran setan yang sudah diketahui sebab akibatnya. Gaji akan mengikuti dedikasi. Jadi.Pengembangan Profesionalitas Guru 1-15 pun juga. LPTK mengalami kesulitan besar ketika dihadapkan kepada masalah kualitas calon mahasiswa kelas dua yang akan dididik menjadi guru. Ketidakmampuan LPTK ternyata memang di luar tanggung jawabnya. Di samping itu. karena masalah rendahnya mutu calon guru itu lebih disebabkan oleh rendahnya penghargaan terhadap profesi guru. Pekerjaan besar ini mulai dari proses yang menjadi tugas lembaga pendidikan prajabatan yang dikenal dengan LPTK. guru harus memiliki tiga kualifikasi dasar: (1) menguasai materi atau bahan ajar. Untuk membangun pendidikan yang bermutu. mengasyikkan. karena pada akhirnya menyangkut duit atau gaji dan penghargaan. Peningkatan mutu guru merupakan upaya yang amat kompleks. Hal ini hanya dapat dilakukan oleh guru yang bermutu. (2) antusiasme. dan (3) penuh kasih sayang (loving) dalam mengajar dan mendidik (Mas’ud 2003:194). Banyak orang menganggap bahwa gaji dan penghargaan terhadap guru menjadi penyebab atau causa prima-nya. Sebagai salah satu komponen utama pendidikan. Namun. mencerdaskan. karena indikasi adanya mutu profesionalisme guru masih rendah. selain memang harus dipikirkan dengan sungguhsungguh upaya untuk meningkatkan gaji dan penghargaan kepada . karena melibatkan banyak komponen. Ternyata. Pada akhirnya orang mudah menebak. Gaji dan penghargaan guru belum dapat disejajarkan dengan profesi lain. melainkan harus dengan upaya peningkatan proses pengajaran dan pembalajaran yang yang berkualitas. ada orang yang berpendapat bahwa antara gaji dan dedikasi tidak dapat dipisahkan. gaji dan dedikasi terkait erat dengan faktor lain yang bernama kompetensi profesional. yakni proses dan pembelajaran menyenangkan.

keterampilan. Setelah sekitar dua tahun berjalan. keterampilan. para penyelenggra pendidikan di kabupaten/kota telah menunggu kelahiran kompetensi guru itu. dan nilai-nilai yang direfleksikan dalam kebiasaan berpikir dan bertindak”. Apakah yang dimaksud kompetensi? Istilah kompetensi memang bukan barang baru. nama baru Dikgutentis telah membentuk satu tim Penyusun Kompetensi Guru yang beranggotakan para pakar pendidikan yang tergabung dalam Konsorsium Pendidikan untuk menghasilkan produk kompetensi guru. terkenal wacana akademis tentang apa yang disebut sebagai Pendidikan dan Pelatihan Berbasis Kompetensi atau Competency-based Training and Education (CBTE). Untuk menjelaskan pengertian tentang kompetensi itulah maka Gronzi (1997) dan Hager (1995) menjelaskan bahwa “An integrated view sees competence as a complex combination of knowledge. Bahkan mereka mendambakan adanya satu instrumen atau alat ukur yang akan mereka gunakan dalam melaksanakan skill audit dengan tujuan untuk menentukan tingkat kompetensi guru di daerah masing-masing. Secara sederhana dapat diartikan bahwa kompetensi guru merupakan kombinasi kompleks dari pengetahuan. Sementara itu. Direktorat Tenaga Kependidikan (Dit Tendik). Direktorat Profesi Pendidik Ditjen PMPTK. Sejalan dengan definisi tersebut. yakni meningkatkan dedikasi dan kompetensi guru. Pada tahun 70-an.1-16 Pengembangan Profesionalitas Guru guru. Pada saat itu Direktorat Pendidikan Guru dan Tenaga Teknis (Dikgutentis) Dikdasmen pernah mengeluarkan “buku saku berwarna biru” tentang “sepuluh kompetensi guru”. menjelaskan bahwa “Kompetensi diartikan sebagai pengetahuan. sikap. and values displayed in the context of task performance”. . tim itu telah dapat menghasilkan rendahnya kompetensi guru. skill. Dua dekade kemudian. dan nilai-nilai yang ditunjukkan oleh guru dalam konteks kinerja tugas yang diberikan kepadanya. namun masih ada pekerjaan besar yang harus segera dilakukan. attitudes.

kemandirian. peningkatan kualitas dan penjenjangan karir guru. Oleh karena itu. Di samping itu. 2005). (5) pengembangan profesi. Diten PMPTK. keterampilan. Ketiga komponen masing-masing terdiri atas dua kemampuan. Direktorat Tendik 2003:5). (2) meningkatkan kinerja guru dalam bentuk kreativitas. (7) penguasaan bahan kajian akademik. Standar kompetensi guru bertujuan ‘untuk memperoleh acuan baku dalam pengukuran kinerja guru untuk mendapatkan jaminan kualitas proses pembelajaran’ (SKG. dan jenjang pendidikan’ (Direktorat Profesi Pendidik. (6) pemahaman wawasan kependidikan. 2005). Standar kompetensi guru terdiri atas tiga komponen yang saling mengait. dan (3) penguasaan akademik. yaitu: (1) penyusunan rencana pembelajaran. yakni (1) pengelolaan pembelajaran. (3) penilaian prestasi belajar peserta didik. Ketiga standar kompetensi tersebut dijiwai oleh sikap dan kepribadian yang diperlukan untuk menunjang pelaksanaan tugas guru sebagai tenaga profesi. standar kompetensi guru diartikan sebagai ‘satu ukuran yang ditetapkan atau dipersyaratkan dalam bentuk penguasaan pengetahuan dan perilaku perbuatan bagi seorang guru agar berkelayakan untuk menduduki jabatan fungsional sesuai bidang tugas. Standar kompetensi guru SKS memiliki tujuan dan manfaat ganda.Pengembangan Profesionalitas Guru 1-17 Berdasarkan pengertian tersebut. (2) pengembangan profesi. Standar Kompetensi Guru bermanfaat untuk: (1) menjadi tolok ukur semua pihak yang berkepentingan di bidang pendidikan dalam rangka pembinaan. dan tanggung jawab sesuai dengan jabatan profesinya (Direktorat Profesi Pendidik. ketiga komponen tersebut secara keseluruhan meliputi 7 (tujuh) kompetensi. . (2) pelaksanaan interaksi belajar mengajar. (4) pelaksanaan tindak lanjut hasil penilaian prestasi belajar peserta didik. kualifikasi. PMPTK. inovasi.

antara lain karena belum ada kejelasan tentang standar pengembangan karir mereka. dengan melibatkan antara direktorat terkait dengan . ada sebagaian kecil guru yang karena kapasitas pribadinya atau karena faktor lainnya dapat berubah atau meningkat karirnya menjadi kepala desa. dan Pusat Pengembangan Penataran Guru (PPPG) yang sekarang menjadi Pusat Pengembangan Profesi Pendidik dan Tenaga Kependidikan (P4TK) untuk pelbagai mata pelajaran dan bidang keahlian di beberapa daerah di Indonesia. anggota legeslatif.1-18 Pengembangan Profesionalitas Guru E. pembinaan guru diatur secara terpusat oleh pemerintah. Pelaksanaan kenaikan pangkat guru dengan sistem kredit pun sama. dan bahkan menjadi tenaga struktural di dinas pendidikan. Mengingat kondisi itulah maka pada tahun 1970-an dan 1980an telah didirikan beberapa lembaga pendidikan dan pelatihan yang bernama Balai Penataran Guru (BPG). Pengembangan Karir Guru Pada era sentralisasi pendidikan. Sedang sebagian besar lainnya mengalami nasib yang tidak menentu. Pada tahun 1970-an kegiatan ‘up-grading’ guru mulai gencar dilaksanakan di BPG dan PPPG. Kepala sekolah sering terpaksa menandatangani usul kenaikan pangkat guru hanya karena faktor ‘kasihan’. Kegiatan itu pada umumnya dirancang oleh direktorat-direktorat di bawah pembinaan Direktorat Jenderal Pendidikan Dasar dan Menengah sekarang LPMP dan P4TK berada di bawah Ditjen PMPTK. Dalam pelaksanaan di lapangan ketentuan tersebut berjalan dengan berbagai penyimpangan. yang sekarang menjadi Lembaga Penjamin Mutu Pendidikan (LPMP) di setiap provinsi. dalam hal ini Departemen Pendidikan Nasional melalui PGPS (Peraturan Gaji Pegawai Sipil) dan ketentuan lain tentang kenaikan pangkat dengan sistem kredit. PGPS sering diplesetkan menjadi ‘pinter goblok penghasilan sama’ atau ‘pandai pandir penghasilan sama’. Dengan kondisi seperti itu. Region-region penataran telah dibentuk di berbagai kawasan di Indonesia.

serta melibatkan juga peranan lembaga pendidikan sekolah sebagai on the job training yang dibina langsung oleh Kantor Wilayah Departemen pendidikan dan Kebudayaan yang ada di regionnya masing-masing. yakni guru baru atau guru yang belum pernah mengikuti penataran. kecamatan. guru yang telah mengikuti klegiatan diklat TOT (training of trainer) di tingkat pusat atau nasional dan memperoleh predikat sebagai penatar di tingkat provinsi. Sebagian besar instruktur ini juga telah memperoleh pengalaman dalam mengikuti penataran di luar negeri. yakni tempat bertemunya para guru berdiskusi atau mengikuti penataran tingkat kabupaten atau sekolah. dan Latihan Kerja Pengawas Sekolah (LKPS) untuk pengawas sekolah. atau baru sebatas ditatar di tingkat kecamatan atau sekolah. yakni instruktur yang telah diangkat untuk menduduki jabatan sebagai kepala sekolah. satu jenjang fungsional bagi guru yang telah menjabat sebagai kepala sekolah.Pengembangan Profesionalitas Guru 1-19 lembaga diklat (preservice training) dan lembaga pendidikan tenaga kependidikan (LPTK) sebagai lembaga preservice training. sementara para kepala sekolah aktif dalam kegiatan Latihan Kerja Kepala Sekolah (LKKS). dan sekolah. guru yang telah ditatar di tingkat provinsi atau nasional dan memperoleh predikat yang sebagai penatar di tingkat kabupaten. (4) pengelola sanggar. para guru dapat diklasifikasikan sebagai berikut: (1) guru biasa. yang sistem penyelenggaraan diklatnya dinilai melibatkan elemen pendidikan yang lebih luas. para guru memiliki wadah pembinaan profesional melalui orgabnisasi yang dikenal dengan Musyawarah Guru Mata Pelajaran (MGMP). (5) kepala sekolah. (2) guru Inti. . Kegiatan-kegiatan tersebut sebagaian besar dilaksanakan di satu sanggar yang disebut sanggar PKG. (3) instruktur. (6) Pengawas sekolah. Salah satu pola pembinaan guru melalui diklat ini adalah mengikuti pola Pembinaan kegiatan Guru (PKG). Selain itu. guru instruktur yang diberi tugas untuk mengelola Sanggar PKG. Melalui pola PKG ini.

Berbagai program peningkatan kompetensi dan profesionalisme tersebut dilaksanakan dengan melibatkan P4TK (PPPG).1-20 Pengembangan Profesionalitas Guru F. . Dinas Pendidikan. LPMP. dan LPTK sebagai mitra kerja. oleh Depdiknas sekarang dikelola oleh Direktorat Jenderal Peningkatan Mutu Pendidik dan Tenaga Kependidikan. PENUTUP Peningkatan kompetensi dan profesionalisme guru.

Jakarta: Genesindo. Safrudin Ismi. 2002. Pendidikan Nasional Menuju Masyarakat Masa Depan. Paradigma Pendidikan Masa Depan. Jakarta: Direktorat Ketenagaan Dirjen Dikti Dirjen Dikti Dir PPTK Depdiknas. Pendidikan untuk Masyarakat Indonesia Baru. Ace dan Dasim Budimansyah. Standar Kompetensi Guru Kelas SD-MI Program D-II PGSD. Rambu-rambu Penyelenggaraan Pendidikan Profesional Guru Sekolah Dasar. Undang-Undang No. Everett M. Akibatnya pada Mutu Pendidikan”. Rogers. Yogyakarta: Bigraf Publishing.1995. 2002. Paul. Zamroni. “Peningkatan Mutu Pendidikan melalui Manajemen Berbasis Sekolah”. Jakarta: Grasindo. New York: Cross Cultural Approach. Pusat Data dan Informasi Pendidikan. 2004. Direktorat Ketenagaan. Jakarta: Rineka Cipta. Gunawan. Rokhman. 2002. Menuju Masyarakat Pembelajar: Menggagas Paradigma Baru Pendidikan. Inovation in Education: Reformers and Their Critics. dalam Isu-isu Pendidikan di Indonesia: Lima Isu Pendidikan Triwulan Kedua. Suparno. 14 tahun 2005 tentang Guru dan Dosen. Indra Djati Sidi.DAFTAR PUSTAKA Chamidi. 2006. Jakarta: Grasindo. Rich. Kebijakan-Kebijakan Pendidikan. John Martin. 2000. 1992. Undang-undan No. Jakarta: Depdiknas. Suryadi. Ary H. Fathur dkk. 2005. Balitbang Depdiknas. Jakarta:Paramadina dan Logos Wacana Ilmu. Santoso S. New York: The Free Press. 2004. . Penelitian Balitbang dan Lemlit UNNES. 1995. “Status dan Peran Guru. Studi Kebijakan Pengelolaan Guru Di Era Otonomi Daerah dalam Rangka Peningkatan mutu pendidikan. 20 tahun 2003 tentang Sistem Pendidikan Nasional. Hamijoyo. 2004. Guru Demokratis di Era Reformasi Pendidikan. 2002. dalam Syarif Ikhwanudin dan Dodo Murtadhlo. Diffusion of Innovation.

BUKU AJAR Dasar Teknik Elektro .

cara pemasangan alat ukur listrik. komponen-komponen listrik. Kompetensi dan Indikator. diharapkan mahasiswa dapat menyelesaikan permasalahan rangkaian listrik yang komplek dengan berbagai metode. Setelah memahami materi. Deskripsi Ruang lingkup dari materi ini mempelajari tentang dasar rangkaian listrik dari komponen pasip yaitu R . Dapat merangkai dengan berbagai hubungan menghitung secara teoritis dan membuktikan dengan cara mengukur. D. daya. DC maupun AC. . Sebelum memahami tentang rangkaian dasar elektro. Pemahaman akan lengkap apa bila mengenal bentuk fisik masingmasing komponen. satuan dasar.BAB I PENDAHULUAN A. dapat menggunakan alat ukur dasar listrik (AVO meter). L dan C pada rangkaian dengan arus atau tegangan DC maupun AC. Kompetensi yang akan dicapai setelah mempelajari materi ini akan memahami fungsi dari masing-masing komponen bila dirangkai dan dipasang pada arus maupun tegangan. C. pembacaan code nilai. B. terlebih dahulu harus sudah memahami teori dasar ilmu listrik tentang arus. Prasyarat. Petunjuk belajar. tegangan.

watt detik Persamaan yang berhubungan q = i.Q i.q .1 Besaran dan satuan listrik . Dasar rangkaian Listrik.t t = 1/f i = dq/dt e = w/q p = e.I positip 0 negatip t Gambar 1. batre.1 Kurva DC 1. A. Daya ini dibangkitkan akumulator . thermocouple dan lain-lain. berikut Besaran Listrik Muatan Arus Tegangan Daya Kerja energi Simbol q.V p. I e. tegangan) yang besar dan arahnya setiap saat sama. w = ∫τ ei dt Tabel 1.BAB II KEGIATAN BELAJAR I I. E.i w = e.E.v. RANGKAIAN DC DC (Direct Current ) adalah daya listrik (arus . Besaran dan satuan listrik Besaran dan satuan listrik ditunjukkan pada tabel 1. dinamo.W Satuan Coulomb Ampere Volt Watt Joule. P w.

2. R ………volt E I R I = E / R…ampere dan R = E / I……Ω Gambar 1.E) dan arus listrik (i. Hubungan komponen a. R=ρℓ/A Keterangan: R = Tahanan dalam ohm ρ = (rho) tahanan jenis 4. Hukum OHM Hukum Ohm : perbandingan antara tegangan (e. Hubungan seri maka RAB = R .3.I )dalam tahanan (R) E = I. Segitiga Ohm 3. Resistivitas Resistivitas suatu penghantar adalah tahanan untuk satu satuan panjang per satu satuan luas penampang penghatar tersebut.n yang terhubung seri n = jumlah tahanan Tahanan total hubungan seri besarnya lebih besar dari tahanan terbesar R2 B RAB = R1 + R2 +…… Rn Bila R1 = R2 =…… Rn = R ℓ = panjang hantaran dalam cm A = luas penampang dalam cm2 . Deret (seri) R1 A Gambar 1.Dasar Teknik Elektro/Rangkaian Listrik 2-3 2.

5. Hubungan campuran (coumpound) RBC = R3 R4 / (R3 + R4) A R1 R2 B R4 R3 C RAC = RAB + RBC RAC= (R1 + R2 ) +{ R3 R4 / (R3 + R4)} Gambar 1. Hubungan Y . y.2-4 Dasar Teknik Elektro/Rangkaian Listrik b.R3)} B 1/ RAB = 1/ R1 + 1/ R2 +…… 1/ Rn RAB = 1/ (1/ R1 + 1/ R2 +…… 1/ Rn) Bila R1 = R2 =…… Rn = R maka RAB = R / n Tahanan total hubungan paralel besarnya lebihkecil dari tahanan terkecil yang terhubung paralel c.4. Jajar (paralel) R1 A R2 Gambar 1. Hubungan bintang ( Y ) Hubungan bintang: masing-masing pangkal terbuka (x. Hubungan paralel Untuk n = 2 Untuk n = 3 RAB = R1 R2 / (R1 + R2) RAB = R1 R2 R3/ {(R1. z).6.R3) +(R2. dan ujungujung disatukan X R1 R3 Z R2 Y Gambar 1. Hubungan seri paralel d.R2) + (R1.

y. ujung RB terhubung pangkal RC.Dasar Teknik Elektro/Rangkaian Listrik 2-5 e. z) seperti terlihat pada gambar 6. sehingga hasil konversi merupakan hubungan seri atau paralel atau campuran Konversi dari Y ke ∆ Untuk mengkonvers 3 terminal senama Y dan ∆ disatukan RA = (R1 R2 + R2 R3 + R3 R1 ) / R1 RB = (R1 R2 + R2 R3 + R3 R1 ) / R2 RC = (R1 R2 + R2 R3 + R3 R1 ) / R3 Konversi dari ∆ ke Y R1 = (RB RC) / (RA + RB + RC) R2 = (RC RA) / (RA + RB + RC) R3 = (RA RB) / (RA + RB + RC) . Hubungan ∆ atau D Catatan: Hubungan Y maupun ∆ tidak bisa diselesaikan seperti cara seri. ujung Rc terhubung pangkal RA. Hubungan segitiga (∆ ) atau Delta (D) Hubungan segitiga: ujung RA terhubung pangkal RB . Untuk penyelesaian harus ada hubungan lain yang terkait dengan hubungan Y atau ∆ yang harus dikonversi /diubah dari Y ke ∆ atau sebaliknya.7. masing-masing sambungan sebagai terminal terbuka (x. paralel dan campuran karena mempunyai 3 terminal terbuka. X RB RC Z RA Y Gambar 1.

perhitungannya sama dengan tahanan 2. Untuk kondensator (C) Bila terhubung seri.9. RC seri R5 sehingga B (RB + R2) paralel (RC + R5) = Rpar RAB = RA seri dengan Rpar Gambar 1. Hukum OHM pada rangkaian Arus dan tegangan pada rangkaian i2 B i3 R4 A E C R1 i R2 R3 C Gambar 1. paralel atau campuran. paralel atau campuran. Untuk kumparan (L) nilai tahanan R = ρ ℓ / A. Bila terhubung seri. perhitungannya terbalik dengan tahanan (R). A R4 RB A RA RC R5 R1 R3 R5 R2 B R2 R1.8. Arus dan tegangan RAC= (R1 + R2 ) +{ R3 R4 / (R3 + R4)} Tegangan pada R1 = i R1 Tegangan pada R2 = i R2 Tegangan pada R3 = Tegangan pada R4 = E BC = i { R3 R4 / (R3 + R4)} i2 = E BC / R3 dan i3 = E BC / R4 E = E AB + E BC = ( iR1 + iR2 ) + i { R3 R4 / (R3 + R4)} i= E / RAC . R3.2-6 Dasar Teknik Elektro/Rangkaian Listrik Contoh 1. R4 = Y diubah ∆ jadi RA RB RC maka RB seri R2. Gabungan Y ∆ dan penggantinya Catatan: 1. f.

10. Tegangan kirchhoff . Hukum Kirchhoff 1. Arus kirchhoff 4Ω . 10Ω .Dasar Teknik Elektro/Rangkaian Listrik 2-7 Latihan 1. Jumlah aljabar semua arus yang mengalir menuju suatu titik pada sebuah rangkaian listrik sama dengan nol i A i1 i2 R2 Gambar 1. A+ E1 Bi2 R1 i1 R2 C + E2 D terminal AB terdapat tegangan E1 terminal CD terdapat tegangan E2 arus i1 mengalir pada R1 arus i2 mengalir pada R2 E1 . Berapa besar tahanan bila a) dihubungkan seri b) dihubungkan paralel 2. Dari rangkaian B R1 C i = arus menuju titik B (arah positip) D i1 dan i2 = meninggalkan titik B (arah negatip) semua arus yang menuju ke titik B adalah i + (-i1) + (. Jumlah aljabar dari seluruh perkalian arus dan tahanan pada penghantar-penghantar tersebut. Tiga buah tahanan terdiri dar 12Ω .i2) = 0 i . Empat buah tahanan masing-masing 15 Ω .E2 = i1 R1 + i2 R2 sebuah rangkaian tertutup. 6 Ωdan 3 Ω deret. tersebut dibungkan dengan batre 12v Berapa besar tahanan total arus yang mengalir pada masing-masing R.i2) = 0 2.11. sama dengan jumlah aljabar seluruh gaya gerak listrik yang terdapat pada rangkaian Gambar 1. 3.i1 . Pada gambar 7 bila masing-masing tahanan besarnya 3 Ω hitunglah besar tahanan RAB 5. 3Ω dihubungkan jajar kemudian dihubungkan seri dengan tahanan 9Ω .

I aktif (c) E aktif .12b. Rp2 = {(R3 + R4 ) // R1 } + R2 maka It = E / Rp2 Arus di R4 adalah I4’’ = [R1/ {{R1 + (R3 + R4 ) } ] It dengan arah atas ke bawah maka I4 = I4’ + I4’’ (karena arah sama) .12c. R3 R2 R1 + R3 R3 + E I R4 I4 R2 R1 It E=0 R4 I4 ’ I R1 It R2 + E I=0 R4 I4’’ (a) (b) Gambar 1. I mati Gambar 1.12. Rangkaian dengan 2 sumber (c) (a) rangkaian dasar (b) E mati . maka arus yang mengalir pada salah satu cabang dapat dihitung dengan menjumlahkan arus yang mengalir padanya pada saat salah satu sumber dimatikan sedang sumber lain aktip secara bergantian.2-8 Dasar Teknik Elektro/Rangkaian Listrik Teori Superposisi Bila dalam suatu rangkaian terdapat lebih dari satu sumber tegangan atau sumber arus. Rp1 = (R1//R2)+ R3 arus di R4 adalah I4’= (Rp1 / Rp + R4 ) It dengan arah atas ke bawah Gambar 1.

Rangkaian Thevenin ke Norton a RT Rangkaian selanjutnya a Rangkaian selanjutnya (beban) IT GT b (beban) . Rangkaian Thevenin 7.Dasar Teknik Elektro/Rangkaian Listrik 2-9 6.13. TEORI THEVENIN Sebuah rangkaian dua terminal dapat diganti dengan sebuah sumber tegangan tetap ET dan tahanan tetap RT yang terhubung seri a R1 E IT ET R2 b a RT Rangkaian selanjutnya Rangkaian selanjutnya Rangkaian semula. (beban) Rangkaian Thevenin RT didapat dengan membuka beban (oc)dan menghubungsingkatkan E (sc) sehingga ET didapatkan dengan membuka beban (oc) maka ET = Eab = ( R2 / R1 + R2 ) E IT = ET / RT (beban) R2 // R1 b Gambar 1.14. TEORI NORTON Sebuah rangkaian dua terminal dapat diganti dengan sebuah sumber arus tetap IT dan konduktor tetap GT yang terhubung paralel IT ET b Gambar 1.

E2 RT didapatkan dengan menghubungsingkatkan E1dan E2 pada beban terbuka (gambar 10c) sebesar R xy = ( R1 // R2 ) + R3 Arus hubung singkat ( beban Isc) (x-y) atau IT didapatkan 10b.Isc’’ (arah arus mana yang lebih besar) .15.2-10 Dasar Teknik Elektro/Rangkaian Listrik Contoh Ubahlah menjadi rangkaian Thevenin dan Norton R3 x R1 E1 R2 R1 R2 I R3 x R1 R2 E1 =0 R3 x + + E2 + E1 i1 y i2 beban RL + E2 y beban RL E2=0 y (a) (b) (c) Gambar 1. R2 ) . Karena arus tak mengalir pada R3 maka tegangan x-y atau ET sebesar: ET = E xy = E1 – (I . dengan cara menghubungsingkatkan superposisi didapatkan: E1 = aktif E2 = 0 i1 = E1 /{ R1 + (R2 // R3)} gambar Dengan Isc’ = ( R2 / R2 + R3 ) i1 E1 =0 E2 = aktif IT = i2 = E2 / {( R1 // R2 )+ R2 } Isc’’ = ( R1 / R2 + R3 ) i2 Isc’ .Rangkaian dengan 2 sumber tegangan Untuk x–y terbuka arus I mengalir ke R2 dan R1 sebesar I = (E1+E2 ) / (R1+R2 ) . R1 ) atau ET = E xy = (I .

Rangkaian pengganti gambar 15 (a) Thevenin (b) Norton Arus beban n=menurut Thevenin IL = ET / (RT + RL) Arus beban n=menurut Norton IL = {RT / (RT + RL)} IT Latihan Hitunglah arus pada beban RL dari gambar 10 secara Thevenin dan Norton bila diketahui : E1 = 20V RL = 5Ω B. Bentuk sinus . R3 = 3 Ω. arus) yang besar dan arahnya setiap saat berubah. RANGKAIAN AC AC (Alternating Current) adalah daya listrik (tegangan.16.Dasar Teknik Elektro/Rangkaian Listrik 2-11 Rangkaian Thevenin dan Norton dapat digambarkan RT + ET y (a) (b) x IL RL IT + RT x IL RL y Gambar 1. Tegangan v = Vm sin ω t Arus i = Im sin ω t Gambar.17. Bila daya AC dihubungkan dengan komponen maka komponen tersebut bersifat impedansi yang berupa tahanan murni ( R ) dan reaktansi (x) v. R2 = 6 Ω . 1. 0 0 Π 2Π 2Π = T = periode dalam detik + 0 0 = putaran per detik f =1/T= frekuensi dalam cps (Hertz) 0 t ω = 2Π / T = 2Π f = kecepatan sudut T T dalam radial (derajat). i V m Im E2 = 10V R1 = 3 Ω.

( Vm / ω L) cos ω t = (Vm / ω L) sin (ω t .19 AC pada L (a) v dan i pada L v = Vm sin ω t i = ∫ (Vm sin ω t dt / L) = .2-12 Dasar Teknik Elektro/Rangkaian Listrik 1.18 AC pada R (a) v dan i pada R v = Vm sin ω t (b) phasa v dan i R 0 (b) Vm Im t dicatukan pada R maka arus i = v / R = Im sin ω t bentuk gelombang v maupun i (gambar 18b) ternyata tidak terjadi beda phase (0o) maka impedansi (Z) merupakan vektor sebesar Z=R Kumparan i v t Ф=90o 0 ………………Ω v.i Vm Im v=i ω L L 0 ω (a) Gambar.1. Catu daya (v atau i ) AC pada komponen Tahanan i v v=i R (a) Gambar.Ф ) = Im sin (ω t -90o ) (b) (b) phasa v dan i dicatukan pada L maka arus .1.

90o ……….Ω ω L = 2 Π f L= XL disebut reaktansi induktif Vm Im 0 (b) ωt dicatukan pada C maka arus i = C (d Vm sin ωt /dt ) = C (Vm cos ωt /dt ) = ωC (Vm cos ωt) = {Vm / (1/ ωC ) } sin (ωt +90o ) = Im sin (ωt +90o) Vm / (1/ ωC) = Im bentuk gelombang (gambar 1..Ω 1/ω C = 2 Π f C= Xc disebut reaktansi capasitif .20.Dasar Teknik Elektro/Rangkaian Listrik 2-13 bentuk gelombang (gambar 19b) ternyata terjadi beda phase 90o yaitu Im tertinggal 90o terhadap Vm atau Vm mendahului 90o terhadap Im maka impedansi (Z) merupakan vektor sebesar ZL = ω L Kondensator v.i i v v=i1/ωC (a) Gambar 1.20b) ternyata terjadi beda phase 90o yaitu Vm tertinggal 90o terhadap Im atau im mendahului 90o terhadap vm maka impedansi (Z) merupakan vektor sebesar ZC = ω C .. AC pada C (a) v dan i pada C v = Vm sin ωt (b) phasa v dan i C Ф=90 o 90o ……….

21.Ω -1 XL R Z = √ R2 + X L 2 Ф = tg XL /R 0 Atau Ф = arc tg XL /R Gambar 1.22. R seri C . Vektor impedansi RL Rangkaian seri R dan C i R v C vC vR v = i R + i / j ωC Gambar 1. Vektor tegangan v = Im ZL Z = √ R2 + ω2L2 Z Ф Ф ……. R seri L maka A sin Ф + B cos Ф = C sudut Ф = ωt = tg -1 B/A= tg -1 (ωL/R) v C 0 Ф vL C= A2 + B 2 2 2 B vR = √ R2 Im2 + ω2L2 Im2 = Im√ R + (ωL) A Gambar 1.23.24.2-14 Dasar Teknik Elektro/Rangkaian Listrik Rangkaian seri R dan L vR v = vR + vL i v R L vL = R Im sin ωt + ωL Im cos Ф = Im (R sin ωt+ ωL cos ωt) misalkan R Im = A ωL Im = B Gambar 1.

.1/ ωC ) . L dan C vR v = vR + vL + vC i v R L C vC Gambar 1.1/ ωC R ) XC Gambar 1.Dasar Teknik Elektro/Rangkaian Listrik 2-15 Z = √ R2 – (1/ ωc)2 Ф …….Ω dengan sudut Ф 1/ ωC Ф = tg -1 R Gambar 1.Im/ ωC ) cos ωt} = Im R sin ωt + (ωL – 1/ ωC) Im cos ωt ωL √ R2 +(ωL-1/ ωC)2 ωL-1/ ωC Ф impedansi seri RLC adalah Z = √ R2 +(ωL-1/ ωC)2 …….27.25. Vektor impedansi R L C ( ωL/R . Vektor impedansi RC Rangkaian seri R . Seri R L C vL = R Im sin ωt + ωL Im cos Ф + { ( .Ω 0 Z R Ф = tg -1 (.26.

28.2o arus tertinggal 38.2o Bila digambarkan vector impedansinya arus Im = Vm / Z Z =12.7 38. Penyelesaian XL = 2 Π f L = 2.38.7Ω = √ 102 + 7.05 = 7. 3.85Ω Z = √ R2 + XL2 jadi Z = 12.852 = √ 161.85/10) =38.8 A .7Ω 38.2o R=10 XL=7.05 henry dihubungkan tegangan AC yang mempunyai tegangan maximum 150v frekuensi 25 Hz berapa impedansi dan arus yang mengalir. 25 .2o = 11.6 = 12.14 .2-16 Dasar Teknik Elektro/Rangkaian Listrik contoh Tahanan R=10 Ω diseri dengan kumparan L=0.2o =(150 0) / 12.2o terhadap tegangan Gambar 1. Vektor Z . 0.85 dengan sudut Ф = tg -1 XL /R = tg -1 (7.7 38.

Emissi Kuat Medan : emissi yang timbul karena perbedaan tegangan pada Anoda-Katoda.BAB II KEGIATAN BELAJAR II DASAR ELEKTRONIKA KOMPONEN : Komponen elektronika bersifat aktif yang artinya dapat mengubah besaran maupun bentuk masukan (input). Emisi Elektron : Pancaran elektron akibat pengaruh dari luar (panas. Tabung elektron a) Bentuk fisik b) Simbol-simbol 2. sinar. A. Emissi Thermis : emissi yang timbul karena pengaruh panas pada filament (heater) b.1. DASAR KERJA Bekerjanya tabung elektron berdasarkan emissi elektron: a. tekanan mekanik ) pada bahan emissi (katoda) . BENTUK FISIK & SIMBOL A = anoda A K K = Katoda A G = Grid A G SG = Sreen Grid A G SG K K K Dioda ( a) Dioda gas Trioda Tetroda ( b) Gambar 2. c. tegangan. TABUNG ELEKTRON 1. Sebelum komponen semikonduktor ditemukan komponen aktif menggunakan tabung electron atau tabung hampa. Rangkaian elektronika terdiri dari komponen aktif dan pasif (bersifat resistip).

Mg. SEMIKONDUKTOR 1. Daya yang dibutuhkan rendah 2. Tidak membutuhkan pemanasan 3. Tl ………………. BAHAN 1. Zn. Perawatan sulit 7. In.. Membutuhkan daya besar 2. 10 -19 C P =pembawa muatan positip + 1. Al. Pb ……………………. golongan II B. Ga. As. Mahal B. Sb.Bahan campuran : C. N = pembawa muatan negatip sebesar – 1. Sn.. Po ………………golongan VI Golongan V didoping ke golongan IV = logam type N (elektron) Golongan III didoping ke golongan IV = type P (hole). Tidak tahan tekanan mekanik 6. Se.golongan I Be.6. Daya besar 2. Miniaturisasi 4. 5. KEUNTUNGAN & KERUGIAN Keuntungan : 1.6.2-18 Dasar Teknik Elektro/Rangkaian Listrik 3. Dimensi besar 4. S. Dinamis / portable . Bi ………………. Hg …………. Bahan utama : Silicon (Si) dan Germanium ( Ge) sebagai golongan IV 2. Te. Cd. 10 -19 C.golongan V (donor) O. KEUNTUNGAN & KERUGIAN Keuntungan : 1. Membutukan pemanasan 3. Statis. Tahan Panas Kerugian : 1. 2.golongan III (aseptor) N. P.

3. KARAKTERISTIK ID mA Forward bias VD>0V ID > 0 -VD Reverse bias VD< 0V ID = . SIMBOL & PENCATUAN Logam tipe P & N disambung = Sambungan (jungtion) PN Dioda anoda IB =0 IS =0 dk katoda IS dk IB IB =0 dk IS P N VD<0 dicatu mundur VD= tegangan catu VD=0 VD>0 tanpa dicatu dicatu maju IB = arus mayoritas IS = arus minoritas dk = daerah kosong Gambar 2. Simbol dan pencatuan dioda Dioda melalukan arus bila di catu maju (forward bias) dan tidak melalukan arus bila dicatu mundur/balik (reverse bias). Tidak tahan terhadap panas DIODA 1. Murah Kerugian : 1.Dasar Teknik Elektro/Rangkaian Listrik 2-19 5. Karakteristik dioda . Mudah perawatan 7. 2.IS 0 . Daya yang dihasilkan rendah 2. Tahan terhadap tekanan mekanik 6.ID µA VD non bias VD=0V ID = 0 volt Gambar 2.2.

10 -23 joule oK -1) VD = tegangan dioda T = temperature dalam oK (300 oK ) Keterangan : IS = arus jenuh balik Tahanan DC (statis) R DC = VD ID Tahanan AC (dinamis) r AC = vd / id vd = k.1 ) e = muatan electron ( 1. 10 -19 colomb ) k = konstanta Boltzman ( 1.38 . Ω PENGGUNAAN DIODA 1. A A B E C 1 B E 0 A D1 D2 I C R R 0 0 1 1 B 0 1 0 1 C 0 1 1 1 Gambar 2. Rangkaian Gerbang OR (ATAU). RANGKAIAN GERBANG (GATE) A. rangkaian OR dan tabel kebenaran .6 .2-20 Dasar Teknik Elektro/Rangkaian Listrik Arus dioda ID = IS ( e kVD/T . Rangkaian logika. T /q maka r AC = (kT/q) / id r AC = 26 mA/ id ……….4.

7.6.5. Gerbang OR pada kondisi A=B=1 Tegangan C = [ R /{ R+ (Rf1 // Rf2 )}]E = [ R/{R+ (0 // 0) }]E = E = 1 Gerbang AND kondisi A=1 B=0 R A 1 E 0 C D1 R D2 B Gambar 2. Rangkaian Gerbang AND (DAN) A B A D1 D2 I C R C E 1 B 0 A 0 0 1 1 B 0 1 0 1 C 0 0 0 1 E Gambar 2.Gerbang AND kondisi A=1 B=0 Tegangan C = [Rf2 / {Rf2 +( R // Rr1)} ] E = [0 / {0+( R //~)}] E = 0 . rangkaian logika. Dioda ideal rangkaian AND dan tabel kebenaran Rf = 0 ohm (tertutup) Tahanan maju (forward) Tahanan mundur (reverse) Rr = ~ ohm (terbuka) Analisis dapat dilakukan berdasarkan tabel kebenaran Contoh Gerbang OR kondisi A = B = 1 A 1 B E 0 D1 D2 I C R R Gambar 2.Dasar Teknik Elektro/Rangkaian Listrik 2-21 B.

Clipper seri tanpa sisipan tegangan DC V vi =Vm VD R Vo Vm 0 V vi vo 0 vi + V v (a) (b) (c) .9. PEMOTONG PARALEL R R vo 0 0 vi 0 vi vo 0 R 0 vi vo 0 R 0 vi vo 0 Gambar 2. Clipper seri dengan sisipan tegangan DC (a) Rangkaian clipper seri (b) Bentuk masukan (c) Bentuk keluaran B. Pemotong Seri 0 vi R vo 0 0 vi R vo 0 0 vi R vo 0 0 vi R vo 0 Gambar 2. Clipper paralel tanpa sisipan tegangan DC .2-22 Dasar Teknik Elektro/Rangkaian Listrik 1. RANGKAIAN PEMOTONG (CLIPPER) A.8.10.Gambar 2.

a) Rangkaian b) input sinusoidal VDC = 0.12 Penyearah setengah gelombang. Penyearah setengah gelombang (half wave rectifier) Satu periode input menghasilkan ½ periode (satu puncak) positip VT D Vi = Vm sinωt Vm -VT R Vi Vm 0 t1 t2 0 Vo Vm -VT V dc = 0. Ada 2 macam jenis penyearah A. Penyearah gelombang penuh (full wave rectifier) Satu periode input menghasilkan 2 puncak positip Penyearah gelombang penuh ada 2 macam: . PENYEARAH Penyearah (rectifier) adalah perubah daya AC menjadi DC.318 (VM .318 t1 t2 (a) (b) (c) Gambar 2.11. Clipper aralel dengan sisipan tegangan DC (a) Rangkaian clipper paralel (b) Bentuk masukkan (c) Bentuk keluaran 3.Dasar Teknik Elektro/Rangkaian Listrik 2-23 Vo R vi =Vm VD V vi Vm 0 vo Vm V 0 (a) (b) (c) Gambar 2.VT) c) bentuk output B.

15 Saringan kondensator a) rangkaian b) grafik pengisian.636 VM 0 D1 A P B S D2 R t1 b) t2 c) Gambar 2. penyimpanan dan pengosongan t3 (b) S Vo Vo E Vc τ = RC t .14. Cara cabang tengah (centre tap) Vi 0 t1 a) t2 Vo VDC =0. E C R 0 t1 t2 a) Gambar 2. Penyearah jembatan a) bentuk input b) bentuk output c) rangkaian Saringan (filter) .636 VM t2 D1 D4 B D3 D2 (a) (b) (c) Gambar 2.13 Penyearah gelombang penuh cabang tengah a) Input sinusoidal (b) bentuk output (c) rangkaian 2. Vi 0 D2 Vo t1 t2 0 A t1 VDC =0.2-24 Dasar Teknik Elektro/Rangkaian Listrik 1. Cara jembatan ( bridge ) .

atau fo = 2 fi V Ripple = (VRiple max ) + (VRiple min ). atau fo = fi gelombang penuh t = 0.Dasar Teknik Elektro/Rangkaian Listrik 2-25 Penyearah setengah gelombang dengan filter .02 detik. Penyearah gelombang penuh dengan filter (a) bentuk input (b) bentuk output V Ripple = Q/C ……volt = (I .VRiple max . Penyearah setengah gelombang dengan filter (a) bentuk input (b) bentuk output Penyearah gelombang penuh dengan filter Vi Vm VDC VMin Vo Vm VRiple max VRiple VRiple min 0 t1 t2 t3 (a) t 0 (b) t Gambar 2. f sekunder = 2 f primer. f sekunder = f primer. Farad t = 1/f atau f = 1/ t f = 50 Hertz untuk setengah gelombang t = 0. t ) / C C = Q / V Ripple …….01 detik.16.17. Tegangan searah VDC = Vm . Vi Vm Vo Vm VDC VMin VRiple 0 t1 (a) t2 t3 t 0 t (b) VRiple max VRiple min Gambar 2..

besaran listrik .318 Vm .2-26 Dasar Teknik Elektro/Rangkaian Listrik Besaran-besaran listrik. Penyearah setengah gelombang: Tegangan rata-rata Vr = V rata-rata = 0.636 0. Arus rata-rata Ir = I rata-rata = 0.636 Vm . Hubungan besaran. V 0. Besaran effektif diukur dengan alat ukur AC.18.707 Vm untuk arus maksimum Ieff = 0. Arus rata-rata I rata-rata = 0. Besaran effektif. Besaran rata-rata Besaran rata-rata (average) diukur dengan alat ukur DC.636 Im .318 tegangan Vm Vr Vr Veff Vm V p t p = Vm t m t 0 -Vm Gambar 2. 1.707 0. Untuk maksimum Vm = Vp = (V ptp)/2 dan untuk arus maksimum Im = Ip =(I ptp)/2 2. Besaran effektip lebih kecil 0.318 Im Penyearah gelombang penuh: Tegangan rata-rata V rata-rata = 0.707 Im 3.707 dari besaran maksimum Untuk tegangan effektip Veff = 0. Besaran maksimum (puncak) Besaran maksimum(puncak) atau puncak ke puncak (peack to peack) diukur dan digambarkan oleh alat ukur Osiloskop.

Dasar Teknik Elektro/Rangkaian Listrik 2-27 TRANSISTOR 1 Konstruksi dan susunan Transistor singkatan dari transistor (BJT). Susunan Common Base (a) arah arus PNP (b) arah arus NPN . Susunan Common Base (CB) E + VEE IE IB B B (a) (b) IC C E IE IC C + Gambar 2. Transistor (a) Teknologi PNP dan NPN (b) Analogi 2 dioda (c) Simbol PNP dan NPN Syarat kerja transistor :dioda E – B bias forward. dioda C-R bias reverse 1. ++ P E transfer resistor atau disebut bi junction N B P (a) C (b) E N P B N C E B C E B (c) C Gambar 2.19.20.

α ) .α ) Arus bocor akibat agitasi termis sebesar ICBO.2-28 Dasar Teknik Elektro/Rangkaian Listrik Penguatan arus DC pada CB adalah α (alfa) : α dc = IC / IE jadi IC = α IE IC ≈ IE IB = IE .IC atau IB = IE .21. : IB = IE ( 1 .α) IE = ( β +1 ) IB VCE = constant .α IE atau IB = IE ( 1 . β ac = (∆IC) / (∆IB) Hubungan α dan β β = α / (1.ICBO maka IC = α IE + ICBO dan IE = IC / α 2 Susunan Common Emitor (CE) IC IE .α) Penguatan arus untuk emitor bersama dengan inisial β (beta).VCC .VBB IB IE IC + VCC +VBB IB (a) (b) Gambar 2.α)+ (ICBO / 1. Susunan Common Emitor (a) arah arus PNP (b) arah arus NPN Arus-arus yang mengalir pada transistor IE = IB + IC dan IC = α IE + ICBO IC = α (IB + IC ) + ICBO IC = ( α IB / 1.

VCE=C IC = f(VCE). IB=C IC =f ( IB) . Susunan common colector (a) PNP Arus pada susunan CC adalah (b) NPN IE = {(1/1. IE=C CE IB = f(VBE).Dasar Teknik Elektro/Rangkaian Listrik 2-29 3 Susunan Common Colector (CC) IE IB IC (a) Gambar 2. VCB=C IC = f(VCB).VCE=C Penguatan arus VEC=C Tegangan balik IB=C Parameter Impendansi Input (Zi) (besar) Impendansi Output (Zo) Penguatan arus (Ai) Penguatan Tegangan (Av) CB IE = f(VEB).22. IE=C IC =f ( IE) . VCE=C VBE= f (VCE). VBC= f(VEC).α) ICBO} -VEE +VBB IB IC (b) IE +VEE . VCB=C VEB= f(VCB). VEB/ IE (kecil) VCB/ IC (besar) IC / IE (kecil) VCB/ VEB (besar) VBE/ IB (besar) VCE/ IC (besar) IC / IB (besar) VCE /VBE (besar) VBC /IB VEC/IE (kecil) IE / IB (besar) VEC /VBC (kecil) . IC =f (VEC) IE =f ( IB) .1. Karakteristik dan perameter Karakteristik/ parameter Karakteristik Input VEC=C Output .VBB 3 KARAKTERISTIK DAN PARAMETER PENGUAT Tabel 2.α) IB } + {(1/1. IB=C CC IB = f(VBC).

25. Base bias I RB C1 IB VBE VCC RC IC IE Output AC C2 Input AC Gambar 2. Fixed bias IB = (VCC .24.IC RC 2.2-30 Dasar Teknik Elektro/Rangkaian Listrik PEMBIASAN PADA PENGUAT 1.VE .23. Fixed Bias (Bias tetap) VCC RB Input AC C1 VBE IB IC RC C2 IE Output AC Gambar 2.IC (RC + RE ) 3.VBE ) / RB IC = β IB VCE = VCC . Fixed bias dengan stabilisasi emitor VCC RB Input AC C1 IB VBE RE IC RC C2 IE CE Output AC VB Gambar 2.VBE) /{ (RB/ β )+ RE } VCE = VCC . Fixed bias stabilisasi emitor IB = (VCC -VBE ) / {RB +(β +1) RE} IC = (VCC . Base bias .

IC (RC + RE ) VB R2 Gambar 2.VBE ) / {RB + ( β +1)RE} VCE = VCC . Base bias dengan stabilisasi Emitor IC = ( VCC . Potensio Bias VCC R1 Input AC C1 IB VBE RE IE IC RC C2 CE Output AC VCE = VCC .VBE) / {RC +( RB/ β )} VCE = VCC .IC (RC + RE ) .27. Base bias dengan stabilisasi Emitor I RB C1 IB VBE VCC RC IC IE Output AC C2 CE Input AC RE Gambar 2.VBE) / {RC + (RB/ β) + RE } 5.26. Potensio bias RB = R1 // R2 = R1R2 / (R1 +R2) VB = (R2 / R1 +R2 ) VCC IB = (VB .Dasar Teknik Elektro/Rangkaian Listrik 2-31 IC = ( VCC .IC RC 4.

29 Hubungan input dan output Dari gambar 2. Penguat susunan CE Dibutuhkan: a. .28. ANALISIS GRAFIS VCC Input AC Ii R1 IB C1 VBE RE Io RC Output AC VCE C2 vo IE CE vi VB R2 Gambar. Karakteristik output CE b.1000 x ( terjadi beda phase 180 o ) Terjadi penguatan arus 100 kali dengan arah terbalik. 2.28 arus maximum di kolektor adalah IC Max = VCC / (RC + RE) dan VCC = VCE Penguatan arus Ai = ( 50 -30) mA / (30 – 10) µA = .2-32 Dasar Teknik Elektro/Rangkaian Listrik TRANSISTOR SEBAGAI PENGUAT Besar penguatan penguat dapat dianalisis dalam 2 cara yaitu: I. Garis beban IC (mA) IC Max Q1 IB1 60µA IB2 50 µA input IB3 40 µA IB4 30µA IB5 20µA IB6 10µA IB7 0µA Q7 Garis bebanDC VCC VCE (volt) output 0 50 40 30 20 0 Q2 Q3 Q4 0 Q5 Q6 Gambar 2.

RC . dB Penguatan arus A i = 20 Log ( Io / Ii ). Rangkaian yang digunakan dalam analisis adalah susunan CE. dB II. Catu daya DC mengalir pada R1 . Gambar 30a merupakan rangkaian penguat susunan CE dengan masukan dan keluaran sinyal AC. ANALISIS TEORITIS Untuk memudahkan analisis secara teoritis/matematis rangkaian harus ganti dengan model AC. Dari temuannya dihasilkan: Penguatan daya : Oleh karena AP = Log ( Po / Pi ) ………. Analisis model “re” “re” adalah tahanan masukan AC dalam kondisi penguat beroperasi. karena penguatan berdasarkan sinyal AC Untuk mengganti menjadi rangkaian AC ( rangkaian model ) 1.………..Bell (B) atau = 10 ( Po / Pi ) …………desiBell (dB) P = E2 / Z atau P = I2 Z Untuk P maximum Zo = Zi Maka Penguatan tegangan A v = 20 Log ( Vo / Vi )………... Semua kondensator dianggap hubung singkat (short) 2. Catu daya DC dianggap hubung singkat (short) 1. R2 .. RE dan transistor membentuk rangkaian DC .Dasar Teknik Elektro/Rangkaian Listrik 2-33 PENGUATAN dalam satuan dB ( desi Bell ) Menurut Abraham Bell : Bahwa telinga manusia menerima intensitas suara secara logaritmis.

rangkaian AC c. model “re “non ideal Transistor pada gambar 2.( Vi / re ) Rc bila masing-masing dibagi dengan Vi maka .β ( Vi / βre ) Rc = . Keterangan : βre = impedansi masukan ro = impedansi keluaran re = 26 mV / IE Zi = RB // βre Zo = Rc ro = ∞ βib = penguatan arus Tahanan emitor AC RB = R1 // R2 Vo = Io Rc = .30 Penguat CE a.30(c). rangkaian dasar ( c) b.β Ib Rc Vo = .30b (dalam kotak) dimodelkan pada gambar 2.2-34 Dasar Teknik Elektro/Rangkaian Listrik VCC Input AC Ii R1 IB C1 VBE RE Io RC Output AC C2 vo IE CE vi VB R2 (a) C ii R2 B Vo E ii Zi B ib βre E C R1 Zi io RC Zo vi RB βib ro io Zo RC vo (b) Gambar 2.

β Ib β = Io / Ib Transistor model “h” ic B C E B ib vBE vCE ib vBE hiE hrEvCE hfE ib ic vCE hoE C E (a) (b) Gambar 2.31. Parameter “h” pada susunan penguat Parameter Impedansi input (hi ) Penguatan tegangan reverse (hr) Penguatan arus forward (hf) Admitansi output (ho) CB hiB hrB hfB hoB CE hiE hrE hfE hoE CC hiC hrC hfC hoC Satuan ohm X (kali) X (kali) mho Io = .(Rc // ro) / re 2. Pemodelan transistor non ideal (a) transistor (b) model “h” non ideal . Analisis model “h “ Model hybrid atau “h” adalah model yang paling banyak digunakan dalam menganalisis analisis penguat.Rc / re terjadi beda phase 180 o Penguatan arus Ib = ( RB Ii ) / (RB + βre) bila masing-masing dibagi dengan Ii Ib/ Ii = RB / (RB + βre ) Ai = (Io / Ib ) (Ib/ Ii ) Ai = -β RB / (RB + βre ) terjadi beda phase 180 o Bila ro dipertimbangkan maka Zo = Rc // ro Maka penguatan tegangan Av = .Dasar Teknik Elektro/Rangkaian Listrik 2-35 Penguatan tegangan Vo /Vi = Av = . Tabel 2.2.

2-36 Dasar Teknik Elektro/Rangkaian Listrik Dari gambar 2. Susunan basis bersama RE vS VEE (a) a) rangkaian DC E B C E hiB RL VCC RE vS iE hfB iE (b) C iC RL hrBVCB B hoB Gambar 2.33. Penguat basis bersama b) model “h” . Pemodelan transistor ideal (a) transistor Persamaan input Persamaan output hiE = (b) model “h” ideal hrE = 0 hoE = 0 ZoE = ~ vBE = hiE ib + 0 ic = hfE ib + 0 (hfE 26 mV ) / IE Susunan penguat model “h” (non ideal) 1.32.31(b) terdapat 2 persamaan Persamaan input (tegangan) Persamaan output (arus) ib vBE ic B E E C vBE = hiE ib + hrE vCE ic = hfE ib + hoE vCE B ib hiE hfE ib b) ic vCE C vBE E a) Gambar 2.

34. .35. Susunan emitor bersama ib ic B E C hiE RB Vs B vS VBB (a) RC vCE VCC ib hfE ib ic RC hoE C hrEvCE (b) Gambar 2. Susunan kolektor bersama ib vS VBB RB hiC B E C B ib hfC ib vo C ic RE vo VCC RB vS hrCvE E RE ie hoC (a) a) rangkaian DC b) model “h” (b) Gambar 2. Penguat susunan kolektor bersama.Dasar Teknik Elektro/Rangkaian Listrik 2-37 2. Penguat emitor bersama (a) rangkaian DC (b) model “h” 3.

VB = R2 Vcc / (R2 + R1) VE = VB . Susunan emitor bersama (a).hf E (RC / RC + RL ) } { is ri / (ri + hiE)} masing masing dibagi dengan is maka didapatkan Ai = iL / is = {. Ge = 0.hf E (RC / RC + RL ) } { ri / (ri + hiE)} .hf Eib) ib = {ri / (ri + hiE)} is Bila disubstitusikan maka iL = {.VBE tegangan VBE untuk Si= 0.2-38 Dasar Teknik Elektro/Rangkaian Listrik Analisis Susunan Emitor model “h” VCC is Rs R1 ib VBE RC C2 RE IE CE iL vo RL is C1 vi VB R2 (a) C ib is Rs ri B vo E is is Rs B vi RB ib hiE hf Eib E C vo RC iL RL RB RC iL RL (b) ( c) Gambar 2.3 V IE = VE / RE hiE = (26 mV hf E) / IE Penguatan arus Ai = iL / is sedang untuk iL = { RC + RL)(RC / RC + RL )} (. rangkaian dasar (b) rangkaian AC (c) model “h”ideal RB = R1 // R2 dan ri = RB // Rs.7 V .36.

hf E ) ro / hiE tanda minus menunjukkan terjadi beda PENGUAT BERTINGKAT TUJUAN : MENDAPATKAN PENGUATAN BESAR Hubungan penguat bertingkat Vi (2) Vi (1) Vo (1) Vo (2) Vi (1) Vi (2) Vo(1) Vo(2) Vo Vi (a) (b) Gambar 2.Dasar Teknik Elektro/Rangkaian Listrik 2-39 Penguatan tegangan dapat ditentukan sebagai berikut Av = vo / vi vo = (RC //RL) (.hf E ) (RC //RL) / hiE bila (RC //RL) = ro (. Blok Hubungan penguat bertingkat (a) seri (b) paralel Analisis penguat bertingkat Penguat 2 tingkat susunan CE dengan CE dengan kopling RC + VCC RC2 C3 iL RL is Rs R1 ib1 VBE RC1 ib2 C2 R3 IE is C1 R2 vi VB R4 CE1 RE1 RE2 CE2 (a) .hf Eib ) untuk ib = vi / hiE maka vo = (RC //RL) (.hf E ) vi / hiE masing-masing dibagi vi didapatkan Av = vo / vi = Av = vo / vi = phase 180 o (.37.

pengganti model “h” ideal hiE2 = (26 mV hf E2) / IE2 hiE1 = (26 mV hf E1) / IE1 dan Penguatan arus Ai = iL / is = (iL / ib2) (ib2 / ib1) (ib1 / is) iL = {RC2 / (RC2 +RL) } (-hf E2ib2 ) ib2 = {rb2 / (rb2 + hiE2)} (-hf E1ib1 ) ib1 = {rb1 / (rb1 + hiE1)} is Bila disubstitusikan (iL / ib2) = {RC2 / (RC2 +RL) }(-hfE2) (ib2 / ib1) = {rb2 / (rb2 + hiE2)} (-hf E1) (ib1 / is) = rb1 / (rb1 + hiE1) Maka Ai = -hfE2 {RC2 / (RC2 +RL) } {rb2 / (rb2 + hiE2) (-hf E1) } rb1 / (rb1 + hiE1) Bila hiE1 << rb1 Maka hiE2 << rb2 dan RL << RC2 Ai = (-hf E1) (-hfE2) (1) = + (hf E1) (hfE2) …….2-40 Dasar Teknik Elektro/Rangkaian Listrik B1 Rs R2 R1 ib1 hiE1 hf E1ib1 E1 RC1 C1 R4 B2 ib2 C2 is R3 hiE2 RC2 vo iL RL RC2 hfE2ib2 E2 rb1 = Rs // R2 // R1 (b) rb2 = RC // R4 // R3 ro = RC2 // RL Gambar 2. X Bila hf E1 = hfE2 = hf E n Ai total = (-hf E ) n n = jumlah penguat ( bila n genap = tak terjadi beda phase) . Penguat 2 tingkat CE dengan CE (a) Rangkaian dasar (b) Rangk..38.

Alat-alat ukur (listrik. Sedang dengan sistem analog penampilan besaran dengan jarum yang mudah bergoyang dan pembacaannya posisinya harus tegak lurus. Dua kondisi yang berlawanan ini sering disebut biner.BAB III KEGIATAN BELAJAR III DASAR TEKNIK DIGITAL A. panas. Perkembangan teknologi maju dengan pesat. waktu. OPERASI DIGITAL. Suatu sistem digital berfungsi secara biner. PENGANTAR. B. sehingga mudah dan cepat terbaca. Transistor didesain untuk bekerja pada daerah atau titik jenuh (saturasi) dan daerah atau titik mati (cut off). Sistem digital memberikan penampilan lebih akurat dan cepat sedang sistem analog kurang akurat dan lama. Saat ini disebut jaman digital. berat. Transistor tidak boleh didesain pada daerah aktif. . kecepatan dll) penampilan besaran sistem digital (angka). Komponen elektronik yang banyak dipakai adalah komponen aktip (dioda. Di bidang audio dan video sistem digital memberikan suara nyaring (HiFi) dan gambar jernih. Semua peralatan canggih menggunakan sistim digital yang sebelumnya menggunakan sistem analog. transistor) baik secara terurai (discrete) maupun terintegrasi (integrated). Pada titik jenuh transistor menghasilkan arus/tegangan tinggi (H) sedang pada titik mati transistor menghasilkan arus/tegangan rendah (L).

sinyal analog yang merupakan masukan harus diubah menjadi sinyal digital melalui pencacah dan dikembalikan lagi menjadi bentuk analog. Demikian juga untuk bilangan dari bilangan puluhan diubah menjadi bilangan biner dan dikembalikan ke bilangan puluhan. 23 + (0). Contoh Mengubah bilangan puluhan ke biner Bilangan puluhan 9 dapat ditulis 9 (10) = bilangan biner 1001(2) 9 = 23 +1 = (1).5 = 1 0 0 0 1 + 0. Kondisi biner Tabel 3. ( 1/21 ) + 0. ditambah = 1.125 1 9. 22 +(0) 21 +(1)20 = 1 .625 = 1 0 0 1. (1/22 )+ 1.625 = 0.(1/23) .2-42 Dasar Teknik Elektro/Rangkaian Listrik 1. a.1 kondisi biner Kondisi Salah satu kondisi Kondisi yang lain 1 2 3 4 naik 5 ada 6 on off 7 8 9 10 ya tidak benar (H) 1 salah (L) 0 panas tutup nyala dingin buka padam turun tak ada Dari tabel di atas kondisi biner yang paling tepat digunakan adalah kondisi 3 yaitu 1 dan 0 atau H dan L yang merupakan standar bilangan biner.625 = 9 + 0. Bilangan Biner Sistem komputer dan peralatan digital menggunakan 2 (dua) kondisi yaitu :1 (ON) dan 0 (OFF) disebut sistem bilangan dua-an (biner) atau sistem digit Bilangan yang digunakan untuk keperluan awam adalah bilangan arabic yaitu bilangan dari 0 sampai 9 atau bilangan puluhan atau dasan Untuk peralatan elektronik sistem digital.

(1/25) = 0.096 213=8. 36 =64 .(1/23)+ 1. 27 =128 28=256 29=512 210=1.(1/22)+ 0.Dasar Teknik Elektro/Rangkaian Listrik 2-43 9.11011 = 1.384 1/(20)= 1 .03125 = 0. 1 /(21) =0.25 + 0 + 0. (inver) digit kali seper biner pangkat n Biner berpangkat 20 = 1 .23 + (1). digit kali biner pangkat n.0625 1/(25 )=0. 23=8 . 1/( 23)=0. 25 =32 .625 = 1001.625 x 2 = 1.11011= 14. 1/( 24)=0. PENGURANGAN DAN PERKALIAN BILANGAN BINER 1 1 10010001 0x0=0 1001 1 1 111111 1x0=0 11 1 + 0x1=0 x + 1 0 1010010 1x1=1 1001 1 1 1001 + 11 011 n = jumlah digit .024 211 =2.(1/21)+ 1.21 +(0).5 .5 + 0.25 x 2 = 0.84375 Catatan: bilangan kiri koma. bilangan kanan koma.25 .101 Cara pembagian dengan bilangan biner (untuk bilangan utuh): bilangan 9 9 : 2 = 4 sisa 1 4 : 2 = 2 sisa 0 2 : 2 =1 sisa 0 1 : 2 = 0 sisa 1 0.125 .25 0.625 Mengubah bilangan Biner ke puluhan 1110(2) = 14(10) = (1).192 14 2 =16.2 2 +( 1). 1/(22)=0. 24=16 .11011 = 14 ditambah .03125 PENJUMLAHAN .(1/24)+1.50 x 2 = 1.048 212=4. 22=4 .00 1 0 0 1 1 ( bil dasar x biner >1=logik 1) 0 ( bil belakang koma pertama x biner<1 = logik 0) 1 (bil belakang koma kedua x biner >1 = logik 1) Cara perkalian dengan bil biner (untuk bilangan pecahan) bilangan 0.50 0. 21=2 .84375 1110.20 = 8 + 4 + 2 + 0 = 14 1110.0625 + 0.

yaitu : 1. Ada 7 gerbang logika yang kita ketahui yang dibagi menjadi 2 jenis. Simbol NOT Gambar 3. Rangkaian logika sering kita temukan dalam sirkuit digital yang diimplemetasikan secara elektronik dengan menggunakan dioda atau transistor. Rangkaian inverter berupa transistor Comon Emitor yang mempunyai sifat membalik masukan. Rangkaian logika NOT .2-44 Dasar Teknik Elektro/Rangkaian Listrik Rangkaian Gerbang (Gate ) Logika Gerbang logika adalah rangkaian dengan satu atau lebih dari satu sinyal masukan tetapi hanya menghasilkan satu sinyal berupa tegangan tinggi (H)atau tegangan rendah (L). Gerbang logika Inventer (pembalik) Inverter merupakan gerbang logika dengan satu sinyal masukan dan satu sinyal keluaran dimana sinyal keluaran selalu berlawanan dengan keadaan sinyal masukan.2.1 Rangkaian inverter /Not Inverter disebut juga gerbang NOT atau gerbang komplemen (lawan) disebabkan keluaran sinyalnya tidak sama dengan sinyal masukan. Hasilnya berlawanan. Kebenaran/Logika Inverter Output (Y) Input (A) Rendah 0 Tinggi 1 Tinggi 1 Rendah 0 Gambar 3.3. Dikarenakan analisis gerbang logika dilakukan dengan Aljabar Boolean maka gerbang logika sering juga disebut Rangkaian logika. E A 1 Y Gambar 3.2. +Vcc Tabel 3.

NAND. lampu Y akan nyala (1) apabila saklar A dan/AND B tertutup (1) A B A D1 D2 I R Y E Y 1 B E 0 Gambar 3. OR. Rangkaian Dioda AND . NOR. Gerbang logika non-Inverter Berbeda dengan gerbang logika Inverter yang sinyal masukannya hanya satu untuk gerbang logika non-Inverter sinyal masukannya ada dua atau lebih. Logikanya. Yang termasuk gerbang logika non-Inverter adalah : Gerbang AND Gerbang AND mempunyai dua atau lebih dari dua sinyal masukan tetapi hanya satu sinyal keluaran. Logika AND Gambar 3. 2. Y = .A Misal : A = 1.Dasar Teknik Elektro/Rangkaian Listrik 2-45 Logikanya. lampu Y akan menyala bila saklar A tidak/Not tertutup atau tidak 1 dalam arti lain saklar terbuka atau 0 Fungsi gerbang NOT Y = NOT A Y= A atau . XNOR).4. sedang outputnya satu sehingga hasil (output) sinyal keluaran sangat tergantung oleh sinyal masukannya dan gerbang logika yang dilaluinya (AND. XOR. maka Y = 1 atau Y = NOT 0 = 1.5. A = 0. maka Y= -1 = 0 atau Y = NOT 1 = 0. Gerbang AND mempunyai sifat bila sinyal keluaran ingin tinggi (1) maka semua sinyal masukan harus dalam keadaan tinggi (1).

Tabel 3. B = 1 maka Y = 1 . Input (A) 0 0 1 1 Input (B) 0 1 0 1 Output (Y) 0 0 0 1 ANALISIS TEORITIS Untuk menganalisis secara teoritis hasil keluaran Y dari gerbang AND harus dipahami dahulu karakteristik dioda ideal. A = 1 . Tegangan pada output Y = {(Ro) /(Ro) + R }E = { =0 Saat A = 0 .3. B = AB Misal :A = 1 . Logika AND dengan dua masukan. B = 0 0 / (0 + R) } E = ( 0 /R ) E . B = 1 akan sama saat A = 1 . B = 0 maka Y = 1 . 0 = 0. Saat dioda ON (kondisi forward = maju) tahanan RF = 0 sedang saat OFF (kondisi reverse = mundur) tahanan RR = ~ (tak terhingga) Pada saat A = 0 B = 0 kedua dioda kondisi maju sehingga tahanan output (Ro) sebesar Ro = RF1 //RF2 = 0//0 = 0.2-46 Dasar Teknik Elektro/Rangkaian Listrik Fungsi gerbang AND Y = A AND B Y = A . 1 = 1.

B =1 bagian output akan terbuka ini berarti tahanan output Ro = ~ sedang kedua dioda parallel dengan R dianggap RR1 // RR2 // R = R Tegangan pada output Y = { Ro / (Ro + R) } E = (Ro / Ro ) E = E = 1 Tabel 3. Simbol Gerbang AND .Dasar Teknik Elektro/Rangkaian Listrik 2-47 Dioda pada output kondisi maju sehingga Ro = RF1 = 0 sedang dioda lainnya kondisi mundur RR2 = ~ dan parallel dengan R sehingga RR2 // R = ~ // R = R Tegangan pada output Y = { Ro / Ro + (RR2 // R) } E = { 0 / ( 0 + R )} E = 0 Saat A = 1 . Input (A) 0 0 0 0 1 1 1 1 Input (B) 0 0 1 1 0 0 1 1 Input (C) 0 1 0 1 0 1 0 1 Output (Y) 0 0 0 0 0 0 0 1 R << RR2 Ro >> R * untuk mempermudah mengetahui jumlah kombinasi sinyal yang harus dihitung berdasarkan inputanya.6. jadi jumlah kombinasi sinyal yang harus dihitung sebanyak 4 kali Gambar 3. Contoh : 2 n n adalah jumlah input.4. Logika AND dengan tiga masukan. gunakan rumus ini : 2 . n = 2 maka 2 = 4.

Logika OR (a) Rangkaian dioda OR (b) rangkaian dioda OR Fungsi gerbang OR : Y = A OR B Y = A + B. B = 1 maka Y = 1 + 1 = 1. A = 1 . Logika Gerbang OR dengan dua masukan.2-48 Dasar Teknik Elektro/Rangkaian Listrik Gambar 3.5. Misal : A = 1 . Tabel 3. B = 0 maka Y = 1 + 0 = 0.8. Gerbang OR mempunyai sifat bila salah satu dari sinyal masukan tinggi (1). Simbol Gerbang AND dengan tiga inputan Gerbang OR Gerbang OR mempunyai dua atau lebih dari dua sinyal masukan tetapi hanya satu sinyal keluaran. lampu Y akan nyala (1) apabila saklar A atau/OR B atau keduanya tertutup (1) A A B E Y 1 B E 0 D1 D2 I Y R (a) (b) Gambar 3. Logikanya. maka sinyal keluaran akan menjadi tinggi (1) juga. Input (A) Input (B) 0 0 0 1 1 0 1 1 Output (Y) 0 1 1 1 .7.

6. Gambar 3. Gerbang NAND mempunyai sifat bila sinyal keluaran ingin rendah (0) maka semua sinyal masukan harus dalam keadaan tinggi (1).Dasar Teknik Elektro/Rangkaian Listrik 2-49 Analisis teoritis Analisis teoritisnya sama seperti analisis pada AND hasil tegangan output sama seperti pada tabel gerbang A Tabel 3. Simbol Gerbang OR dengan tiga masukan.10. Logika Gerbang OR dengan tiga masukan.9. Simbol Gerbang OR. Input (A) 0 0 0 0 1 1 1 1 Input (B) 0 0 1 1 0 0 1 1 Input © 0 1 0 1 0 1 0 1 Output (Y) 0 1 1 1 1 1 1 1 Gambar 3. . Gerbang NAND (Not-AND) Gerbang NAND mempunyai dua atau lebih dari dua sinyal masukan tetapi hanya satu sinyal keluaran.

Input (A) 0 0 0 0 1 1 1 1 Input (B) 0 0 1 1 0 0 1 1 Input (C) 0 1 0 1 0 1 0 1 Output (ABC) 1 1 1 1 1 1 1 0 . Rangkaian NAND Fungsi gerbang NAND : Misal : A = 1 .1= = 0.11. B = 1 maka =1.8. Input (A) 0 0 1 1 Input (B) 0 1 0 1 Output (AB) 1 1 1 0 Tabel 3. Logika Gerbang NAND dengan tiga masukan. Tabel 3. Logika Gerbang NAND dengan dua masukan.2-50 Dasar Teknik Elektro/Rangkaian Listrik R A E 1 B 0 D1 D2 I R Y Gambar 3.7.

Dasar Teknik Elektro/Rangkaian Listrik 2-51 Gambar 3.12. Gambar 3.15.14. Simbol Gerbang NAND standar Gambar 3. Simbol-simbol gate . Gerbang NAND dalam arti logikanya Gambar 3.13. Simbol Gerbang NAND tiga masukan Gerbang NAND juga disebut juga Universal Gate karena kombinasi dari rangkaian gerbang NAND dapat digunakan untuk memenuhi semua fungsi dasar gerbang logika yang lain.

Jadi gerbang NOR hanya mengenal sinyal masukan yang semua bitnya bernilai nol. Logika Gerbang NOR dengan dua masukan Input (A) 0 0 1 1 Input (B) 0 1 0 1 Output (A + B) 1 0 0 0 . R A E 1 B 0 D1 D2 I R Y Gambar 3.2-52 Dasar Teknik Elektro/Rangkaian Listrik Gerbang NOR (Not-OR) Gerbang NOR mempunyai dua atau lebih dari dua sinyal masukan tetapi hanya satu sinyal keluaran. Rangkaian NOR Fungsi gerbang NOR : Misal : A = 1 .16. Tabel 3. Gerbang NOR mempunyai sifat bila sinyal keluaran ingin tinggi (1) maka semua sinyal masukan harus dalam keadaan rendah (0). B = 1 maka =1+1= = 0.9.

17.19.Dasar Teknik Elektro/Rangkaian Listrik 2-53 Tabel 3. Exclusive-OR) Gerbang XOR disebut juga gerbang EXCLUSIVE OR dikarenakan hanya mengenali sinyal yang memiliki bit 1 (tinggi) dalam jumlah ganjil untuk menghasilkan sinyal keluaran bernilai tinggi (1). Logika Gerbang NOR dengan tiga masukan. .10. Simbol gerbang NOR dalam arti logikanya Gambar 3. Simbol gerbang NOR standar Gambar 3.18. Input (A) 0 0 0 0 1 1 1 1 Input (B) 0 0 1 1 0 0 1 1 Input (C) 0 1 0 1 0 1 0 1 Output (A + B + C) 1 0 0 0 0 0 0 0 Gambar 3. Simbol gerbang NOR tiga masukan Gerbang XOR (Antivalen.

Not-Exclusive-OR) Gerbang XNOR disebut juga gerbang Not-EXCLUSIVE-OR. Logika Gerbang XOR dengan dua masukan Input (A) 0 0 1 1 Input (B) 0 1 0 1 Output (AB + AB) 0 1 1 0 Gambar 3.11. Gerbang XNOR mempunyai sifat bila sinyal keluaran ingin benilai tinggi (1) maka sinyal masukannya harus benilai genap (kedua nilai masukan harus rendah keduanya atau tinggi keduanya).20. Logika Gerbang XOR dengan dua masukan Input (A) 0 0 1 1 Input (B) 0 1 0 1 Output (Y) 1 0 0 1 Tabel Logika Gerbang XNOR dengan dua masukan . Simbol gerbang XOR standar Gerbang XNOR (Ekuivalen.12.2-54 Dasar Teknik Elektro/Rangkaian Listrik Fungsi gerbang XOR : Tabel 3. Fungsi gerbang XNOR : Tabel 3.

Simbol gerbang XNOR Latihan Soal : 1.Dasar Teknik Elektro/Rangkaian Listrik 2-55 Gambar 3. D) Tabel Logika A 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 B 0 0 0 0 1 1 1 1 0 0 0 0 1 1 1 1 C 0 0 1 1 0 0 1 1 0 0 1 1 0 0 1 1 D 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 Y 0 0 0 1 0 0 0 1 0 0 0 1 1 1 1 1 . B) + (C .21. Diketahui rangkaian digital seperti ini : Carilah persamaan booleannya dan tabel logikanya ? Jawaban Soal : Persamaan booleannya : Y = ( A AND B) OR (C AND D) Y = (A .

0 =1 Y = (A . 3. Diketahui rangkaian digital seperti berikut ini : Carilah persamaan booleannya dan jika diketahui nilai inputan A dan B tinggi (1) dan yang nilai inputan yang lain rendah (0) maka cari nilai hasil keluarannya ? Jawaban Soal : Persamaan booleannya : Y = (A AND B) OR (C AND D ) OR (E AND F) Hasil nilai keluaran. B = 1 . B) + (C .2-56 Dasar Teknik Elektro/Rangkaian Listrik 2.D+E. bila A & B = 1 : Y=A. C = 1 maka Y = 1.F =1.B+C.1+0.1. F) . Diketahui rangkaian digital seperti ini : Carilah persamaan booleannya dan contoh dari masukannya ? Jawaban Soal : Persamaan booleannya : NOT (A AND B AND C) Contoh masukan : A= 1 .1 = . D) + (E .0+0.

Dasar Teknik Elektro/Rangkaian Listrik 2-57 4. (C+ D) . Diketahui rangkaian digital seperti ini : Carilah persamaan booleannya dan tabel logikanya ? Jawaban Soal : Persamaan booleannya : Y = (A OR B) AND (C OR D) Tabel Logika : A 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 B 0 0 0 0 1 1 1 1 0 0 0 0 1 1 1 1 C 0 0 1 1 0 0 1 1 0 0 1 1 0 0 1 1 D 0 1 0 1 0 1 0 1 0 1 0 1 0 1 0 1 Y 0 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 Y= (A + B) .

penjumlahan b. AND d. perkalian 9.58 Soal Teknik Digital A. Gerbang NOR menghasilkan logic yang berlawanan dengan gerbang a. satu input dua output b. pembagian d. saturasi c. NOT b. pengurangan c. AND d. OR c. satu input satu output d. OR c. 0 0 0 1 B. penjumlahan b. 1 0 0 0 c. 1 1 1 0 d. invertor 4. OR b. mati d. Gerbang AND merupakan operasi digital untuk a. 1 0. A 1 B E 0 D1 I Y R D2 . 0 1 1 1 b. Bila gerbang AND dihubungkan dengan gerbang NOT dan diberi masukan 0 0. Gerbang yang menghasilkan 1 bila semua input 1 adalah gerbang a. A=0 B=1 . inkubator 5. Transistor didesain sebagai rangkaian gerbang bekerja pada daerah a. 0 1. Gerbang NOT sering juga disebut gerbang a. EXOR 3. 0 1. perkalian d. Gerbang yang menghasilkan 1 bila salah satu atau semua masukan 1 adalah gerbang a. saturasi dan mati 6. 1 1 1 0 d. 1 0 0 0 c. 1 0. pembagian 8. NOT b. 0 0 0 1 10.Buktikan bahwa output (Y) dari rangkaian gerbang OR di bawah ini menghasilkan 0 1 1 1 bila input A = B = 0 . NOT c. aktip b.Soal Obyektif 1. EXOR 2. indikator b. dua input dua output c. Bila gerbang OR dihubungkan dengan gerbang NOT dan diberi masukan 0 0. Gerbang OR merupakan operasi digital untuk a. Gerbang NOT mempunyai a. 1 1 akan menghasilkan a. 1 1 akan menghasilkan a. pengurangan c. Essay 1. dua input satu output d. AND d. NAND 7. A=1 B=0 dan A=B=1 bila dioda ideal. 0 1 1 1 b. induktor c.

A=0. I dengan II b. Ai = 10 Log (Vo / Ro) c. Salah satu keuntungan dari komponen semikonduktor adalah a. hiE = 26 mV ( hfE/ IB) c. 12 x 0. r m s 8. Dimensi besar 3. 12 x 0.Filament pada tabung electron digunakan untuk membangkitkan : a. IV dengan V 4.Logam tipe N merupakan doping antara logam-logam golongan : a. peack to peack d. Penyearah gelombang penuh cara jembatan tanpa filter bila tegangan primer 12Veff maka tegangan keluaran DC sebesar: a. c) atau d) 1. 12 x 1. B=1 c. Miniatursasi d. effektif b. basis – kolektor forward . emissi benturan 2. Logam tipe P merupakan doping antara logam-logam golongan : a. Ai = 10 Log (Po/ Eo ) b. hiE = 26 mV ( hfE/ IE) 10. emitor – basis reverse b. IV dengan V 5.318V b. II dengan III c. III dengan IV d. emisi tegangan b. A=1. emitor – basis forward . emisi sinar d. rata-rata c. Ai = 20 Log ( Io /Ii) d. emissi thermis c. b). Syarat kerja transistor adalah: a. Osiloscope mengukur tegangan listrik dalam satuan tegangan: a. Besar impedansi input model “h” untuk common emitor adalah: a. kolektor – basis reverse c.414 x 0. hiE = 26 mV ( hoE/ IE) b. I dengan II b. III dengan IV d. II dengan III c.Besar penguatan arus dalam satuan dB adalah: a.Gerbang AND akan menghasilkan logika 1 bila masukan A dan B : a. kolektor – emitor forward d. emitor – basis reverse . Ai = 20 Log (Ii / Io) .59 SOAL-SOAL ELEKTRONIKA Pilih jawaban yang betul dengan memberi tanda X pada a). 12 x 0. Daya besar b. A=B=0 b. A=B=1 6. B=0 d. kolektor – emitor forward 9. Panas tinggi c. kolektor – emitor forward . hiE = 26 mV ( hrE/ IC) d.636V c.707 V d.636V 7.

Rangkaian model “ h “ ideal. Rangkaian DC b. R1 C1 IB IC RC C2 is RS R2 C3 VCC CE RE1 IE RE 2 . Rangkaian AC c.60 Dari rangkaian penguat common emitor di bawah ini: Gambarlah: a.

BUKU AJAR Medan Elektro Magnetik .

medan magnet dan gabungan antara keduanya yang membentuk medan elektromagnetik. dalam bentuk muatan bidang (permukaan) dan dalam bentuk volume. Karena itu penguasaan tentang analisis vektor dalam beberapa sistem koordinat dimensi tiga mutlak harus dikuasai. Juga dibahas mengapa gaya ini bisa timbul yaitu karena sebenarnya di sekeliling suatu muatan listrik ada suatu daerah yang dilingkungi oleh flux listrik yang mengakibatkan adanya medan listrik. Karena pada kenyataannya muatan terdiri dari berjuta-juta dan bahkan trilyunan partikel maka partikel-partikel tersebut akan membentuk distribusi-distribusi tertentu. Selanjutnya karena sifat partikel yang bermuatan listrik negatif yaitu elektron dapat bergerak maka fenomena yang timbul jika elektron bergerak . Keseluruhan perhitungan dan analisis yang digunakan untuk membahas medan listrik maupun medan magnet dan medan elektromagnetik ini harus dilakukan dalam dimensi ruang atau minimal dalam dimensi tiga karena analisis mengenai medan ini hampir keseluruhannya berkaitan dengan besaran vektor yang berada dalam ruang. Secara garis besar muatan terdistribusi dalam bentuk baku yaitu dalam bentuk muatan garis.BAB I PENDAHULUAN Mata kuliah Medan Elektromagnetika ini membahas mengenai medan listrik. Selanjutnya akan dibahas mengenai hal-hal yang berkaitan dengan medan listrik ini yaitu intensitasnya. kerapatan fluxnya dan potensial serta energi yang dimiliki oleh medan listrik. gaya tersebut adalah gaya Coulomb. Pada medan listrik akan dibahas mengenai gaya yang timbul sebagai akibat interaksi dari dua partikel bermuatan listrik yang terletak berdekatan. karena itu untuk menentukan muatan totalnya perlu dilakukan perhitungan dalam bentuk integrasi.

hukum Lenz dan konsep Gaya Lorenz. karena pada dasarnya cahaya adalah gelombang elektromagnetik. B.3-2 Medan Elektromagnetika yang timbul bukan medan listrik yang berubah tetapi akan timbul medan magnet. hukum Faraday. Mempelajari dengan seksama tentang kajian diferensial – integral. hukum Gauss. medan listrik. . fisika listrik dan analisis vektor. Deskripsi Ruang lingkup kajian dalam materi ini meliputi: (1) medan elektro statik yang mempelajari tentang hukum Coulomb. A. dan jika medan magnet mengalami perubahan atau mengalami pergerakan maka akan timbul arus listrik atau berarti akan timbul medan listrik. potensial listrik. perlu kiranya disiapkan langkah-langkah: a. Efek timbal balik inilah yang oleh Maxwell didefinisikan sebagai adanya medan elektromagnetik. hukum Kirchoff tentang tegangan. hukum Biot – savart. Prasyarat Untuk menelaah kajian medan elektromagnetika disarankan menguasai materi-materi diferensial dan integral. fisika listrik dan analisis vektor terlebih dahulu agar diperoleh pemahaman yang mantap. hukum Joule. yaitu timbulnya medan listrik dan medan magnet secara bersamaan dengan arah rambat yang saling tegak lurus tetapi dengan kecepatan rambat yang sama besar yaitu sebesar kecepatan cahaya. hukum Ohm. Petunjuk Belajar Agar dapat memahami materi buku ini dengan mudah. maupun hukum Kirchoff tentang arus. (2) Medan magnet listrik yang memiliki lingkup bahasan tentang: hukum Amper. C. flux listrik.

Menyelesaikan permasalahan yang terkait dengan medan elektromagnetika dan teori-teori ikutannya. Menyelesaikan permasalahan yang terkait dengan medan elektro statika. Memahami tentang medan elektromagnetika c. Kompetensi dan Indikator Kompetensi: Kompetensi yang diharapkan dalam mengkaji materi medan elektromagnetika adalah: a. . sehingga mudah untuk mengingat dan menggunakan D.Medan Elektromagnetika 3-3 b. Memperbanyak latihan mengerjakan tugas-tugas agar diperoleh ketrampilan intelektual yang mantap c. Membuat catatan-catatan kecil dalam bentuk kartu. Memahami tentang medan elektromagnetika berubah terhadap waktu Indikator: a. flux listrik. hukum Gauss dan teori-teori ikutannya. Memahami tentang medan elektro statika b. Melakukan kajian komparatif dengan pengalaman-pengalaman praktis (empiris) d. b.

..BAB II KEGIATAN BELAJAR I ELEKTRO STATIKA A........85 x 10-12 F/ni = 8............................................................... Konsep Dasar Elektro Statika 1..............(2.......................(2... Q2 = muatan masing-masing partikel dalam satuan newton r k = jarak antara partikel yang bermuatan = konstanta dalam sistem internasional k= ∈ ∈0 l 4πε = permittivity medium antara partikel = permittivity vakum = 8.......... Hukum Coulomb Hukum Coulomb dapat dituliskan persamaan berikut: F Q1Q2 newton..........2) 4π ∈ r 2 = vektor satuan ...............1) r2 = gaya yang bekerja pada partikel yang bermuatan (pada Q1 dan Q2) F =k dalam newton Q1................85ρF/ni Karena F (gaya) suatu besaran vektor maka persamaan diatas (2....1) perlu dikalikan vektor satuan (r) sehingga berubah menjadi: F= r Q1Q2 ˆ r..

.. Medan Listrik Bila konsep Hukum Coulomb ini diterapkan untuk konsep medan listrik (E) menunjukkan intensitas medan listrik adalah: Qe F E F Qe = muatan eksperimen yang mendapatkan gaya bila berada dalam E= medan listrik = gaya yang dirasakan oleh Q exp = intensitas medan listrik di titik Q berada.......... maka: F Q1 ˆ r...(2......Medan Elektromagnetika 3-5 2.... Bila dinyatakan dalam model matematis: Ep = E1 + E2 +……….....Em = medan yang ditimbulkan oleh muatan pada titik 1................3) = Qe 4π ∈ r 2 Qe = Q1 = muatan test positif E= E = intensity medan listrik dalam NC-1 (Vm-1) Bila muatan partikel lebih dari satu titik...+ Em ……………………………………………(2.....….... maka besarnya medan listrik di suatu titik muatan test adalah jumlah vektor semua medan yang mempengaruhi muatan test tersebut......... ....4) Ep = medan di titik P (titik dimana muatan test ditempatkan) E1........... muatan garis.... Jika Qe positif maka gaya per satuan muatan adalah intensitas medan listrik.. 2..n Konsep dasar ini melandasi intensitas medan listrik yang ditimbulkan oleh muatan titik......... ….......... E2. muatan bidang maupun muatan ruang (volume)...

...3-6 Medan Elektromagnetika 3..............(2..5) x2 x2 x1 x1 Bila konsep medan E seperti dinyatakan oleh persamaan (2...5) diperoleh persamaan: V21 = − ∫ Q dr 2 x 2 4π ∈ r Q ⎡1 1 ⎤ ⎢ − ⎥ 4π ∈ ⎣ r1 r2 ⎦ x1 =− R1.. dalam medan listrik homogen E maka besarnya kerja diberikan ke muatan test posisif tersebut merupakan besarnya potensial listrik antara x2 ke x1 V = Force work xlenght = Ch arg e Ch arg e Konsep pendefinisian di atas bila ditunjukkan dalam model matematis adalah: V21 = ∫ dv = − ∫ Edr................ r2 = panjang jarak perjalanan muatan test Q sampai titik x1 dan x2...... Potensial Listrik Bila konsep medan listrik ini dikembangkan kajiannya untuk menjawab pertanyaan tentang potensial listrik............ Bila lintasan gerakan muatan test positif tersebut terhadap arah medan membentuk sudut θ..... maka besarnya beda potensial antara kedua titik dinyatakan dalam model matematis berikut: ................................ Bila E X2 X1 dilakukan eksperimen membawa muatan test Positif dari x2 ke x1..3) dan persamaan ini disubstitusi ke dalam persamaan (2..

penulisan model matematisnya adalah: Q L Q ρS = S Q ρV = V ρL = ρL = rapat muatan garis ρS = rapat muatan luas ρV = rapat muatan volume L = panjang garis bermuatan S = luas bidang partikel bermuatan V = besar volume partikel bermuatan Bilamana suatu medan listrik ditimbulkan oleh: ...(1.....dl. Rapat Muatan (Charge density) Rapat muatan listrik adalah jumlah (besaran) total dibagi energi panjang / luas / volume....6) a b E = vektor medan listrik l = vektor panjang lintasan Nilai kerja tak tergantung dari bentuk lintasan tetapi panjang (jarak lintasan)..... Dari konsep rapat muatan di atas maka..Medan Elektromagnetika 3-7 Vab = ∫ dv = − ∫ E cosθdl a a b b Vab = − ∫ E.............. ρL = rapat muatan untuk satuan panjang ρS = rapat muatan untuk satuan luas ρV = rapat muatan untuk satuan volume.........

Q2. Qm adalah: n 1 Q ∑ rn 4π ∈0 n =1 n Potensial yang ditimbulkan muatan terdistribusi sepanjang garis Vp = • V L= 1 4π ∈ ∫ ρL r dl • potensial yang ditimbulkan muatan bidang V L= 1 4π ∈ ∫ ∫ ρS r ds • potensial yang ditimbulkan muatan volume V L= 1 4π ∈ ∫ ∫ ∫ ρV r dv • Besar potensial total akibat Vp.3-8 Medan Elektromagnetika Jumlah n titik bermuatan maka: jumlah total potensial di sustu titik adalah jumlah aljabar dari komponen potensial secara individu oleh masing-masing muatan terhadap titik dimaksud. Rumusan singkat potensial listrik • potensial yang ditimbulkan sebuah muatan titik ialah kerja yang diperlukan untuk membawa satu satuan muatan positif dari tak terhingga ke titik yang dicari potensialnya. …. • Medan potensial yang ditimbulkan oleh sejumlah muatan titik merupakan jumlah dari medan potensial masing-masing muatan tersebut . Pernyataan ini dapat ditulis dalam bentuk model matematis berikut: • Potensial yang diakibatkan n buah titik bermuatan Q1. VL. VS dan VV adalah: + VV V = Vp + VL + VS Dasar konsep ini sebagai dasar teori superposisi.

......………………(2...............................dL.......... Mencermati persamaan (1........................ Konsep diatas dengan rumusan matematis (acuan nol di tak terhingga): VA = − ∫ E.........Medan Elektromagnetika 3-9 • Potensial yang ditimbulkan sejumlah muatan titik atau distribusi muatan medan dapat diperoleh dengan membawa satu satuan muatan positif dari tak terhingga ke titik yang dicari potensialnya sepanjang lintasan sembarang yang kita pilih..................................(2...........7) bilamana didefinisikan akan memperoleh persamaan baru secara umum adalah: = − E...dL B A Perlu diingat untuk integral garis (L) tidak tergantung dari lintasan yang dipilih.......(2..dL = 0 Persamaan ini merupakan bentuk umum Hukum Kirchoff untuk tegangan..............9) dV dL .....................7) bila dikaji lebih lanjut dapat diperoleh konsep berikut: • • • Besar intensitas medan listrik sama dengan harga maksimum laju perubahan potensial terhadap jarak Harga maksimum didapat saat arah pertambahan jarak berlawanan arah E Persamaan (2.......................7) ≈ A Atau beda: VAB = VA − VB = − ∫ E....... Oleh karena itu untuk kerja yang diperlukan untuk lintasan tertutup ialah nol atau: ∫ E..8) Persamaan ini disebut gradient potensial (∇V) atau : Gradien V = grad V = ∇V = -E ……………………………........

........(2....ds = Q Memperhatikan hubungan antara medan listrik (E) dengan kerapatan flux listrik (D) yang besarnya : Q Q ˆ ˆ rmaka rdanD = 2 4π ∈ r 4πr 2 D = ∈E E= Karena konsep kerapatan flux adalah muatan per satuan luas. Flux Listrik Flux listrik (ψ) yang melewati setiap tabung adalah konstant.... Cm-2 A = luas penampang tabung.... Hukum Gauss Flux listrik yang menembus setiap permukaan tertutup sama dengan muatan total yang dilingkungi oleh permukaan tersebut. m-2 Dan bentuk persamaan umumnya adalah: ψ = ∫ ∫ D. yang mana D = kerapatan flux listrik ..ds = mua tan yangdilingkungi = Q......10) s ψ = flux listrik yang menembus permukaan tertutup ..ds Dan flux listrik total yang ditimbulkan muatan (Q) adalah: ψ = ∫ ∫ D....ds = ∫ ∫ Dn ......... C m-2 ∈ = Permittivity medium F m-1 E = intensity medan listrik V m-1 5.... Rumusan matematis dari Hukum Gauss ialah: ψ = ∫ DS . dan dinyatakan dengan persamaan berikut: ψ=DA (C) D = kerapatan flux rata-rata......3-10 Medan Elektromagnetika 4......

. Sedangkan kajian lebih lanjut tentang konsep potensial (tegangan) listrik untuk lintasan tertutup akan melandasi hukum Kirchoff untuk tegangan (KVL) yakni: VAB = − ∫ E.... Kajian lanjut dari hukum Gauss bila diperuntukkan pada materi bermuatan adalah sebagai berikut: • Bola bermuatan................ π = jari-jari bola E= Q • • • flux density (D) di bidang permukaan konduktor besarnya adalah sama dengan charge density (rapat muatan) pada permukaan tersebut..(2............dl b a Vaa = VAab − Vba = ∫ E...........A V=Ed A = luas permukaan plat (kapasitor) .Medan Elektromagnetika 3-11 ∫ S = int egralpermukaantertutup Ds = rapat flux pada permukaan Kajian dari hukum Gauss ini akan melandasi konsep Hukum Kirchoff tentang arus (Kirchoff Current Law = KCL)...... Dn = ρs → ρs = rapat muatan bidang permukaan................ Besarnya kapasitas (C) kapasitor adalah: C= Q V Dimana Q = D...............................dl = 0..........11) Persamaan ini melandasi hukum Kirchoff untuk tegangan (KVL). maka medan listrik untuk bagian dalam adalah nol (E = 0) dan untuk permukaan dan di luarnya adalah: ˆ r 4πε 0 r 2 (π ≥ π1) .....dl Karena Vaa = 0 jadi: ∫ E.

3-12 Medan Elektromagnetika d = jarak antar plat kapasitor D = ∈E C= maka ∈A dalamFarad (F ) d Dan energi pada kapasitor 1 q. maka hubungan antara D dan E adalah: pada isolator Dn1 = ρs . maka pada bidang batas akan berlaku: α1 α2 medium 1 ∈1 x1 medium 2 ∈2 x2 tan α1 ∈1 = tan α 2 ∈2 D cosα1 D2 cosα 2 = E1 sin α1 E2 sin α 2 • Bila dua bahan konduktor dengan dielektrik (isolator) Besarnya nilai D atau E dalam konduktor adalah nol.dq C∫ 0 Q W = W = • 1 Q2 1 1 = CV 2 = QV 2 C 2 2 Bila dua bahan (lebih) dielektrik dipadukan.

..... D = ρ untuk daerah bebas muatan (ρ=0) ∇. D = 0 Dari hukum Gauss diperoleh hubungan ∫ D... Model matematis persamaan ini adalah: ∇........Medan Elektromagnetika 3-13 En1 = ρs ∈1 ......ds = ∫ ρ ............D = divD = ∂Dx ∂Dy ∂Dz + + ∂x ∂y ∂z nilai dari div D adalah ρ yaitu rapat muatan permukaan volume... Ini sebagai dasar persamaan Maxwell untuk differensial relation.............D..dv S V Bila persamaan dinyatakan dengan pernyataan adalah: “ Integral fungsi vektor atas permukaan tertutup akan sama dengan integral divergen fungsi vektor melalui permukaan volume setelah tertutup”. Et = 0 Et1 = tan −1 0 = 0 En1 Maka flux listrik pada bidang batas dielektrik – konduktor selalu tegak lurus pada bidang permukaan konduktor......(2.ds = ∫ ∇. D untuk ρ............... diperoleh persamaan baru: ∫ D.....12) n ΔV atau ∇.dv s V Dan ∇... . α1 = tan −1 • Bilamana flux density (D) dikenai operasi divergensi akan menghasilkan suatu persamaan lim ΔV → 0 ∫ D ds = divD = ρ ........

(2... diperoleh parameter hubungan sebagai berikut: “Besarnya beda tegangan (V) antara ujung konduktor sama dengan hasil kali antara resistans (R) dengan arus (I)” bila dinyatakan dalam model matematis: V = IR atau R = V/I ……………………………………………......14) Hubungan model matematis ini merupakan konsep hukum Ohm................... Hukum Joule Kajian antara hubungan daya (power) listrik dengan energi yang timbul (diserap) dilakukan oleh joule.13) Untuk ρ = 0 → ∇2V = 0 • Bilamana divergensi operator akan mendasari diperolehnya persamaan ∇ 2V = ∂ 2V ∂ 2V ∂ 2V + + ∂x 2 ∂y 2 ∂z 2 Laplace: 6..3-14 Medan Elektromagnetika • Bilamana divergensi operator akan mendasari diperolehnya persamaan ∇ 2V = − ρ ∈ Poisson: .. Ω T = waktu. dalam bentuk model matematis berikut: W = I2R T untuk I = arus listrik .... 7...... A R = resisitansi.... Hubungan antara voltage dengan arus Pada tahun 1826 George Simon Ohm melakukan eksperimen hubungan antara tegangan V pada sepanjang konduktor dengan arus I yang melewati konduktor tersebut.....(2.......... sekon .......

.ds Δv .... joule Hubungan ini disebut hukum Joule................ Pengembangan analisis divergensi untuk volume ∇V adalah: ∇J = 0 …………………………………………………………………...... Divergence Current Density (∂) Kerapatan arus (J) untuk elemen ∇V memiliki arah komponen koordinat pada sumbu x... Hukum Kirchoff Di bagian terdahulu telah ditunjukkan bahwa konsep tegangan telah melandasi ditemukannya hukum tentang tegangan yakni untuk lintasan tertutup (rangkaian tertutup) bahwa “ jumlah aljabar tegangan (voltage) adalah sama dengan nol” bila dinyatakan dalam model matematis: ∑ V = 0...Medan Elektromagnetika 3-15 W = energi...J = lim Δv → 0 ∫ J .... 8.............(2.17) 9... maka “jumlah aljabar arus yang melewati titik adalah sama dengan nol”.........18) sebab divJ = ∇. Pernyataan ini merupakan hukum Kirchoff untuk arus dan bila dinyatakan dalam persamaan adalah: ∑ I = 0…………………………………………………………………......... Secara spesifik hubungan hukum Kirchoff dengan hukum Ohm ditampilkan oleh persamaan: ∑ V = ∑ I R ……………………………………………………………….ds = 0............... y dan z...(2........(2.16) S Bilamana konsep ini diberlakukan pada suatu titik cabang... yaitu integral komponen normal rapat arus J pada permukaan tertutup adalah sama dengan nol atau ∫ J ...(2.........15) Sedangkan hukum Kirchoff untuk arus dilandasi oleh hukum Gauss..

(2.854 = 0.......ds = − dt Δv S dρ untuk arus I kontinyu.. Hukum Coulomb • Titik P bermuatan + 10 C dan titik Q bermuatan + 30 C..... Berapa gaya yang diderita oleh benda di titik P......7 x 108 N Newton • Dua plat sejajar berjarak 3 x 10-2 m dan masing-masing plat bermuatan listrik 10 x 10-4 C dan 9 x 10-4 C........... Latihan 1...277 x 1010 = 27.. sehingga ∇J = 0. Jarak kedua titik tersebut 3 m dan berada di ruang hampa......14 • 8. divJ = ∇.......854 • 10−12 • 302 10 • 1012 120 • 3. Berapa gaya yang diderita oleh kedua plat bila plat tersebut berada di ruang hampa? Penyelesaian: ........... Penyelesaian: F1 = F2 = Q1 • Q2 4πεoR 2 = = 10 • 30 4 • 3................ ∂ρ / ∂t = 0....J = − ∂ρ ..19) ∂t B......3-16 Medan Elektromagnetika sedangkan hubungan antara rapat muatan dengan rapat arus untuk suatu volume ∇V: maka: ∫ J ..14 • 8...

Berapa kuat medan di titik R tersebut? Penyelesaian: Medan di R adalah: ER = = Q 4πεoR 2 10−4 4 x3.025 x 106 = 2.996 x 103 N/C • Ketentuan seperti soal di atas dan titik S berjarak 6 m.14 x8. berapa medan di titik S? Penyelesaian: Medan di titik S: ES= Q 4πεoR 2 N/C = 0.854 x10−12 x(10) 2 = 10-4 x 1012 x 102 4 x 3.854 x10−12 (3x10− 2 ) 2 10 x9 x10−8 x1016 4 x3.14 x8.Medan Elektromagnetika 3-17 F1 = F2 = = = Q1 • Q2 4πεoR 2 (10 x10−4 ) x(9 x10−4 ) 4 x3.854 x9 = 8. Suatu titik R berjarak 10 m dari benda bermuatan.14 x8.5 x 104 V/m .854 = 0.14 x 8.8996 x 104 N/C = 8. Medan Listrik • Benda berukuran 10-4 C berada di ruang hampa.996 x 106 N 2.

Hukum Ohm • Suatu resistor 10 Ω diberi tegangan 10 volt.25 x 105 volt 4.14 x8.225 x 106 Volt = 2. berapa tegangan yang dipasang pada resistor tersebut? Penyelesaian: V=IR = 20 x 2 . Berapa beda potensial antara titik S dan T? Penyelesaian: VST = − ∫ RT RS Q dR 4πεo R 2 RT =− Q 4πεo RS dR ∫ R2 = 1 ⎤ Q ⎡ 1 − ⎥ ⎢ 4πεo ⎣ R S RT ⎦ 10 −4 4 x3.14 x8.85 x10−12 ⎡1 1⎤ ⎢2 − 4⎥ ⎣ ⎦ = = 10− 4 x1012 4 x3.3-18 Medan Elektromagnetika 3. ada dua titik S dan T berjarak dari benda bermuatan 2 m dan 4 m. Ketiga titik tersebut berada di ruang hampa.85 x 4 = 0. Potensial Listrik Benda A bermuatan 10-4 coulomb. berapa arus yang mengalir pada resistor? Penyelesaian: Hukum Ohm dalam model matematis: V = I R atau I = V R-1 I = 10 / 10 = 1 V / Ω = 1 A • Suatu resistor 20 Ω dialiri arus 2 A.

Medan Elektromagnetika 3-19 = 40 AΩ = 40 volt 5.30 A . Berapa arus yang keluar (meninggalkan) titik cabang? Penyelesaian: Hukum Kirchoff untuk arus pada titik cabang ditunjukkan oleh model matematis: ∑I=0 I 1 + I2 + I 3 = 0 10 A + 20 A + I3 = 0 I3 = .42 A • Suatu titik bercabang tiga. Berapakah arus yang dikeluarkan baterai? Penyelesaian: Hukum Kirchoff untuk lintasan tertutup dinyatakan dalam model matematis adalah: ∑ E = ∑ I R atau ∑ V = ∑ I R E1 + E2 = IR1 + IR2 I = (E1 + E2) x (R1 + R2)-1 = (12 + 9) x (10 + 40)-1 V/Ω = 21 x 50-1 V/ Ω = 0. dua cabang berarus 10 A dan 20 A menuju titik titik tersebut. Hukum Kirchoff • Dua baterai 12 volt dan 9 volt diseri dan digunakan untuk mengaliri dua resistor masing-masing 10 Ω dan 40 Ω tersambung seri.

4. Bilamana dua benda bermuatan listrik. 3. Benda bermuatan listrik akan menyebabkan adanya medan listrik di sekitarnya.Besarnya intensitas medan listrik berbanding langsung dengan besar muatan dan berbanding terbalik dengan kuadrat jaraknya. Benda-benda bermuatan sejenis akan tolak menolak dan bila bermuatan berlawanan akan saling tarik menarik. maka pada setiap titik yang berada di ruang tersebut akan timbul tegangan yang besarnya ditunjukkan oleh persamaan: V = − ∫ E • dl Vab = − ∫ E • dl a b Dengan ketentuan Vab adalah beda tegangan (potensial) antara titik a – b.3-20 Medan Elektromagnetika C. Suatu ruang (medium) yang padanya ada medan listrik. Rangkuman 1. Hukum Kirchoff untuk tegangan (KVL) dinyatakan oleh model matematis : ∑V=∑IR dan Hukum Kirchoff untuk arus (KCL) ditunjukkan oleh model matematis berikut: ∑I=0 . Besarnya intensitas medan listrik dinyatakan oleh persamaan: E = F Q-1 = k Q R-2. Nilainya ditunjukkan oleh Persamaan: F = k (Q1 Q2) x R-2. 2. pada benda tersebut pasti merasakan ada gaya tarik / tolak. Bila pernyataan ini ditunjukkan dengan persamaan: Q = ∫ D • ds S 5. Hukum Coulomb. Flux listrik yang menembus setiap permukaan tertutup sama dengan muatan total yang dilingkupi oleh luasan tertutup tersebut.

Joule per coulomb (J/C).Medan Elektromagnetika 3-21 D. Newton per coulomb (N/C) 3. bila pernyataan 1 dan 2 benar Pilih jawaban c.3 Satuan untuk potensial listrik adalah: 1.2 dan 4 benar. Volt (V) 2.2 Satuan medan listrik adalah: 1. 2. Newton meter (Nm) 2. 2 dan 3 benar Pilih jawaban d.4.1 Pernyataan hukum Coulomb menunjukkan bahwa: Gaya yang diderita oleh dua benda bermuatan adalah: 1. Volt / meter (V/m) 3. Volt per meter (V/m) 2. Berbanding langsung dengan besar tahanan konduktor 4. Berbanding terbalik dengan besar tahanan konduktor 3. Besar arus tak terpengaruh nilai tegangan antar ujung konduktor. Tugas-tugas Pilih jawaban a. Tergantung dari kebalikan kuadrat jarak antara benda bermuatan 3. bila pernyataan 1. Newton per coulomb (N/C) 4. Tergantung dari besar muatan masing-masing 2. 2. bila pernyataan 1 benar Pilih jawaban b. Tergantung dari medium benda bermuatan tersebut berada 4. bila pernyataan 1.4. .4.4.4 Pernyataan dari hukum Ohm untuk konduktor yang dialiri arus adalah: 1. 2. Tergantung kuadrat jarak antara kedua benda. Joule per coulomb meter (J/Cm) 4. Besar arus yang mengalir pada konduktor berbanding langsung dengan besar tegangan 2.

Bila medium memiliki k = 1 berapa kuat medan di titik N? 2. Setiap titik cabang jumlah arus pada titik cabang adalah nol 3. Setiap lintasan tertutup jumlah tegangan sama dengan jumlah hasil kali arus dan hambatan-hambatannya 2.4.4.7 Ketentuan seperti soal 2.8 Ketentuan seperti kedua soal di atas. Setiap titik cabang jumlah arus yang menuju titik cabang sama dengan jumlah arus yang meninggalkannya 4.4. titik N berjarak 10 m dari benda tersebut.6 terdapat titik M yang berjarak 20 m dari benda bermuatan.4. 2. berapa beda potensial antara N – M? .3-22 Medan Elektromagnetika 2. Setiap titik cabang jumlah arus adalah tetap.5 Pernyataan hukum Kirchoff menyebutkan bahwa: 1. berapa kuat medan di titik M? 2.6 Suatu benda bermuatan 20 x 10-4 C.4.

..... H X X : arah arus meninggalkan kita I • 0 : arah arus menuju kita : arah medan Sedangkan hubungan nilai besaran antara arus medan magnet dan panjang lintasan medan ditunjukkan oleh hukum Amper yang berbunyi: “integral garis medan H pada lintasan tertutup sama dengan arus yang dilingkupinya”...... Medan Magnet pada Arus Listrik Steady Bilamana batang konduktor berarus listrik.. .....Medan Elektromagnetika 3-23 BAB III KEGIATAN BELAJAR II ELEKTRO MAGNETIKA A..........dl = NI ... sehingga ∫ H ...............(3............................................. maka besarnya medan juga sebanding dengan N tersebut... Hubungan antara arah arus dengan medan magnet ditunjukkan oleh kaidah telapak tangan kanan seperti ditunjukkan oleh gambar berikut... Konsep Dasar Elektro Magnetika 1.................2) persamaan menjadi: Konsep dasar dari hukum Amper ini yang melandasi kemagnetan listrik...............1) Atau secara sederhana dinyatakan dengan persamaan: H = kuat medan l = panjang lintasan I = arus yang dilingkupi Bilamana batang konduktor diperbanyak menjadi N batang dalam berkas (turn).......(3.......dl = I ...................... ∫ H .............................. disekeliling konduktor akan timbul medan magnet..................

.....3) dB = 4π r2 Atau B= Dimana B = rapat flux pada P....(3... A dl = elemen batang berarus............................................. m r = jarak dari elemen ke P θ = sudut yang terukur antara garis r dan garis singgung elemen batang Atas dasar kajian ini aplikasinya dapat menganalisa induksi magnet yang ditimbulkan oleh bentuk batang khusus seperti kamparan...............................4) adalah statemen dari hukum Biot – Savart. mereka merumuskan induksi magnet (B) besarnya dipengaruhi elemen batang berarus dan jarak seperti ditunjukkan persamaan: μ Idl sin θ ....... maka besarnya rapat flux B= μI 2πR (B) pendekatannya: Untuk B = flux density (rapat flux) NA-1 m-1 Atau dalam satuan Tesla (T) μ = permeabilitas dalam satuan H/m I = arus pada konduktor dalam A R = jarak titik (dicari kuat flux density) dalam m............4) 4π ∫ r 2 μ = permeability medium H m-1 I = arus pada batang...... dan sebagainya....................... .....3-24 Medan Elektromagnetika Kajian lebih lanjut dilakukan Biot dan Savart. NA-1 m-1 atau T μI sin θ dl.(3..... sehingga d l sin θ = ηdθ dan R = η sin θ ........3) dan (3..... batang panjang.............. Konsep tersebut melandasi konsep medan magnet atau rapat flux B pada radius R dari konduktor linier berarus I dengan panjang konduktor tak terbatas............ Persamaan (3..

..... solenoide...............5) 2R B = flux density dalam NA-1 m-1 atau T I = arus pada konduktor dalam A R = jari-jari (radius) cincin dalam m B= μI μ = permeabilitas medium dalam Hm-1 Untuk solenoida (kumparan) besarnya B adalah: μNI ....... 2.............. secara eksperimen mengalami gaya yang dinyatakan persamaan berikut: F = Qv x B …………………………………………………...................7) Dengan v = kecepatan gerak muatan listrik dalam m ....(3..(3.............................. Persoalan mendasar adalah bila nilai besaran arus mengalami perubahan (dI) ataupun medan magnet mengalami perubahan yang berarti flux magnet mengalami perubahan (dφ).. Gaya Bilamana suatu muatan bergerak dalam medan magnetik dengan kerapatan flux B..... Untuk konduktor cincin (terbuka) ................ toroid dan sebagainya dapat diselesaikan persamaan-persamaannya seperti berikut.....…………........(3...........................................................Medan Elektromagnetika 3-25 Konsep dasar medan magnet akibat arus listrik pada konduktor..............5) Analisis dasar ini dapat dikembangkan untuk kepentingan praktis seperti konsep pemagnetan buatan (magnet listrik) dan sebagainya........ bila dikembangkan kajian pada konduktor berarus yang dibentuk seperti konduktor cincin (lilitan=kumparan cincin).6) B= l N = jumlah turn (lilitan) pada solenoida l = panjang solenoida dan ketentuan lain seperti pada penjelasan persamaan (3.. Adanya perubahan dI atau dφ akan menghasilkan konsep dasar hukum Lenz atau Faraday......

12) vol Persamaan (3...9) dan (3.10) atau F = I L x B ……………………………………………..........…………(3..(3....8) Persamaan (3.. berapa kuat medan di titik P yang berjarak 10 m dari konduktor.... Latihan-latihan 1..(3..14 x 10]-1 ......9) dapat ditulis berikut: d F = I d L x B ………………………………………………………..10) merupakan persamaan dasar dari konsep kerja motor listrik / alat ukur listrik dan pengembangan alat-alat lainnya..........8) sebagai dasar kajian gaya akibat muatan bergerak pada kerapatan flux.............7) dideferensial.....11) atau dalam bentuk lain: F= garis ∫ IdLxB = ∫ ∂xBdv..... v d Q ada keterkaitan dengan rapat muatan bergerak yakni d Q = ρ d v yang merupakan rapat muatan ruang. 3.. Penyelesaian: Besarnya kuat medan magnet (H) adalah: ∫ Hxdl = I Atau : H = I x (2 π R)-1 →l=r H = 10 x [ 4 x 3........9) untuk J = rapat muatan ruang dalam A m-2 sedangkan hubungan antara J dv sebagai unsur arus diferensial yaitu J dv = I d L oleh karena itu persamaan (3.3-26 Medan Elektromagnetika Bila persamaan (3. maka telaah ini diteruskan akan memperoleh persamaan yakni: d F = J x B dv …………………………………………………………(3.......(3. Suatu konduktor berarus 10 A..... maka gaya pada partikel muatan adalah: dF = d Q v x B ……………………………………………………….. Begitu pula bila kerapatan flux (B) ditimbulkan oleh magnet listrik yang berarti gaya antar batang – batang konduktor berarus yang merupakan konsep dasar moment (kopel) suatu alat ukur / motor listrik..

Konduktor tersebut dialiri arus sebesar 10 A. Konduktor dibentuk toroide dengan jumlah 10000 lilitan. berapa kuat medan (H) di pusat cincin? Penyelesaian: H = I x (2 R)-1 = 10 x (2 x 10) -1 =1 / 2 A/m 3. dan intinya memiliki μ = 1. Berapa rapat flux magnet rata-rata pada inti solenoide? Penyelesaian: Besarnya B adalah: B = μ N I x (l)–1 = 1 x 1000 x 10 x (20 x 10 –2)-1 = 5 x 104 A/m 4. Berapa kerapatan flux (B) pada inti toroide? Penyelesaian: B = (μ N I) x (2 π R)–1 = 1 x 104 x 10 x (2 x 3. dengan panjang 20 cm. Konduktor berbentuk cincin dengan radius 10 m.14 ]-1 = 7. diameter toroide 50 cm dan diameter coil 4 cm.14 x 50 x 10-2)-1 = 3.Medan Elektromagnetika 3-27 = 1 x [ 4 x 3. Permeabilitas μ = 1 dan dialiri arus 10 A. Bila konduktor tersebut dialiri arus listrik 10 A.18 x 104 A/m = 3.2 x 104 A/m A/m .14 x 50 x 10-2)-1 = 105 x (2 x 3.98 x 10-2 A/m 2. Konduktor dibentuk kumparan (solinoide) sebanyak N = 1000 lilitan.

Konduktor lurus panjang: B = μ I x (2 π R)–1 .3-28 Medan Elektromagnetika 5. Berapa gaya yang dirasakan oleh konduktor? Penyelesaian: Gaya yang dialami konduktor: F =LIxB = 10 x 5 x 1000 = 5 x 104 Newton = 5 x 104 N 4. Disekitar konduktor berarus akan timbul medan magnetik (H). berada dalam kerapatan flux magnet (B) sebesar 1000 N/Am dan dialiri arus 5 A. Telaah lebih lanjut dari hukum Biot – savart terhadap bentuk konduktor berarus: a. Mendasarkan konsep hukum Amper. Konduktor panjang 10 m. Biot dan Savart menemukan hukum Biot savart dengan rumusan matematis sebagai berikut: dB = atau B= μ Idl sin θ r2 4π μI sin θ dl 4π ∫ r2 3. Konduktor cincin flux density (B) di titik pusat cincin B = μ I x (2 R) –1 b. Hubungan antara medan magnet dengan arus listrik didasarkan hukum Amper yang model matematisnya adalah: ∫ H • dl = I 2. Rangkuman 1.

Newton per Amper (N/A) b. Suatu muatan bergerak dalam medan magnettik dengan kerapatan flux (B) akan mengalami gaya yang dinyatakan persamaan: F = Q V x B Atau dalam bentuk hubungannya dengan I. Suatu konduktor panjang 5 m berarus 10 A. Tugas-tugas Pilihlah jawaban yang paling benar dari jawaban yang tersedia. 100 N d. 5. besarnya B adalah: B = μ N I x (2 π R)–1 Dengan ketentuan R = radius toroide. Newton meter per Amper (Nm/A) F=LIxB d. Satuan untuk besaran flux magnet (φ ) adalah: a. Konduktor dibentuk toroid. Besarnya gaya yang dialami oleh konduktor adalah: a. L adalah: Persamaan ini mendasari prinsip muatan listrik.Medan Elektromagnetika 3-29 c. Newton per Amper meter (N/Am) c. berada pada medan magnet dengan rapat flux (B) sebesar 10 N/Am. Newton per Amper meter (N/Am) c. 4. 1. 50 N c. 500 N b. besarnya B adalah : B = μ N I x (l)–1 d. Amper meter per Newton (Am/N) 3. 20 N . Newton per Amper (N/A) b. Konduktor dibentuk solenoide dengan panjang kumparan l . Newton meter per Amper (Nm/A) d. Satuan untuk besaran rapat flux (B) adalah: a. Amper meter per Newton (Am/N) 2.

panjang solenoide 10 cm. 100.15 A/m c.1692 A/m 5. 1000 A lilitan / m d. maka besar medan magnet yang berjarak 10 m dari konduktor adalah: a. 0. Konduktor cincin berarus 10 A dan radius cincin 5 cm. 10 000 A lilitan / m c. Solenoide tersebut dialiri arus sebesar 5 A. Bila pada intinya terbuat bahan ferromagnetik dengan nilai μ = 5 A/m dan diameter toroide 20 cm. 0. memiliki jumlah lilitan 10. Konduktor dibentuk toroide dengan 1000 lilitan.000 A lilitan / m b. Sebuah solenoide panjang 5 cm. besar medan megnet di inti solenoide adalah: a. Berapa kuat medan di titik pusat cincin? 8. 0.3-30 Medan Elektromagnetika 4.000 lilitan. Berapa kuat medan magnet yang terbentuk pada inti solenoide? 7. 100 A lilitan / m 6. Konduktor dibentuk solenoide dengan 1000 lilitan. Konduktor lurus panjang berarus 10 A.16 A/m b. Bila solenoide tersebut dialiri arus listrik 10 A. berapa rapat flux magnet yang terbentuk bila toroide dialiri arus 5 A. .1592 A/m d. 0.

......... Maka kajian ini diteruskan yaitu medan magnet berubah tersebut disebabkan oleh arus yang berubah (seperti ditunjukkan hukum integral Amper ∫ Hdl = I Atau ... Konsep Dasar Medan Magnet dan Medan Listrik Berubah terhadap Waktu Bila dikaji arus listrik dapat menimbulkan medan magnet seperti ditunjukkan hukum Amper atau Biot-Savart...............(4.... Konsep pemikiran yang melandasi Faraday melakukan eksperimennya ........2b) ∂t Hubungan antara medan magnet yang berubah (dφ) terhadap tegangan = v = −N potensial yang ditimbulkannya telah ditemukan oleh Faraday dimana Faraday diilhami oleh hukum Lenz..................................(4.............. yang berarti tegangan = potensial listrik..............2a ) ∂t ∂φ .................................. maka medan magnet pasti menimbulkan arus listrik.1) ∂t Jika lintasan tertutup nya konduktor berbentuk lilitan yang terdiri N lilitan............ ∂φ volt..........................(4......Medan Elektromagnetika 3-31 BAB IV KEGIATAN BELAJAR IV MEDAN MAGNET DAN MEDAN LISTRIK BERUBAH TERHADAP WAKTU A. sehingga ditemukan hukum Faraday yang dinyatakan dalam model matematis berikut........... v = ggl = e = − maka v = −N Atau ∂φ volt..........

....(1000 – 0) x (103) volt = .(dφ) x (dt)–1 Volt = ..... Hubungan antara tegangan induksi dengan perubahan arus ditunjukkan oleh model matematis hukum Lenz berikut.........106 volt . Latihan-latihan 1.. (4.(4.. transformator dan analisis transien (rangkaian listrik akibat pengaruh perubahan).......ds S Dan B = μH ds = perubahan Maka dari itu dI akan menyebabkan suatu induksi tegangan pada konduktor yang melawan tegangan yang menyebabkan arus pada konduktor mengalir..... B.... Konsep-konsep dasar yang dinyatakan model matematis (4.1)......2) dan (4... Suatu batang konduktor berada dalam flux yang mengalami laju perubahan dari 1000 Weber ke 0 Weber dalam tempo 10-3 detik..3-32 Medan Elektromagnetika H = Dan dI dl φ = ∫ B.3) ∂t L = besarnya nilai induktansi batang konduktor / lilitan yang besarnya L = φ / I V = −L atau L = Nφ / I.... Hukum Faraday............. Berapa elektromotansi yang akan timbul pada konduktor? Penyelesaian: V = .. di volt.3) merupakan dasar dari analisis generator.

Bila konduktor tersebut dialiri arus 10 A dengan laju perubahan dalam tempo 2 x 10-3 detik.250 volt 5. Seperti soal (4).L (d I) x (d t) volt = . Berapa elektromotansi yang timbul pada konduktor ? Penyelesaian: V = . Berapa elektromotansi yang timbul pada konduktor? Penyelesaian: Elektromotansi (V) = .Medan Elektromagnetika 3-33 2. konduktor tersebut berada dalam laju perubahan flux magnet 500 weber ke 0 weber dalam tempo 4 x 10-3 detik.50 x 10-3 x 10 x (2-1 x 103) volt = . Suatu konduktor dibentuk filamen dengan 1000 lilitan.L (d I) x (d t)–1 volt .(dφ) x (dt)–1 Volt = .25 x 103 volt 3.N (d φ) x (d t)–1 = -1000 x (500 – 0) x (4-1 x 103) volt = .500 x (2-1 x 102) = . berapakah elektromotansi yang timbul pada konduktor ? Penyelesaian: V = . Suatu batang konduktor bergerak memotong flux magnet 500 weber dengan laju kecepatan 2 x 10-2 detik. Suatu konduktor berbentuk filamen memiliki induktansi diri (L) sebesar 50 mH.1.25 x 108 volt 4.50 x 5 volt = . Berapa elektromotansi yang timbul pada konduktor ? Penyelesaian: V = . tetapi tempo laju perubahannya 106 detik.106 x 125 volt = .

Bila pernyataan ini dimodelkan matematis adalah: elektromotansi = . 3. Hukum Lenz “Tegangan induksi (gaya gerak listrik) selalu berkelakuan menimbulkan flux yang berlawanan”.N d φ dt 2. Hukum Faraday: “Medan magnetik yang berubah terhadap waktu menimnulkan elektromotansi (gaya gerak listrik / tegangan listrik) pada suatu rangkaian”.500 k volt C. Besarnya flux magnet yang ditimbulkan oleh arus listrik berbanding langsung dengan besar arus listrik pada konduktor yang menimbulkan flux magnet.50 x 10-3 x (10 x 10-6) volt = -5 x 105 volt = . Keterpautan antara flux magnet total dengan arus listrik disefinisikan sebagai “induktansi diri (L)”.L d I dt V .3-34 Medan Elektromagnetika = .d φ V dt Jika lintasan tertutupnya berbentuk konduktor filamen yang terdiri dari N lilitan maka elektromotansinya adalah: elektromotansi = . Model matematis keterkaitan antara φ dan I adalah: L = φ / I atau untuk N lilitan adalah: L=Nφ/I Hubungan antara elektromotansi dengan perubahan arus terhadap waktu yang mengalir pada konduktor yang memiliki induktansi diri L adalah: ektromotansi = . Rangkuman 1.

bila pernyataan 1. Tugas-tugas Pilih jawaban a. Satuan untuk tegangan induksi (elektromotansi) adalah: (1) Volt (V) (2) Weber per detik (Wb/dtk) (3) Weber per volt (Wb/V) (4) Volt per weber (V/Wb) 3. Model matematis untuk persamaan induksi (elektromotansi = V) adalah: (1) V = . Satuan induktansi diri adalah: (1) Henry (H) (2) Weber per Amper (Wb/A) (3) Weber lilitan per Amper (Wb lilitan / A) (4) Amper per weber (A/Wb) 4.d φ / d t (2) V = . 1. 2 dan 3 benar Pilih jawaban c. bila pernyataan 1. 2 benar Pilih jawaban b. Besarnya elektromotansi yang timbul pada konduktor yang berada dalam perubahan flux magnet terhadap waktu adalah: (1) Tergantung dari besarnya perubahan flux (2) Tergantung dari waktu laju perubahan (3) Besarnya berlawanan dengan pernyataan (1) dibagi pernyataan (2) (4) Besarnya berbanding lurus dengan pernyataan (1) dibagi pernyataan (2) 2.N d φ / d t (3) V = d φ / d t (4) V = N d φ / d t .Medan Elektromagnetika 3-35 D. bila pernyataan 4 benar. bila pernyataan 2 dan 3 benar Pilih jawaban d.

3-36 Medan Elektromagnetika

5. Model matematis untuk persamaan induktansi diri (L) adalah: (1) L = - φ / I (2) L = φ / I (3) L = N φ / I (4) L = - Nφ / I

Medan Elektromagnetika 3-37

BAB V KEGIATAN BELAJAR V
TEORI MAXWELL (Persamaan Maxwell) Kajian teori Maxwell sebagai dasar kajian tentang keterkaitan medan magnet (H) dengan medan listrik (E) atau sebaliknya. Hal ini sebagai dasar menelaah gelombang elektromagnet. Kajian ini sebagai pengembangan Medan Elektro Magnet. Kajian saling keterkaitan antara pengaruh medan listrik dengan medan magnet atau sebaliknya dikaji oleh James Clark Maxwell sebagai temuan teori Maxwell. Sebagai dasar pemikiran Maxwell dari teori Stoke yang melakukan kajian pengoperasian integral garis terhadap kajian integral luasan diperoleh persamaan dasar:

∫ H .dl = ∫ (∇xH ).ds..................................................(5.1)
S

Persamaan (4.1) berlaku untuk setiap medan vektor d l = panjang lintasan tertutup d s = luas permukaan yang dibentuk lintasan tertutup itu Dengan konsep teori Stoke di atas, maka berlaku pula untuk medan listrik seperti model matematis berikut.

∫ E.dl = ∫ (∇xE ).ds..................................................(5.2)
S

Kuat medan yang ditimbulkan kerapatan arus (J) untuk batang ds maka persamaan matematisnya adalah:

∫ H .dl = ∫ J .ds......................................................(5.3)
S

Mendasari konsep matematis (5.1), (5.2) dan (5.3) maka teori Maxwell dapat dinyatakan dengan model matematis berikut.

3-38 Medan Elektromagnetika

∂B ..........................................................(5.4a) ∂t ∂D ∇xH = J + .....................................................(5.4b) ∂t Persamaan ini untuk medan berubah terhadap waktu sedangkan untuk medan tak berubah terhadap waktu adalah: ∇.D = ρ ………………………………………..(5.4c) ∇xE = −
∇.B = 0 ………………………………………...(5.4d)
Untuk bantuan kajian keempat persamaan Maxwell dalam bentuk diferensial perlu keterkaitan persamaan berikut. D=∈E B=μH J=σE Dimana : ∈= permitivitas medium

μ = permeabilitas medium σ = konduktivitas medium
Bilamana menghadapi bahan berkelakuan tak baik, maka nilai D = ∈0 E + P dan B = μ0 (H+M) M = magnetisasi dan P = polarisasi pengutuban bahan isolasi (medium) Sedangkan model matematis Maxwell dalam bentuk integral adalah:

∫ E.dl = − ∫ ∂t .ds......................................................(5.5a)
S

∂B

∫ H .dl = I + ∫ ∂t .ds................................................(5.5b)
S

∂D

∫ D.ds = ∫ ρdv.........................................................(5.5c)
vol

∫ B.ds = 0.................................................................(5.5d )
S

Medan Elektromagnetika 3-39

Keempat persamaan integral ini memungkinkan untuk mencapai syarat batas untuk B, D, H dan E yang diperlukan untuk mencari tetapan dalam mencari jawaban persamaan Maxwell dalam bentuk diferensial. Kajian teori Maxwell di atas memungkinkan menelaah lanjut medan elektro magnet di segala situasi medium.

3-40 Medan Elektromagnetika

DAFTAR PUSTAKA
Kraus, J.D & Carver, K.R, Electro Magnetics, Mc Graw-Hill, Tokyo, 1993 Hayt, W.Jr., Electromagnetika Teknologi, Vol 1 & 2, Erlangga, Jakarta, 1981. Attwood, SS., Electric and Magnetic Fields, John Wiley & Sons, New York, 1949. Sears, Zermansky, Physic for University, Mc Graw-Hill, New York, 1960. Elliot, Electromagnetic, Mc Graw-Hill Book Company, New York, 1966. Halliday, D. & R Resnick, Physic, John Wiley & Sons, New York, 1962.

BUKU AJAR

TEKNIK PEMROGRAMAN

BAB 1 PENDAHULUAN

A. Standar Kompetensi 1. Mengenal paradigma prosedural dan algoritma. 2. Mengenal metodologi penulisan algoritma. 3. Mengenal bahasa pemrograman.

B. Kompetensi Dasar 1. Memecahkan masalah dengan paradigma prosedural dan

menuliskan spesifikasi dan algoritmanya tanpa tergantung pada bahasa pemrograman apapun. 2. Menulis algoritma dari suatu masalah dengan menggunakan metodologi dan skema standard yang diajarkan secara terstruktur. 3. Menulis program yang "baik" (sesuai dengan kriteria yang diajarkan di kelas) dalam bahasa pemrograman yang diajarkan, dengan menggunakan aturan translasi yang diberikan. Programnya harus terstruktur walaupun bahasa pemrogramannya bukan bahasa yang terstruktur.

C. Indikator Pencapaian Kompetensi 1. Mengenal algoritma. 2. Mengenal Paradigma Prosedural. 3. Mengenal Penulisan Algoritma. 4. Mengenal bahasa program. 5. Mengenal penulisan program yang baik.

1. Paradigma Pemrograman Paradigma adalah sudut pandang atau "sudut serang" tertentu yang diprioritaskan, terhadap kelompok problema, realitas, keadaan, dan sebagainya. Paradigma membatasi dan mengkondisikan jalan berpikir

kita, mengarahkan kita terhadap beberapa atribut dan membuat untuk

4-2 Teknik Pemrograman

mengabaikan atribut yang lain. Dengan demikian , jelas bahwa sebuah paradigma hanya memberikan pandangan yang terbatas terhadap sebuah realitas, karena itu fanatisme terhadap sebuah paradigma, mempersempit wawasan dan kadang berbahaya. Dalam pemrograman pun ada beberapa paradigma, masing-masing mempunyai priotas strategi analisis yang

khusus untuk memecahkan persoalan, masing-masing menggiring kita ke suatu pendekatan khusus dari problematika keseluruhan. Beberapa jenis persoalan dapat dipecahkan dengan baik dengan menggunakan sebuah paradigma, sedangkan yang lain tidak cocok. Mengharuskan seseorang memecahkan persoalan hanya dengan melalui sebuah paradigma, berarti membatasi strateginya dalam pemrograman. Satu paradigma tidak akan cocok untuk semua kelas persoalan. "Ilmu" pemrograman berkembang, menggantikan "seni"

memprogram atau memprogram secara coba-coba ("trial and error"). Program harus dihasilkan dari proses pemahaman permasalahan, analisis, sintesis dan dituangkan menjadi kode dalam bahasa komputer secara sistematis dan metodologis. Beberapa paradigma dalam

pemrograman :

a. Paradigma Prosedural atau imperatif Paradigma ini didasari oleh konsep mesin Von Newmann (stored program concept) : sekelompok tempat penyimpanan (memori), yang dibedakan menjadi memori instruksi dan memori data; masing-masing dapat diberi nama dan harga. Instruksi akan dieksekusi satu per satu secara sekuensial oleh sebuah pemroses tunggal. Beberapa instruksi menentukan instruksi berikutnya yang akan dieksekusi (percabangan kondisional). Data diperiksa dan dimodifikasi secara sekuensial pula. Program dalam paradigma ini didasari pada strukturasi informasi di dalam memori dan manipulasi dari informasi yang disimpan tersebut. Kata kunci yang sering didengungkan dalam pendekatan ini adalah : Algoritma + Struktur Data = Program

Teknik Pemrograman 4-3

Pemrograman dengan paradigma ini sangat tidak "manusiawi" dan tidak "alamiah", karena harus berpikir dalam batasan mesin

(komputer), bahkan kadang-kadang batasan ini lebih mengikat daripada batasan problematikanya sendiri. Keuntungan pemrograman dengan paradigma ini adalah efisiensi eksekusi, karena dekat dengan mesin.

b. Paradigma Fungsional Paradigma fungsional didasari oleh konsep pemetaaan dan fungsi pada matematika. Fungsi dapat berbentuk sebagai fungsi "primitif", atau komposisi dari fungsi-fungsi lain yang telah terdefinisi.

Pemrogram mengasumsikan bahwa ada fungsi-fungsi dasar yang dapat dilakukan. Penyelesaian masalah didasari atas aplikasi dari fungsi-fungsi tersebut. Jadi dasar pemecahan persoalan adalah transformasional. Semua kelakuan program adalah suatu rantai transformasi dari sebuah keadaan awal menuju ke suatu rantai keadaan akhir, yang mungkin melalui keadaan antara. Paradigma fungsional tidak lagi mempernasalahkan memorisasi dan struktur data, tidak ada pemilahan antara data dan program, tidak ada lagi pengertian tentang "variabel". Pemrogram tidak perlu lagi mengetahui bagaimana mesin mengeksekusi atau bagaimana informasi disimpan dalam memori, setiap fungsi adalah "kotak hitam", yang menjadi perhatiannya hanya keadaan awal dan akhir. Dengan merakit kotak hitam ini, pemrogram akan menghasilkan program besar. Berlainan sekali dengan paradigma prosedural, program fungsional harus diolah lebih dari program prosedural (oleh pemroses bahasanya), karena itu salah satu keberatan adalah kinerja dan efisiensinya.

c. Paradigma Deklaratif, predikatif atau lojik Paradigma ini didasari oleh pendefinisian relasi antar individu yang dinyatakan sebagai predikat. Sebuah program lojik adalah kumpulan

4-4 Teknik Pemrograman

aksioma (fakta dan aturan deduksi). Pada paradigma ini, pemrogram menguraikan sekumpulan fakta dan aturan-aturan (inference rules). Ketika program dieksekusi, pemakai mengajukan pertanyaan (Query), dan program akan menjawab apakah pernyataan itu dapat dideduksi dari aturan dan fakta yang ada. Program akan memakai aturan deduksi dan mencocokkan pertanyaan dengan fakta-fakta yang ada untuk menjawab pertanyaan.

d. Paradigma Berorientasi Objek (Object Oriented) Paradigma ini didasari oleh objek. Sebuah objek mempunyai atribut (kumpulan sifat), dan mempunyai kelakuan (kumpulan reaksi, metoda). Objek yang satu dapat berkomunikasi dengan objek yang lain lewat "pesan", dengan tetap terjaga integritasnya. Kelas adalah objek

mempunyai atribut yang sama dan diturunkan ke semua objek yang berada dalam kelas yang sama. Kelas-kelas mempunyai hirarki, anggota dari sebuah kelas juga mendapatkan turunan atribut dari kelas di atasnya. Paradigma ini menawarkan konsep class, generic, inheritance, polymorphism dan menenkankan pentingnya pendefinisian statik kelas untuk melahirkan (menciptakan) objek pada saat runtime, yang kemudian dimanipulasi atau saling berinterasi. Definisi kelas memungkinkan adanya penurunan kelas dengan objek pada saat run time yang dapat “berubah” bentuk dengan kelakuan yang disesuaikan, Namun demikian, literatur pada struktur kontrol mikro untuk

mendeskripsikan kelakuan, masih terkandung paradigma imperatif, dengan adanya pernyataan sekuensial, assignment, analisis

kondisional dan pengulangan. Disamping itu, mengkonstruksi program dari objek dan kelas adalah berbeda dengan mengkonstruksi program dari struktur data dan algoritma. Kedekatan antara paradigma ini dengan paradigma lain dapat dilihat dari bahasa-bahasa bukan

berorientasi obyek murni, yaitu bahasa prosedural atau fungsional yang ditambahi dengan ciri orientasi objek.

bahasa tingkat tinggi. LISP c. b. Eifel. Jaca. dan pemrograman dalam bahasa Query yang memungkinkan diperolehnya suatu himpunan nilai. Paradigma relasional. C++. Bahasa Pemrograman berkembang dengan cepat sejak tahun enampuluhan. sampai bahasa generasi ke empat (4GL). Ada. misalnya : a. Basic.. dalam literatur masih sering disebutkan paradigma yang lain. seringkali dianalogikan dengan menara Babel yang berakibat manusia menjadi tidak lagi saling mengerti bahasa masingmasing. Pascal. Bahasa Pemrograman Ada banyak sekali bahasa pemrograman. Paradigma konkuren. Konkuren : OCCAM. bahasa asembler (dalam kode mnemonik). Object oriented murni: Smalltalk. Contoh bahasa-bahasa pemrograman yang ada : a.Teknik Pemrograman 4-5 Selain keempat paradigma tersebut. Relasional: SQL pada basisdata relasional Paradigma Objek mulai ditambahkan pada bahasa-bahasa yang ada. Cobol.. Prosedural : Algol. Pemroses bahasa Pascal dan C versi terbaru dilengkapi dengan fasilitas terorientasi objek. yang didasari entity dan relasi. Java f. Fungsional : LOGO. APL. misalnya Turbo Pascal (mulai versi 5. Fortran.5) pada komputer pribadi (PC) dan C++. Suatu program dalam bahasa pemrograman . C . b. yang erat hubungannya dengan arsitektur perangkat keras yang memungkinkan pemrosesan secara paralel atau perangkat lunak sistem terdistribusi yang mengelola akses konkuren. Ada beberapa versi LISP dan Prolog yang juga memasukkan aspek OO. mulai dari bahasa tingkat rendah (bahasa mesin dalam biner). tersedia bahasa pemrograman yang mempermudah implementasi rancangan penyelesaian masalahnya. 2.. Deklaratif/Lojik : Prolog d. e. Untuk setiap paradigma.

pengetahuan tentang kelas persoalan penting adanya. aturan sintaks (tatabahasa). Lebih lanjut. pemakaian kembali modul yang ada. penggunaan komputer untuk memecahkan persoalan adalah untuk tidak mengulang-ulang kembali hal yang sama. Karena itu perlu diajarkan metodologi. Beberapa masalah akan cocok kalau diselesaikan dengan suatu paradigma tertentu. Ada dua kategori pemroses bahasa. sintesa. selalu dipakai untuk semua pendekatan. dan seharusnya mendasari semua pengajaran pemrograman. Belajar bahasa pemrograman adalah belajar memakai suatu bahasa. Karena itu. belajar bahasa pemrograman adalah belajar untuk memanfaatkan instruksi-instruksi dan kiat yang dapat dipakai secara spesifik hanya pada bahasa itu. Belajar memprogram lebih bersifat pemahaman persoalan. 3. setiap instruksi yang ada dan tata cara pengoperasian kompilator bahasa yang bersangkutan pada mesin tertentu. analisis.4-6 Teknik Pemrograman tertentu akan diproses oleh pemroses bahasanya. Belajar Pemrograman Tidak Sama Dengan Belajar Bahasa Pemrograman Belajar memprogram adalah belajar tentang strategi pemecahan masalah. terutama karena sebagian besar pemrogram pada akhirnya memakai rutin-rutin yang ditulis orang lain. metodologi dan sistematika pemecahan masalah tersebut kemudian menuangkannya dalam suatu notasi yang disepakati bersama. Mahasiswa seringkali . Belajar memprogram dan belajar bahasa pemrograman mempunyai tingkatan dan kesulitan yang berbeda-beda. Dan ada algoritma baru yang lahir. Pada hakekatnya. tapi relatif lebih sedikit dibandingkan dengan bongkar pasang program yang sudah ada. Belajar memprogram lebih bersifat keterampilan daripada analisis dan sintesa. Strategi pengenalan masalah melalui dekomposisi. tersedia bahasa pemrograman visual atau tekstual. Dalam melakukan implementasi program. sintesis. yaitu kompilator dan interpreter.

Teknik Pemrograman 4-7 dihadapkan pada kedua kesulitan itu sekaligus. suatu rancangan harus dapat dikode untuk dieksekusi dengan mesin. Sebaliknya. Karena itu memaksa mahasiswa hanya bekerja diatas kertas. Proses memprogram memang berakhir secara konkrit dalam bentuk program yang ditulis dan dieksekusi dalam bahasa target. Seorang yang sedang belajar harus belajar melalui contoh nyata. belumlah lengkap. sanggup melayani segala kemungkinan masukan. Proses memprogram adalah proses yang memerlukan kepakaran. menganalisis dan membuat spesifikasi tanpa pernah mengeksekusi program. yang dapat dieksekusi oleh mesin. Karena itu. notasi yang disepakati supaya masalah itu dapat dengan mudah diterjemahkan ke dalam salah satu bahasa yang masih ada dalam lingkup paradigma yang sama. Berkat . hanya mencetak pemrogram yang langsung "memainkan keyboard". Produk yang dihasilkan oleh seorang pemrogram adalah program dengan rancangan yang baik (metodologis. proses koding lebih merupakan proses semi otomatik dengan aturan pengkodean. berfungsi dengan benar. Pengajaran pemrograman titik beratnya adalah membentuk seorang perancang "designer" program. belajar pemrograman dan belajar bahasa pemrograman saling komplementer. Pada prakteknya. Metoda terbaik untuk belajar apapun adalah melalui contoh. dan didukung dengan adanya dokumentasi. pemecahan persoalan dalam satu paradigma dapat diterjemahkan ke dalam bahasa-bahasa yang berbeda. Beberapa bahasa dapat termasuk dalam sebuah paradigma sama. Untuk itulah diperlukan adanya suatu perjanjian. mengetik program dan mengeksekusi tanpa analisis dan spesifikasi yang dapat dipertanggung jawabkan juga bukan merupakan praktek yang “baik” (terutama untuk program skala besar dan harus dikerjakan banyak orang). tidak mungkin dipisahkan satu sama lain. sedangkan pengajaran bahasa pemrograman titik beratnya adalah membentuk seorang "coder" (juru kode). sistematis). Pemecahan persoalan dengan paradigma yang sama akan menghasilkan solusi yang "sejenis".

Ini dapat dianalogikan dengan pembangunan sebuah gedung pencakar langit dibandingkan dengan . Pendapat ini sudah kuno. proses yang baik pasti dapat menjamin kehadiran suatu produk yang baik. Aspek penekanan pada proses ini sangat ditegaskan dalam kuliah pemrograman (dan nantinya dalam Rekayasa perangkat Lunak dengan skala lebih besar). Diharapkan bahwa mahasiswa tidak hanya mampu untuk menghasilkan produk program.4-8 Teknik Pemrograman contoh nyata itu dia melihat. mungkin dihasilkan oleh sebuah proses yang “kurang baik” atau bahkan “sangat buruk” karena hasil akhir yang dipolers disana sini secara tambal sulam. Contoh tipikal adalah contoh program yang merupakan “pola solusi” dari kelas-kelas persoalan yang dapat diselesaikan. Sebuah produk yang baik. Contoh tipikal tersebut dikembangkan dan dipakai untuk belajar dan mengajar sesuai dengan paradigma pemrograman yang diajarkan. Metoda pengajaran yang dipakai pada perkuliahan pemrograman fungsional ini adalah pengajaran melalui contoh tipikal. 4. Program Skala Kecil dan Program Skala Besar Pada kehidupan nyata. Memang pemantauan produk jauh lebih gampang daripada pemantauan proses. Sebaliknya. Apalagi dengan jumlah mahasiswa yang cukup banyak maka aspek proses seringkali sulit dipantau. mengalami dan melakukan pula. bahkan sangat besar dan mempunyai persyaratan tertentu. Program : Produk versus Proses Beberapa kalangan berpendapat bahwa yang penting dalam sebuah pengembangan program adalah produk. perangkat lunak yang dibutuhkan “berukuran” besar. melainkan juga dapat menjalankan proses pembuatan program seperti yang “sebaiknya” sesuai dengan prosedur yang standard. Pembangunan program berskala besar tidak dapat dilakukan dengan cara yang identik dengan program skala kecil. Sikap mahasiswa yang mau disiplin secara mandiri sangat diharapkan dalam mencapai tujuan kuliah ini. 5.

Skala komponen juga makin berkembang. sampai komponen utama yang menjadi dasar. Pemrogram Individu dan Pemrogram dalam Tim Jaman dulu. ubin yang dapat difabrikasi secara terpisah sebelum dipasang. Pendekatan “merakit” ini juga dilakukan dalam pembangunan perangkat lunak. Maka dapat dikatakan bahwa ada dua kategori pemrogram: penyedia modul/komponen dan pemakai modul/komponen. dan ada perakit yang memakai komponen. Ada produsen komponen. Ahli Informatika selayaknya mampu untuk menjadi penyedia modul/komponen. di dalamnya terdiri dari komponen elektronik “standard” yang dirakit. suka menyendiri. atau pengembangan modul-modul “kecil” yang merupakan modul/komponen primitif yang nantinya akan merupakan bagian dari sebuah perangkat lunak berskala besar. Misalnya sebuah peralatan elektronik yang canggih. Pemrograman Beroreinetasi Objek). Sebuah program yang besar dan “baik” biasanya terdiri dari banyak sekali modul/komponen “kecil” yang dikerjakan oleh banyak orang. tidak jarang ditemui programmer “eksentrik”. Pada kuliah Pemrograman yang mendasar (Algoritma dan Pemrograman. hanya dicakup pembangunan program-program skala “kecil (karena memang “kecil”). Struktur Data. Sedangkan pembangunan perangkat lunak skala besar akan dicakup dalam modul-modul kuliah kelompok Rekayasa Perangkat Lunak. di Program Studi Pendidikan Teknik Elektro UNNES. framework. platform. dari komponen setara “suku cadang” dalam industri perakitan mobil. bahkan “engine” dari produk secara keseluruhan (munculnya istilah library. Sebuah gedung besar mempunyai komponen seperti pintu. 6. jendela. jenius yang selalu hanya berhadapan dengan komputer dan menghasilkan kode-kode program “misterius” yang hanya dimengerti olehnya sendiri (Baca tulisan Hoare mengenai “Programming: Sorcery or . Sesuatu yang “besar” biasanya terdiri dari komponen-komponen “kecil”.Teknik Pemrograman 4-9 pembangunan sebuah rumah kecil sederhana. dsb).

Ada banyak standard yang dipakai di dunia pemrograman. Kuliah Algoritma Pemrograman lebih diarahkan kepaga programming. Suatu aksi harus terjadi pada selang waktu yang terbatas. Jika seseorang tertarik pada suatu aksi. Maka efek neto . Aspek ini perlu diperhatikan dan dengan disepakati bersama. 7. ditekankan benar efek tersebut harus “direncanakan”. Suatu aksi adalah kejadian yang terjadi pada suatu selang waktu terbatas dan menghasilkan efek neto yang telah terdefinisi dengan baik dan memang direncanakan. maka pemrograman adalah sebuah orkestra. Jadi salah satu tujuan pengajaran adalah membentuk pemrogram atau perancang program yang harus mampu bekerja sama dengan orang lain. Bekerja dalam tim membutuhkan standard atau pola kerja yang sama dan aturan main agar ada koodinasi dan tim dapat menghasilkan suatu produk sesuai dengan prosedur. pemrogram diharapkan untuk dapat bekerja dalam tim. Aspek bekerja dalam tim dan mengikuti standard ini akan dicakup dalam perkuliahan. Ini sudah dijelaskan pada bagian Program Skal Besar dan Program Skala kecil. Pada deskripsi tersebut. Skala program yang harus dibuat di masa kini sudah jauh lebih besar ukurannya dibandingkan dengan jaman dulu.4-10 Teknik Pemrograman Science” [Hoare-84). yang harus dipimpin seorang konduktor supaya pertunjukan dapat berjalan dengan baik. daripada coding. juga membutuhkan kemauan setiap individu untuk bermain selaras sesuai dengan arahan konduktor. Pemrograman Prosedural Pengertian pertama yang akan dijelaskan adalah aksi. dimulai pada saat T0 dan berakhir pada saat T1. Akibatnya. Jika dianalogikan dengan dunia musik. Jaman itu sudah berlalu. maka jelas bahwa minatnya adalah pada efek netonya. Di kelas akan ditetapkan suatu standard pemrograman tertentu yang diharapkan akan dipakai selama kuliah. Sebuah orkestra selain membutuhkan kerja keras individu. maka berarti dititikberatkan pada kegunaannya.

keadaan akhir).S. jadi sup. Initial state (I. Ketika kentangnya terhidang. digoreng atau direbus saja ? Maka kita harus membatasi dengan jelas keadaan awal yang menjadi titik tolak mengupas kentang dan keadaan akhir yang ingin dicapai supaya dapat “merencanakan” efek neto yang diinginkan. b. yang ditaruh di rak di dapur.S. yaitu keadaan “ sebelum dan sesudah” maka kejadian tersebut berarti sebagai proses. T1. misalnya : a. Dengan sudut pandang ini maka efek kumulatifnya sama dengan efek netto dari seluruh kejadian. adalah kentang sudah ada di kantong kentang. Apakah yang dimaksud dengan mengupas kentang untuk makan malam berarti sampai dengan kentang terhidang ? c.Teknik Pemrograman 4-11 dari aksi dapat dijelaskan dengan membandingkan keadaan pada saat T0 dan keadaan pada saat T1. Dan kejadian tersebut dianggap sebagai sequential process atau disingkat proses. Suatu kejadian dapat dipandang sebagai urut-urutan dari beberapa kejadian. Untuk itu ditentukan : a. berarti dapat diuraikan dalan beberapa (sub) aksi yang terjadi secara sekuensial. Kejadian yang sama dapat dianggap sebagai aksi ataupun sebagai proses. kentang dalam keadaan terkupas di panci. Dengan anggapan kejadian . keadaan awal). Ini adalah contoh bagaimana kita menentukan batasan dari persoalan yang akan diprogram. Kalau lebih dititik beratkan efek netonya. di mana ibu Tati akan mengupasnya. Contoh dari suatu aksi adalah Ibu Tati yang MENGUPAS KENTANG untuk mempersiapkan makan malam. Apakah kentangnya harus dibeli dulu atau sudah ada di dapur ? b. Final state (F. Penggolongan suatu kejadian sebagai proses atau aksi adalah relatif. siap untuk dimasak dan kantong kentangnya harus dikembalikan ke rak lagi. T0. Penambahan kentang ke dapur di luar tinjauan masalah ini. Pernyataan ini mencakup hal yang luas ruang lingkupnya. Pengandaian yang lain adalah bahwa persediaan kentang di ibu selalu cukup untuk makan malam.

dan dapat dipastikan pula bahwa keadaan awal dari keduanya berbeda. Jika dari hasil pengamatan tidak dipandang perlu untuk menjelaskan bahwa kantong kentang diambil dari rak sebelum panci diambil dari almari. Misalkan kejadian tentang ibu Tati mengupas kentang. Kembalikan kantong kentang ke rak. yaitu : • • • • Ambil kantong kentang dari rak. Jika dua kejadian dengan pola yang sama menghasilkan efek neto yang berbeda. Sekarang perhatikanlah laporan pengamatan tentang kejadian ibu Tati yang mengupas kentang : • • • Ibu Tati mengambil kantong kentang dari rak. Kejadian yang lain mungkin mengikuti pola yang sama. maka cukup dituliskan : • • • Ambil kantong kentang dari rak dan panci dari almari. dengan suatu keistimewaan.4-12 Teknik Pemrograman tersebut suatu proses. dapat dijelaskan oleh urut-urutan sub-aksi yang dilakukan oleh ibu tersebut. Ada kejadian yang mempunyai suatu pola tingkah laku. maka T0 adalah awal dari sebuah sub-aksi dan setiap akhir dari suatu sub-aksi akan merupakan awal dari sub-aksi berikutnya. Efek neto dari kejadian ditentukan sepenuhnya oleh pola tersebut dan (mungkin) oleh keadaan awal (yaitu keadaan pada saat T0). akhir dari sub-aksi yang terakhir adalah T1 yaitu akhir dari seluruh kejadian. Kejadian tersebut akan terjadi jika pola ini diikuti. maka efek neto tersebut pasti tergantung pada keadaan awal. Ibu Tati mengambil panci dari almari Ibu Tati mengupas kentang . Ambil panci dari almari Kupas kentang Kembalikan kantong kentang ke rak Pada contoh tersebut. Kupas kentang. kejadian dijelaskan sebagai urut-urutan dari empat sub-aksi yang diungkapkan berdasarkan suatu pengamatan. atau disingkat pola.

Dan notasi untuk aksi kondisional dinyatakan oleh kondisi dan aksi. • • • • Ambil kantong kentang dari rak Ambil panci dari almari If baju berwarna muda then Pakai celemek Kupas kentang . dapat ditarik kesimpulan: algoritma ibu Tati menyatakan cara-cara untuk melakukan sesuatu sedangkan laporan pengamatan menjelaskan tentang kejadian itu sendiri. yaitu sekumpulan intsruksi yang diberikan oleh ibu Tati kepada pembantu barunya : • • • • Ambil kantong kentang dari rak. sedangkan pada hari lain tidak. Misalnya sehabis mengambil panci ia memakai celemek jika perlu. maka jika dilaksanakan akan menghasilkan pengamatan kejadian : • • • • Ina mengambil kantong kentang dari rak Ina mengambil panci dari almari Ina mengupas kentang Ina mengembalikan kantong kentang ke rak Dengan membandingkan teks hasil pengamatan terhadap algoritma. Ada dua hal yang penting. Maka pada suatu hari ia memakai celemek. Ambil panci dari almari. Tetapi kelakuan dari ibu Tati (atau pembantu) dapat lebih rumit. Kupas kentang Kembalikan kantong kentang ke rak Jika teks algoritma tersebut diberikan kepada pembantunya yang bernama Ina. pengamatan apakah baju si ibu berwarna muda. yaitu jika kebetulan ia memakai baju berwarna muda. dan kedua berdasarkan pengamatan tersebut aksi “memakai celemek” bisa terjadi atau tidak (berarti aksi tersebut kondisional). Pertama.Teknik Pemrograman 4-13 • Ibu Tati mengembalikan kantong kentang ke rak Bandingkanlah hasil pengamatan tersebut dengan teks berikut. yang merupakan algoritma.

Dalam hal ini mesin tersebut adalah alat bantu untuk memecahkan dari sudut pandang ini.4-14 Teknik Pemrograman • Kembalikan kantong ke rak Oleh karena itu aksi kondisional mengandung dua aksi. aksi pertama harus suatu pengamatan. Hasil dari pengamatan ini adalah suatu keadaan benar (“true”) atau salah (“false”). Pada algoritma ini kita hanya tertarik pada aksi mengambil kentang dari kantong dan mengupas kentang. While jumlah kentang terkupas belum cukup do depend kantong kantong berisi 1 kentang : Kupas 1 kentang 2. maka kita jarus membuat program yang sesuai untuk masalah tersebut dan mesin akan mengerjakan program sesuai dengan algoritma yang ditulis. jika pengamatan memberikan hasil “false” maka aksi tidak dilakukan. Aksi kedua menghasilkan kejadian berlangsung sesuai dengan hasil pengamatan. Jika pengamatan memberikan hasil “true” maka aksi terjadi. While kantong tidak kosong do Kupas 1 kentang . Contoh Soal Periksalah apakah masing-masing algoritma “mengupas kentang” berikut benar. 1. Sebagai contoh kasus yang ekstrem adalah mengupas 500 kentang (karena kentangnya sangat kecil-kecil dan ada pesta) kita dapat menuliskan algoritma umum untuk mengupas kentang : • • • • • Ambil kantong kentang dari rak Ambil panci dari almari If baju berwarna muda then pakai celemek While jumlah kentang terkupas belum cukup do Kupas 1 kentang Kembalikan kantong kentang ke rak Program yang mengontrol mesin harus disusun sedemikian rupa jika ingin dipakai sesuai keinginan. Misalnya kita ingin menyuruh mesin tersebut untuk memecahkan suatu masalah.

While jumlah kentang terkupas belum cukup do Depend on kantong kantong tidak kosong : kupas 1 kentang kantong kosong : ambil kantong lain . While kantong tidak kosong do While jumlah kentang terkupas belum cukup do Kupas 1 kentang 4. While (kantong tidak kosong) dan (jumlah kentang terkupas belum cukup) do Kupas 1 kentang 5.Teknik Pemrograman 4-15 Kupas 1 kentang 3.

C adalah bahasa yang terstruktur Bahasa C termasuk bahasa tingkat menengah Kekurangan Bahasa C : . Selanjutnya bahasa ini memberikan ide kepada Ken Thompson yang kemudian mengembangkan bahasa yang disebut bahasa B pada tahun 1970. Pendahuluan Bahasa C merupakan perkembangan dari bahasa BCPL yang dikembangkan oleh Martin Richards pada tahun 1967. Proses executable program bahasa C lebih cepat Dukungan pustaka yang banyak. Hampir semua perguruan tinggi di dunia menjadikan bahasa C sebagai salah satu mata kuliah wajib. (sekarang adalah AT & T Bell Laboratories). Saat ini penggunaan bahasa C telah merata di seluruh dunia. Bahasa C pertama kali digunakan di computer Digital Equipment Corporation PDP-11 yang menggunakan sistem operasi UNIX. Perkembangan selanjutnya dari bahasa B adalah bahasa C oleh Dennis Ricthie sekitar tahun 1970-an di Bell Telephone Laboratories Inc.BAB II KEGIATAN BELAJAR II Struktur Dasar Pemrograman Bahasa C A. Selain itu. Kelebihan Bahasa C: • • • • • • • Bahasa C tersedia hampir di semua jenis computer. Kode bahasa C sifatnya adalah portable dan fleksibel untuk semua jenis computer. kita sangat perlu blajar bahasa C. Bahasa C hanya menyediakan sedikit kata-kata kunci. banyak bahasa pemrograman populer seperti PHP dan Java menggunakan sintaks dasar yang mirip bahasa C. Oleh karena itu. hanya terdapat 32 kata kunci.

buka Editor Bahasa C yang ada. Akan ditampilkan hasil kompilasi Program. Editor Bahasa C Memulai Bahasa C. 2.1 . langkah-langkahnya sbb: a. Turbo C.Teknik Pemrograman 4-17 • • Banyaknya Operator serta fleksibilitas penulisan program kadangkadang membingungkan pemakai. 1. Enter d. Menu-menu dalam Turbo C : Gambar : 1 Gambar : 2. B. Pilih submenu Run dan tekan Enter 3. Pilih menu Run dengan menekan Alt + R b. b. dan sebagainya. Untuk menjalankan program : a. Pilih Submenu Compile c. Bagi pemula pada umumnya akan kesulitan menggunakan pointer. Semua program yang ada di tutorial ini bisa dicoba Turbo C. Pilih menu Compile dengan menekan Alt + C. Untuk mengkompilasi Program. seperti Bordland C. tekan sembarang tombol.

(3) Cut. untuk menghapus bagian tertentu dari program (7) Copy example (8) Show Clipboard Search. terdiri dari : (1) Find… (2) Replace… (3) Search again (4) Previous error (5) Next error (6) Locate function… Run. untuk mencetak program (8) DOS Shell. untuk menyimpan file/program (4) Save as. (4) Copy. untuk menyimpan seluruh file/program (6) Change dir. untuk memulai program baru (2) Open. untuk mengubah directory (7) Print. untuk menduplikasi bagian program (5) Paste (6) Clear. untuk menyimpan file/program (5) Save all.4-18 Teknik Pemrograman File . untuk memotong bagian tertentu dari program. untuk membatalkan pengeditan terakhir (2) Redo. terdiri dari : (1) Run…. untuk keluar dari Turbo C Edit. untuk menuju ke DOS Shell (9) Quit. untuk menjalankan program (2) Program reset . terdiri dari : (1) Undo. terdiri dari : (1) New. untuk kembali ke pengeditan terakhir yang telah di undo. untuk mengambil atau membuka program (3) Save.

Teknik Pemrograman 4-19

(3) Go to cursor (4) dst

Compile, terdiri dari : (1) Compile, untuk mengkompilasi program (2) Make (3) Link (4) Build all, dst

Debug, terdiri dari (1) Inspect (2) Evaluate/modify (3) Dst

Project, terdiri dari : (1) Open project (2) Close project (3) dst

Options, terdiri dari : (1) Application (2) Compiler (3) Transfer (4) Dst Window, terdiri dari : (1) Size/Move (2) Zoom (3) Tile (4) Cascade (5) Next (6) dst Help, terdiri dari

4-20 Teknik Pemrograman

(1) Contens (2) Index (3) Topic search (4) Previous topic (5) dst Program Bahasa C tidak mengenal aturan penulisan di kolom tertentu, jadi bisa dimulai dari kolom manapun. Namun demikian, untuk mempermudah pembacaan program dan untuk keperluan dokumentasi, sebaiknya penulisan bahasa C diatur sedemikian rupa sehingga mudah dan enak dibaca. Berikut contoh penulisan Program Bahasa C yang baik Gambar 2.2 dan yang kurang baik Gambar 2.3 #include “stdio.h” void main() { printf(“Bahasa C\n”); } Gambar : 2.2 #include “stdio.h” void main() { printf(“Bahasa C”); }

Gambar : 2.3

Kedua Program di atas bila dijalankan akan menghasilkan hasil yang sama berupa tulisan “Bahasa C” di layar, namun dari segi penulisannya program yang pertama tampaknya lebih mudah dibaca dan lebih rapih dibanding dengan program yang kedua.

C. Struktur Dasar Bahasa C 1. Tipe Data Tipe data merupakan bagian program yang paling penting karena tipe data mempengaruhi setiap instruksi yang akan dilaksanakan oleh computer. Misalnya saja 5 dibagi 2 bisa saja menghasilkan hasil yang berbeda tergantung tipe datanya. Jika 5 dan 2 bertipe integer maka akan menghasilkan nilai 2, namun jika keduanya bertipe float maka akan menghasilkan nilai 2.5000000. Pemilihan tipe data yang tepat akan membuat proses operasi data menjadi lebih efisien dan efektif. Dalam bahasa C terdapat lima tipe data dasar, Gambar 2.4 :

Teknik Pemrograman 4-21

Gambar : 2.4 Contoh Program : #include “stdio.h” #include “conio.h” void main() { int x; float y; char z; double w; clrscr(); /* untuk membersihkan layar */ x = 10; /* variable x diisi dengan 10 */ y = 9.45; /* variable y diisi dengan 9.45 */ z = ‘C’; /* variable z diisi dengan karakter “C” */ w = 3.45E+20; /* variable w diisi dengan 3.45E+20 */ printf(“Nilai dari x adalah : %i\n”, x); /* Menampilkan isi variable x */ printf(“Nilai dari y adalah : %f\n”, y); /* Menampilkan isi variable y */ printf(“Nilai dari z adalah : %c\n”, z); /* Menampilkan isi variable z */ printf(“Nilai dari w adalah : %lf\n”, w); /* Menampilkan isi variable w */ getch(); } 2. Konstanta Konstanta merupakan suatu nilai yang tidak dapat diubah selama proses program berlangsung. Konstanta nilainya selalu tetap. Konstanta harus didefinisikan terlebih dahulu di awal program. Konstanta dapat bernilai integer, pecahan, karakter dan string. Contoh konstanta : 50; 13; 3.14; 4.50005; ‘A’; ‘Bahasa C’. Selain itu, bahasa C juga menyediakan beberapa karakter khusus yang disebut karakter escape, antara lain : \a : untuk bunyi bell (alert) \b : mundur satu spasi (backspace) \f : ganti halaman (form feed) \n : ganti baris baru (new line) \r : ke kolom pertama, baris yang sama (carriage return) \v : tabulasi vertical

4-22 Teknik Pemrograman

\0 : nilai kosong (null) \’ : karakter petik tunggal \” : karakter petik ganda \\ : karakter garis miring

3. Variable Variabel adalah suatu pengenal (identifier) yang digunakan untuk mewakili suatu nilai tertentu di dalam proses program. Berbeda dengan konstanta yang nilainya selalu tetap, nilai dari suatu variable bisa diubah-ubah sesuai kebutuhan. Nama dari suatu variable dapat ditentukan sendiri oleh pemrogram dengan aturan sebagai berikut : • Terdiri dari gabungan huruf dan angka dengan karakter pertama harus berupa huruf. Bahasa C bersifat case-sensitive artinya huruf besar dan kecil dianggap berbeda. Jadi antara nim, NIM dan Nim dianggap berbeda. • • Tidak boleh mengandung spasi. Tidak boleh mengandung symbol-simbol khusus, kecuali garis bawah (underscore). Yang termasuk symbol khusus yang tidak diperbolehkan antara lain : $, ?, %, #, !, &, *, (, ), -, +, = dsb. • Panjangnya bebas, tetapi hanya 32 karakter pertama yang terpakai. Contoh penamaan variabel yang benar : NIM, a, x, nama_mhs, f3098, f4, nilai, budi, dsb. Contoh penamaan variable yang salah : %nilai_mahasiswa, 80mahasiswa, rata-rata, ada spasi, penting!, dsb

4. Deklarasi Deklarasi diperlukan bila kita akan menggunakan pengenal (identifier) dalam program. Identifier dapat berupa variable, konstanta dan fungsi. a. Deklarasi Variabel Bentuk umum pendeklarasian suatu variable adalah : Nama_tipe nama_variabel;

Teknik Pemrograman 4-23

Contoh : int x; // Deklarasi x bertipe integer char y, huruf, nim[10]; // Deklarasi variable bertipe char float nilai; // Deklarasi variable bertipe float double beta; // Deklarasi variable bertipe double int array[5][4]; // Deklarasi array bertipe integer char *p; // Deklarasi pointer p bertipe char

b. Deklarasi Konstanta Dalam bahasa C konstanta dideklarasikan menggunakan preprocessor #define. Contohnya : #define PHI 3.14 #define nim “0111500382” #define nama “Sri Widhiyanti”

c. Deklarasi Fungsi Fungsi merupakan bagian yang terpisah dari program dan dapat diaktifkan atau dipanggil di manapun di dalam program. Fungsi dalam bahasa C ada yang sudah disediakan sebagai fungsi pustaka seperti printf(), scanf(), getch() dan untuk menggunakannya tidak perlu dideklarasikan. Fungsi yang perlu dideklarasikan terlebih dahulu adalah fungsi yang dibuat oleh programmer. Bentuk umum deklarasi sebuah fungsi adalah : Tipe_fungsi nama_fungsi(parameter_fungsi); Contohnya : float luas_lingkaran(int jari); void tampil(); int tambah(int x, int y); Misalnya : 9%2=1 9%3=0

4-24 Teknik Pemrograman

5. Operator a. Operator Penugasan Operator Penugasan (Assignment operator) dalam bahasa C berupa tanda sama dengan (“=”). Contoh : nilai = 80; A = x * y; Artinya : variable “nilai” diisi dengan 80 dan variable “A” diisi dengan hasil perkalian antara x dan y. b. Operator Aritmatika Bahasa C menyediakan lima operator aritmatika, yaitu : * / % + : untuk perkalian : untuk pembagian : untuk sisa pembagian (modulus) : untuk pertambahan : untuk pengurangan

Catatan : operator % digunakan untuk mencari sisa pembagian antara dua bilangan. Misalnya : 9%2=1 9%3=0 9%5=4 9%6=3 Contoh Program 1 : #include “stdio.h” #include “conio.h” void main() { clrscr(); // untuk membersihkan layar printf(“Nilai dari 9 + 4 = %i”, 9 + 4); /* mencetak hasil 9 + 4 */ printf(“Nilai dari 9 - 4 = %i”, 9 - 4); /* mencetak hasil 9 - 4 */ printf(“Nilai dari 9 * 4 = %i”, 9 * 4); /* mencetak hasil 9 * 4 */ printf(“Nilai dari 9 / 4 = %i”, 9 / 4); /* mencetak hasil 9 / 4 */ printf(“Nilai dari 9 \% 4 = %i”, 9 % 4); /* mencetak hasil 9 % 4 */ getch();

Teknik Pemrograman 4-25

} Contoh Program 2 : /* operator % utk mencetak deret bilangan genap antara 1 – 100 */ #include “stdio.h” #include “conio.h” void main() { int bil; clrscr(); // untuk membersihkan layar for (bil=1; bil<100; bil++) { if(bil % 2 == 0) //periksa apakah ‘bil’ genap printf(“%5.0i”, bil); } getch(); } c. Operator Hubungan (Perbandingan) Operator Hubungan digunakan untuk membandingkan hubungan antara dua buah operand (sebuah nilai atau variable). Operator hubungan dalam bahasa C gambar 3 :

Gambar : 2.5 d. Operator Logika Jika operator hubungan membandingkan hubungan antara dua buah operand, maka operator logika digunakan untuk membandingkan logika hasil dari operator-operator hubungan. Operator logika ada tiga macam, yaitu : && || ! : Logika AND (DAN) : Logika OR (ATAU) : Logika NOT (INGKARAN)

4-26 Teknik Pemrograman

e. Operator Bitwise Operator bitwise digunakan untuk memanipulasi bit-bit dari nilai data yang ada di memori. Operator bitwise dalam bahasa C : << >> & ^ | ~ : Pergeseran bit ke kiri : Pergeseran bit ke kanan : Bitwise AND : Bitwise XOR (exclusive OR) : Bitwise OR : Bitwise NOT

f. Operator Unary Operator Unary merupakan operator yang hanya membutuhkan satu operand saja. Dalam bahasa C terdapat beberapa operator unary, Gambar : 3

Gambar : 2.6 Catatan Penting ! : Operator peningkatan ++ dan penurunan -- jika diletakkan sebelum atau sesudah operand terdapat perbedaan. Perhatikan contoh berikut : Contoh Program 1 : /* Perbedaan operator peningkatan ++ yang diletakkan di depan */ /* dan dibelakang operand */ #include <stdio.h> #include <conio.h>

Teknik Pemrograman 4-27

void main() int x, nilai; clrscr(); x = 5; nilai = ++x; /* berarti x = x + 1; nilai = x; */ printf("nilai = %d, x = %d\n", nilai, x); nilai = x++; /* berarti nilai = x; nilai = x + 1; */ printf("nilai = %d, x = %d\n", nilai, x); getch(); } Contoh Program 2 : #include “stdio.h” #include “conio.h” void main() { int b, nilai; clrscr(); // untuk membersihkan layar nilai = --b; /* berarti b = b - 1; nilai = b; */ printf("nilai = %d, b = %d\n", nilai, b); nilai = b--; /* berarti nilai = b; b = b + 1; */ printf("nilai = %d, b = %d\n", nilai, b); getch(); } 6. Kata Tercadang (Reserved Word) Bahasa C standar ANSI memiliki 32 kata tercadang (reserved word) dan Turbo C menambahkannya dengan 7 kata tercadang. Semua reserved word tidak boleh digunakan dalam penamaan identifier (variable, nama fungsi dll). Kata Tercadang yang tersedia dalam bahasa C adalah sbb:

7. Komentar Program Komentar program hanya diperlukan untuk memudahkan pembacaan dan pemahaman suatu program (untuk keperluan dokumentasi program).

4-28 Teknik Pemrograman

Dengan kata lain, komentar program hanya merupakan keterangan atau penjelasan program. Untuk memberikan komentar atau penjelasan dalam bahasa C digunakan pembatas /* dan */ atau menggunakan tanda // untuk komentar yang hanya terdiri dari satu baris. Komentar program tidak akan ikut diproses dalam program (akan diabaikan). Contoh Program : #include “stdio.h” #include “conio.h” void main() { clrscr(); /* Ini untuk membersihkan layar tampilan */ printf(“Contoh Penggunaan Komentar”); //komentar tidak ikut diproses getch(); /* Dan ini untuk menahan tampilan di layer */ }

%e %o %x %u : Membaca sebuah karakter : Membaca sebuah string : Membaca sebuah bilangan bulat (integer) : Membaca sebuah bilangan pecahan (real) : membaca sebuah bilangan octal : Membaca sebuah bilangan heksadesimal : Membaca sebuah bilangan tak bertanda Contoh Program : /* Program memasukan inputan dengan beberapa tipe data */ #include <stdio.BAB III KEGIATAN BELAJAR III Input dan Output A. Memasukan Data Dalam bahasa C proses memasukkan suatu data bisa menggunakan beberapa fungsi pustaka yang telah tersedia. %d %f. Hal-hal yang perlu diperhatikan dalam pemakaian fungsi scanf() : 1) Fungsi scanf() memakai penentu format 2) Fungsi scanf() memberi pergantian baris secara otomatis 3) Fungsi scanf() tidak memerlukan penentu lebar field 4) Variabelnya harus menggunakan operator alamat & Kode penentu format : %c %s %i.h> void main() { int jumlah. b. char huruf. . float nilai. karakter dan string secara terformat. nim[10]. scanf() a.h> #include <conio. Beberapa fungsi pustaka yang bisa digunakan adalah : 1. Fungsi pustaka scanf() digunakan untuk menginput data berupa data numerik.

/* membaca sebuah string */ printf("Masukkan sebuah bilangan pecahan : "). /* membaca sebuah karakter */ printf("Masukkan nim Anda : "). jumlah ). nilai ). printf("Masukkan sebuah bilangan bulat : "). scanf("%f". Tidak memerlukan penentu format Contoh Program : /* Program inputan tipe data karakter/string */ #include “stdio. printf("nilai = %f\n". getch(). scanf("%c". void main() { char nama[20]. printf("huruf = %c\n". } 2. printf("nim = %s\n". printf(“Hello. /* membaca sebuah bilangan bulat */ printf("Masukkan sebuah karakter : "). gets() a. c. Fungsi gets() digunakan untuk memasukkan data bertipe karakter dan tidak dapat digunakan untuk memasukkan data numerik. &jumlah ). huruf ). gets(nama). printf(“Masukkan nama Anda : “). &huruf ). b. Harus diakhiri dengan penekanan tombol enter. /* membaca sebuah bilangan float */ printf("\nNilai variable yang Anda masukkan adalah :\n"). scanf("%s". &nilai ). nama). Cursor secara otomatis akan pindah baris. getch(). clrscr(). d.h” #include “conio. &nim ). scanf("%d". Nama Anda adalah %s”. } . nim ).4-30 Teknik Pemrograman clrscr(). printf("jumlah = %d\n".

Teknik Pemrograman 4-31 3. d. huruf1 = getche(). printf(“Masukkan sebuah karakter : “). getch(). huruf2). getchar() a.h” void main() { char huruf1. Contoh Program : #include “stdio. Sedangkan pada getche() karakter yang dimasukkan akan ditampilkan pada layar. getch() dan getche() a. Harus diakhiri dengan penekanan tombol enter c. // karakter yang dimasukkan akan terlihat di layar printf(“\nKarakter yang Anda masukkan adalah %c\n”. Fungsi getch() dan getche() digunakan untuk membaca data karakter. printf(“\nMasukkan sebuah karakter lagi : “). Fungsi getchar() digunakan untuk membaca data yang bertipe karakter b. Tidak memberikan efek pergantian baris secara otomatis. Pergantian baris secara otomatis 4. huruf1). b. Karakter yang dimasukkan terlihat pada layar d. Karakter yang dimasukkan tidak perlu diakhiri dengan penekanan tombol enter. huruf2. huruf2 = getch().h” #include “conio. // karakter yang dimasukkan tidak terlihat di layar printf(“\nKarakter yang Anda masukkan adalah : %c. Jika menggunakan fungsi getch() karakter yang dimasukkan tidak akan ditampilkan pada layer sehingga sering digunakan untuk meminta inputan berupa password. c. } . e.

Mengatur tampilan bilangan pecahan (float).2f”. . printf(“Anda memperoleh nilai %5. getch(). clrscr(). argument). nilai).4-32 Teknik Pemrograman B. } : menyatakan panjang range : menyatakan jumlah digit di belakang koma. Fungsi puts() digunakan untuk menampilkan data string dan secara otomatis akan diakhiri dengan perpindahan baris. dan putchar(). Menampilkan Data 1. printf(“Apakah Anda telah puas mendapat nilai %6.h” void main() { float nilai. Menggunakan fungsi printf().2f”. Fungsi putchar() digunakan untuk menampilkan sebuah karakter. scanf(“%f”. Bentuk umum : printf(“%m. puts(“Masukkan nilai Anda : ). b. /* Program untuk menampilkan data berupa bilangan pecahan */ #include “stdio. nilai). m n argument Contoh : printf(“%5. Fungsi printf() digunakan untuk menampilkan semua jenis data (numeric dan karakter) c. artinya variable nilai akan ditampilkan sebanyak 5 digit dengan 2 digit di belakang koma.nf”. Contoh Program 1. &nilai). puts(). nilai).h” #include “conio. : nilai atau variable yang akan ditampilkan. Menampilkan data ke layar monitor a. d.4f ?”.

fputs(stdprn. “Hallo. //tipe data string printf(“Umur Anda : %d \n”. printf(“Nama Anda : %s \n”. Untuk menampilkan data ke printer dapat menggunakan fungsi fprintf(). } . Fungsi fprintf() digunakan untuk mencetak semua jenis tipe data ke printer dan secara otomatis memberikan efek perpindahan baris. char nama[20]. puts(“Masukkan nama Anda : ). fputs() dan fputc(). nama).h” void main() { fprintf(stdprn.h” void main() { int umur. b. //tipe data integer getch().h” #include “conio. umur). gets(nama). scanf(“%d”. Menampilkan data ke printer a. c.Teknik Pemrograman 4-33 Contoh Program 2. puts(“Masukkan umur Anda : “). Fungsi fputs() digunakan untuk mencetak tipe data string ke printer d. Saya akan tercetak di printer”). clrscr(). } 2. Fungsi fputc() digunakan untuk mencetak tipe data karakter ke printer Contoh program : #include “stdio.h” #include “conio. “Saya juga akan tercetak di printer”). /* Program untuk menampilkan data berupa bilangan integer dan string */ #include “stdio. &umur).

Contoh Program 1 : /* Program struktur kondisi if untuk memeriksa suatu kondisi */ #include “stdio. maka pernyataan yang ada di dalam blok if akan diproses dan dikerjakan. } . if(nilai > 65) printf(“\n ANDA LULUS !!!!\n”). Fungsi penyeleksian kondisi penting artinya dalam penyusunan bahasa C. scanf(“%f”. Bila katup terbuka maka air akan mengalir dan sebaliknya bila katup tertutup air tidak akan mengalir atau akan mengalir melalui tempat lain. Bentuk umum struktur kondisi if adalah : if(kondisi) pernyataan. &nilai). getch(). Penyeleksian kondisi dapat diibaratkan sebagai katup atau kran yang mengatur jalannya air. 1. Bila proses yang diseleksi terpenuhi atau bernilai benar. printf(“Masukan nilai yang didapat : “).BAB IV KEGIATAN BELAJAR IV A. terutama untuk program yang kompleks. Penyeleksi Kondisi Penyeleksian kondisi digunakan untuk mengarahkan perjalanan suatu proses. Struktur Kondisi IF Struktur if dibentuk dari pernyataan if dan sering digunakan untuk menyeleksi suatu kondisi tunggal.h” #include “conio.h” void main() { float nilai.

max. if(max>0) printf("Bil tsb adalah bil positif\n").max). namun sebaliknya bila kita memasukan sebuah nilai yang kurang dari 65 maka program akan berhenti dan tidak dihasilkan apa-apa.fflush(stdin).h" void main() { clrscr().scanf("%i". if(max<0) printf("Bil tsb adalah bil negatif"). if((a>b)&&(a>c)) max=a. b.scanf("%i". printf("Entry bil 2 : "). maka perintah mencetak perkataan LULUS !!!! akan dilaksanakan. int a. c. printf("Entry bil 3 : "). Contoh Program 2 : /* Program contoh penerapan struktur kondisi if */ #include"stdio. getch().&a). if((b>a)&&(b>c)) max=b.fflush(stdin).&c).fflush(stdin). printf("Entry bil 1 : "). } .Teknik Pemrograman 4-35 Bila program tersebut dijalankan dan kita memasukan nilai 80.&b).scanf("%i". printf("Bil terbesar : %i\n".h" #include"conio. if((c>a)&&(c>b)) max=c.

getch(). else printf(“\n TIDAK LULUS !!!\n”). scanf(“%f”..else minimal terdapat dua pernyataan. Hal ini berbeda dengan struktur if dimana program akan berhenti bila kita memasukan nilai kurang dari 65. . Bentuk umumnya adalah sebagai berikut : if(kondisi) pernyataan-1 else pernyataan-2 Contoh Program : #include “stdio.4-36 Teknik Pemrograman 2. &nilai).. clrscr().... /* Masukan akan disimpan dalam variable nilai */ if (nilai > 65) printf(“\n LULUS !!!\n”).ELSE Dalam struktur kondisi if.h” #include “conio. printf(“Masukan nilai yang didapat : “).. Struktur Kondisi IF. } Bila program tersebut dijalankan dan kita memasukan nilai 80 maka akan dicetak perkataan “LULUS !!!” namun bila kita memasukan nilai yang kurang dari 65 maka akan tercetak perkataan “TIDAK LULUS !!!”.h” void main() { float nilai. Jika kondisi yang diperiksa bernilai benar atau terpenuhi maka pernyataan pertama yang dilaksanakan dan jika kondisi yang diperiksa bernilai salah maka pernyataan yang kedua yang dilaksanakan.

.... Selanjutnya proses diteruskan hingga ditemukan pernyataan ‘break’..Teknik Pemrograman 4-37 3. Struktur ini akan melaksanakan salah satu dari beberapa pernyataan ‘case’ tergantung nilai kondisi yang ada di dalam switch. break. Struktur Kondisi SWITCH. break. break...... case n : pernyataan-n.DEFAULT… Struktur kondisi switch. maka proses akan diteruskan kepada pernyataan yang ada di bawah ‘default’.default digunakan untuk penyeleksian kondisi dengan kemungkinan yang terjadi cukup banyak... Jika tidak ada nilai pada case yang sesuai dengan nilai kondisi. ..CASE.. default : pernyataan-m } ..case.... . case 2 : pernyataan-2... Bentuk umum dari struktur kondisi ini adalah : switch(kondisi) { case 1 : pernyataan-1.

} . switch(hari) { case 1 : puts(“Hari Senin”). case 4 : puts(“Hari Kamis”). &hari). /* kemungkinan kedua */ break. /* kemungkinan keempat */ break. /* kemungkinan kelima */ break. /* kemungkinan ketiga */ break. puts(“1 = Senin 2 = Selasa 3 = Rabu 4 = Kamis”). int hari. case 7 : puts(“Hari Minggu”). /* kemungkinan pertama */ break. case 5 : puts(“Hari Jum’at”).4-38 Teknik Pemrograman Contoh Program : /* Program menentukan nama hari berdasarkan inputan */ #include “stdio. printf(“\nMasukan kode hari( 1-7) : “). puts(“5 = Jum’at 6 = Sabtu 7 = Minggu”). scanf(“%d”. case 3 : puts(“Hari Rabu”). /* kemungkinan keenam */ break. case 6 : puts(“Hari Sabtu”). /* kemungkinan ketujuh */ break. default : puts(“Kode hari yang Anda masukan SALAH”).h” void main() { clrscr(). puts(“Menentukan nama hari\n”).h” #include “conio. case 2 : puts(“Hari Selasa”). } getch().

. bila 2 akan tercetak “Hari Selasa” dan seterusnya.Teknik Pemrograman 4-39 Bila program tersebut dijalankan. dan kita memasukan kode hari dengan 1 maka akan tercetak “Hari Senin”.

Namun dengan struktur perulangan proses. x ++. cukup dengan beberapa perintah saja. Struktur Perulangan “ WHILE” Perulangan WHILE banyak digunakan pada program yang terstruktur. Misalnya saja. bila kita ingin menginput dan mencetak bilangan dari 1 sampai 100 bahkan 1000. x). tentunya kita akan merasa kesulitan. } Jika program tersebut dijalankan maka akan menghasilkan hasil sebagai berikut .BAB IV KEGIATAN BELAJAR IV Perulangan Dalam bahasa C tersedia suatu fasilitas yang digunakan untuk melakukan proses yang berulangulang sebanyak keinginan kita. Struktur perulangan dalam bahasa C mempunyai bentuk yang bermacam-macam. Perulangan ini banyak digunakan bila jumlah perulangannya belum diketahui. Proses perulangan akan terus berlanjut selama kondisinya bernilai benar (true) dan akan berhenti bila kondisinya bernilai salah. x = 1. A. Contoh Program 1 : /* Program Perulangan menggunakan while */ #include “stdio. /* awal variabel */ while (x <= 10) /* Batas akhir perulangan */ { printf(“%d BAHASA C\n”. kita tidak perlu menuliskan perintah sampai 100 atau 1000 kali. /* variabel x ditambah dengan 1 */ } getch().h” void main() { int x.h” #include “conio.

Struktur Perulangan “DO. proses atau perintah mencetak kata-kata “BAHASA C” akan terus dilakukan selama variabel x masih kurang atau sama dengan 10.WHILE…” Pada dasarnya struktur perulangan do.. } B... int i=1. hanya saja pada proses perulangan dengan while.while. } printf("\n").h" #include"conio. while(x<=i) { printf("%3i". Contoh Program 2 : /* Program mencetak deret bilangan dengan menggunakan while */ #include"stdio.while sama saja dengan struktur while.x)..x.. Jadi dengan .. x=x+1.. nilai dari variabel x akan bertambah 1.h" void main() { clrscr().Teknik Pemrograman 4-41 1BAHASA C 2BAHASA C 3BAHASA C 4BAHASA C 5BAHASA C 6BAHASA C 7BAHASA C 8BAHASA C 9BAHASA C 10BAHASA C Pada perulangan while di atas... i=i+1. Setiap kali melakukan perulangan.. seleksi berada di while yang letaknya di atas sementara pada perulangan do. while(i<=3) { x=1. seleksi while berada di bawah batas perulangan. } getch().

Contoh Program : #include “stdio. syarat : ekspresi relasi yang menyatakan kondisi untuk keluar dari perulangan. penambahan : pengatur perubahan nilai variabel kontrol. } C. Keterangan : a. getch(). b. syarat. c. . do { printf(“%d BAHASA C\n”. Dari segi penulisannya. x = 1. Struktur Perulangan “FOR” Struktur perulangan for biasa digunakan untuk mengulang suatu proses yang telah diketahui jumlah perulangannya. x ++. Inisialisasi : pernyataan untuk menyatakan keadaan awal dari variable kontrol.h” void main() { int x. } while(x <= 10). x). penambahan) pernyataan. Bentuk umum perulangan for adalah sebagai berikut : for(inisialisasi.4-42 Teknik Pemrograman menggunakan struktur do…while sekurang-kurangnya akan terjadi satu kali perulangan. struktur perulangan for tampaknya lebih efisien karena susunannya lebih simpel dan sederhana.h” #include “conio.

i++) { printf("Entry bilangan %i : ".r). } printf("\n Total : %. printf("\n Rata rata : %.h" #include"conio.2f". y=y+1.i<=2. t=t+x. x<= 10. getch().y++) for(i=0. for(y=1.t=0. r=t/i.Teknik Pemrograman 4-43 Contoh Program 1 : /* Program perulangan menggunakan for */ #include “stdio.i.scanf("%f". } getch().h” #include “conio.&x). float r.y).h” void main() { int x. x++) { printf(“%d BAHASA C\n”.t). } Contoh Program 2 : /* Mencari total dan rata-rata sejumlah bilangan menggunakan for */ #include"stdio.x.h" void main() { clrscr(). } .2f". for(x = 1.int y.y<=3. x).

{ int index. Dilihat dari dimensinya array dapat dibagi menjadi Array dimensi satu. scanf(“%i”. /* input nilai mahasiswa */ printf(“Input nilai 10 mahasiswa : “). array dimensi dua dan array multi-dimensi. clrscr(). index+1). c. index < 10. index++) { printf(“Mahasiswa %i : “. Setiap elemen array dapat diakses melalui indeks.h” void main(). &nilai[index]). A. Letak atau posisi dari elemen array ditunjukkan oleh suatu index. nilai[10]. Array Dimensi Satu a. Indeks array secara default dimulai dari 0.BAB V KEGIATAN BELAJAR V Array Array merupakan kumpulan dari nilai-nilai data yang bertipe sama dalam urutan tertentu yang menggunakan nama yang sama. for(index=0. Deklarasi Array Bentuk umum : Tipe_array nama_array[ukuran]. } . Contoh : Contoh Program : /* Program untuk menginput nilai mahasiswa dalam array satu dimensi */ #include “stdio.h” #include “conio. b.

index++) { printf(“%5. printf(“Masukkan nama Anda : “). Contoh aplikasi array satu dimensi : /* Program untuk menentukan jurusan & jenjang mahasiswa berdasarkan NIM*/ #include “stdio. “Teknik Komputer”). nama[20]. “Komputerisasi Akuntansi”).h” #include “conio. } CATATAN : String juga sebenarnya merupakan array yang bertipe karakter.0i”. /***** cari jurusan *****/ switch(nim[2]) { case ‘1’ : strcpy(jurusan. nim[10]. for(index=0. break. break. index < 10. Jumlah elemen array menyatakan jumlah string. nilai[index]).h” #include “string. printf(“Masukkan NIM Anda : “). gets(nim). break. “Teknik Informatika”). } getch(). . case ‘2’ : strcpy(jurusan.Teknik Pemrograman 4-45 /* tampilkan nilai mahasiswa */ printf(“Nilai mahasiswa yang telah diinput”).h” void main() { char jurusan[25]. jenjang[10]. case ‘4’ : strcpy(jurusan. case ‘3’ : strcpy(jurusan. gets(nama). “Sistem Informasi”). crlscr().

Coba periksa lagi !”). Bentuknya dapat berupa matriks atau tabel. jurusan). Array Dimensi Dua Array dua dimensi merupakan array yang terdiri dari m buah baris dan n buah kolom. Deklarasi array : Tipe_array nama_array[baris][kolom]. } else { if(nim[4] == ‘3’) { strcpy(jenjang. } /***** cari jenjang *****/ if(nim[4] == ‘5’) { strcpy(jenjang. printf(“NIM : %s”. default : printf(“Anda salah memasukkan NIM. printf(“Nama : %s”.4-46 Teknik Pemrograman break.”Diploma-3”). } /***** tampilkan data mahasiswa *****/ printf(“ << Data Mahasiswa Universitas Budi Luhur >>“). } else printf(“ANda salah memasukkan NIM. jenjang). “Strata-1”). . nim). getch(). } B. break. Coba periksa lagi !”). printf(“Jurusan : %s”. nama). printf(“Jenjang : %s”.

scanf(“%i”. Untuk mengakses array. kolom. } // Tampilkan elemen Array secara Row Major Order printf(“Isi array : \n”). Row Major Order (secara baris per baris) e.h” #include “conio. baris+1. kolom+1). baris++) { for(kolom=0. // Input elemen array secara Row Major Order printf(“Input elemen Array : \n“). baris<3. for(baris=0.Teknik Pemrograman 4-47 Contoh : Int X[3][4]. misalnya kita ingin mengisi elemen array baris 2 kolom 3 dengan 10 maka perintahnya adalah sbb : X[1][2] = 10. &matriks[baris][kolom]). Column Major Order (secara kolom per kolom) Contoh Program 1 : /* Program menginput nilai(bilangan) ke dalam array dimensi dua dan menampilkannya */ #include “stdio. . matriks[3][4]. } printf(“\n”). Untuk mengisi dan menampilkan isi elemen array ada dua cara yaitu : d.h” { int baris. kolom<4. kolom++) { printf(“matriks[%i][%i]”.

4-48 Teknik Pemrograman for(baris=0.&B[i][j]). } Contoh Program 2 : /* Program penjumlahan matriks dua dimensi */ #include "stdio. X[3][4].i<3.i++) { for(j=0.h" void main() { int A[3][4].i+1. } } /******** Proses penjumlahan matriks A dan B ********/ . &matriks[baris][kolom]).j<4. kolom<4. fflush(stdin).i+1. B[3][4].i<3. clrscr(). Y[3][4].i++) { for(j=0. kolom++) { printf(“%i”.scanf("%i". baris<3. baris++) { for(kolom=0. C[3][4].j+1). i. } printf(“\n”).j+1).&A[i][j]). j.scanf("%i".h" #include "conio. fflush(stdin). } getch().j++) { printf("input data matrik A[%i][%i] : ".j<4. /******* Masukkan matriks A *******/ for(i=0. } } /******** Masukkan matriks B ********/ for(i=0.j++) { printf("input data matrik B[%i][%i] : ".

j++) printf("%6i".X[i][j]).i++) { for(j=0.i++) { for(j=0.printf("\n"). for(i=0. } } /******** Cetak isi matriks A ********/ printf("\n matrik A\n"). } printf("\n\n"). for(i=0.j++) { X[i][j]=A[i][j]+B[i][j]. /******** Cetak hasil penjumlahan matriks A dan B *******/ printf("\n matrik penjumlahan A+B\n"). getch().j<4.B[i][j]).j<4.i<3.i<3. } . } printf("\n").i<3.i++) { for(j=0.j<4.i<3. printf("\n"). /******** Cetak isi matriks B *******/ printf("\n matrik B\n").Teknik Pemrograman 4-49 for(i=0.A[i][j]).j++) printf("%6i". } printf("\n").j<4.i++) { for(j=0.printf("\n"). for(i=0.j++) printf("%6i".

2f".h" #include "conio.4-50 Teknik Pemrograman Contoh aplikasi Array untuk menghitung invers suatu matriks dengan ukuran m x n dengan metode Gauss-Jordan : /* MENGHITUNG INVERS MATRIKS DENGAN METODE GAUSSJORDAN */ #include "stdio. for(j=1. printf("\nMasukkan ukuran matriks : \n"). printf("\nMasukkan nilai elemen matriks yang akan diinvers”). j<=m. j. &a[i][j]). } } /* Mencetak Matriks asli */ printf("\nMatriks asli : "). int m. i++) { printf("\n"). j<=m. j). printf(“\nsecara baris per baris\n"). scanf("%f". i<=m. clrscr(). i++) { printf("\n"). x. t.%d)= ". i. /* Membaca matriks asli */ for(i=1. for(i=1. &m). scanf("%d". } /* Proses inversi */ for(i=1. j++) { printf("A(%d.h" void main() { float p[20]. i<=m.i. a[20][20]. a[i][j]). k. i++) . for(j=1. i<=m. j++) printf(" %.

a[i][j]). } C. i++) { for(j=1. j++) printf(" %. . i <=m.a[i][x] * t. j<=m. for(i =1. j++) { a[i][j] = a[i][j]/p[i]. j<=m. } getch(). Bentuk umumnya yaitu : tipe_array nama_array[ukuran1][ukuran2]…[ukuranN]. } } } /* Mencetak matriks hasil inversi*/ printf("\n\nMatriks inversi : \n"). k++) { if(k != i) { t = a[k][i]. Bentuk pendeklarasian array sama saja dengan array dimensi satu maupun array dimensi dua. for(x=1. a[k][i] = 0.1f". for(j=1. Array Multi Dimensi Array multi-dimensi merupakan array yang mempunyai ukuran lebih dari dua. x<=m. a[i][j] = 1. k<=m. } for(k=1. printf(" \n").Teknik Pemrograman 4-51 { p[i] = a[i][j]. x++) a[k][x] = a[k][x] .

1. 1. 0. 0 }. 0. 1. 0. 0. 0. 0. 1. 1. 1. 1. 0 }. 0 }. 1. 1. 1. { { 1. 1. 0. 1. 1. 0. 1. 0. 1. 1. 0 }. 1. 1. 1. { 0. j.4-52 Teknik Pemrograman Contoh : float X[2][4][3]. 1. 0. 0. { 1. { 1. 1. 0. 0. 0. 0. 0. 0. 1. 0. 1. 1. { 1. 1. 0. 0 }. 1. 1. 0 }. 0. 0. 0 }. 1. 0. 0. 1. 1. 1. { 1. 0. 1. k. . 1. 1. 0 } }. 1. 0. 0. 0. 0. 1. 0 }. 1. 1. 1. 0. { 1. 1. 0 }. { 1. 0. 1. 1. 0. 0. 0. 1. 1. 0 }. 0. 1.h” void main() { int i. 0. 1. 0. Contoh Program : #include “stdio. 1. 0. 1. 1. 0 }. 0. 1. 0 }. 1. { 1. 0 }. 1. { 1. static int data_huruf[2][8][8] = { { { 1. { 1. 1. { 1. 0. 0. 0 }.h” #include “conio. 0. 0. 1. { 0. 0 } } }. { 0. { 1.

} getch(). i<2. i++) { for(j=0. /* spasi */ puts(“”). k++) if(data_huruf[i][j][k]) putchar(‘\xDB’). j++) { for(k=0. j<8.k<8. } .Teknik Pemrograman 4-53 /* Tampilkan Huruf */ for(i=0. else putchar(“ “). } puts(“”).

BUKU AJAR Mikroprosesor .

Deskripsi Buku ajar ini menguraikan tentang permasalahan Mikroprosesor. Pada akhir pembelajaran ini diharpakan persta diklat dapat mendeskripkan Mikroprosesor Z-80. membahas tentang sistem mikroprosesor. membahas tentang Mikroprosesor. Pada akhir pembelajaran ini diharpakan persta diklat dapat mendeskripkan tetang mikroprosesor. Pada akhir pembelajaran ini diharpakan persta diklat dapat mendeskripkan tentang sistem mikroprosesor. Sejalan dengan perencanaan pembelajaran tersebut. Bab 3. membahas tentang beberapa istilah yang berhubungan dengan sistem mikroprosesor. Pada akhir pembelajaran ini diharpakan persta diklat dapat mendeskripkan beberapa istilah yang berhubungan dengan sistem mikroprosesor. . Bab 4 membahas tentang Mikroprosesor Z-80.BAB I PENDAHULUAN A. Setiap pembelajaran diberi pelatihan dan pad akhir kegiatan diadakan test formatif. Bab 2. uraian materi dibagi menjadi empat bagian. dengan harapan setelah selesai mempelajari buku ajar ini bekenan untuk memperkaya pengetahuan diri dengan membaca buku-buku literatur. masing-masing bagian membahas tentang : Bab 1. Buku ajar ini dimaksudkan untuk membantu peserta didik yang belum sempat memiliki dan mebaca buku0buku literatur tentang mikroprosesor. Materi pembelajaran buku ajar ini diharapkan dapat diselesaikan dalam empat kegiatan belajar masing-masing 2 sks.

peserta didik mempunyai mengetahuan tentang mikroprosesor . Kompetensi Setelah menyelesaikan seluruh kegiatan belajar dalam Buku Ajar ini. Bila peserta belum mampu menjawab sebagian besar dari soal-soal yang ditampilkan dalam latihan maupun test formatif.5-2 Mikroprosesor B. Buku ajar akan lebih baik bila dipelajari secara berkelompok untuk memahami hal-hal baik yang terkait dengan teknik maupun teoritis 4. C. peserta diklat dapat bertanya langsung kepada narasumber yang menyampaikan materi buku ajar ini 5. peserta dapat mengulangi lagi dalam mempelajarinya agar setiap kompetensi yang diharapkan dalam setiap babnya dapat peserta penuhi. Prasyarat Buku ajar ini ditujukan untuk peserta didik yang telah mempuyai kompetensi tentang teknik digital. Bila ada materi-materi yang kurang dipahami. Untuk menguji kemampuan terhadap penguasaan buku ajar ini. Petunjuk Belajar 1. Tugas dan latihan yang terdapat pada setiap bab harap dikerjakan tanpa melihat kunci jawaban terlebih dahulu 6. Kompetensi dan Indikator 1. D. karena itu untuk memahami benar setiap peserta perlu saling tanya jawab atau diskusi baik dengan sesama peserta maupun dengan pelatih/nara sumber 3. Keseluruhan materi yang ada dalam buku ajar ini hendaknya dibaca secara seksama 2. Bab Pendahuluan merupakan informasi yang menguraikan bagian penting dalam memahami buku ajar ini. peserta agar mengerjakan test formatif secara individual 7. Dan lebih diutamakan peserta didik yang mempunyai basik komputer.

menjelaskan komponen-komponen Sistem Mikroprosesor d. Peserta didik dapat Z-80. menggmbarkan peta memory. BUS (Saluran). hubungan mikroprosesor dan memori eksternal c. mikroprosesor ideal. Peserta didik dapat menjelaskan istilah-istilah yang berhubungan dengan mikroprosesor b. Peserta didik dapat menjelaskan arah pembelajaran Sistem Mikroprosesor. komponen mikroprosesor. . Z-80. Peserta didik dapat menjelaskan dan menggambar tetang model mikroprosesor. Indikator a. cara cara Mikroprosesor melakukan melakukan Mikroprosesor Mikroprosesor dan logika memprograman operasi aritmatik menggunakan Mikroprosesor Z-80.Mikroprosesor 5-3 2. menjelaskan Register tentang spesifikasi Z-80.

: Dapat menjelaskan Perkembangan Komponen Mikroelektonika Dapat menjelaskan Komponen Programabel Dapat menjelaskan Mikroprosesor Dapat menjelaskan Sistem Mikroprosesor Dapat menjelaskan Komputer Dapat menjelaskan Mikrokontroller B. 5. Komputer. dan Mikrokontroller 1.000 100. Uraian Materi Beberapa istilah yang berhubungan dengan sistem Mikroprosesor.000 – 10 juta > 10 juta . 3. 2. ditandai dengan Perkembangan meningkatnya mikroelektronika kepadatan komponen yang ada dalam suatu chip komponen Integrated Circuits (IC).BAB II KEGIATAN BELAJAR 1 A. Komponen Programabel. perkembangan komponen IC dapat dibedakan : No Jenis Rangkaian Terintegrasi (IC) 1 SSI (Small Scale Integration) 2 MSI (Medium Scale Integration) 3 LSG (Large Sclae Intergration) 4 VLSI (Very Large Scale Integration) 5 ULSI (Ultra Large Scale Integration) Kepadatan Komponen Jlm Transistor/Chip 10 – 100 100 – 1000 1000 – 100. 6. Dilihat dari tingkat kepadatan komponen. Kompetensi dan Indikator Kompetensi : Setelah mengikuti pembelajaran peserta latih dapat mendeskripsikan beberapa istilah yang berhubungan dengan sistem mikroprosesor Indikator 1. Perkembangan Komponen Mikroelektronika Sejalan dengan perkembangan teknologi lektronika. komponen mikroelektronika komponen juga terus bekermbang. Mikroprosesor. Sitem Mikroprosesor. 4. adalah : Perkembangan Komponen Mikroelektonika. yang perlu dipahami maksudnya.

Clock. Dengan program pada PAL dapat : read/write dan menyimpan intern maupun ekstern (dari ke disket. dll). c. Memiliki Register.Mikroprosesor 5-5 2. IC) dan aktif (Transistor. Sifat program memutus fuse. L. Jenis-jenis bentuk fisik rangkaian komponen programabel diantaranya : a. PLD Sifat pemrograman : X artinya terhubung (belum terprogram). Hardisk. Komponen Programabel. Dapat diprogram dengan bantuan komputer. yaitu : non programabel dan programabel. PAL Sifat pemrograman : dapat diprogram secara manual atau menggunakan bantuan komputer : program PALASM + EPROM (Erasable Programabel Read Only Memory) Programmer. FPGA mempunyai PLD (Program Logic Device) PAL (Pragrammble Array Logic) GAL (Generic Array Logic) FPGA (Field Programabel Gae Array) . Komponen non programabel. dan Alamat. d. Pemrograman dilakukan dengan cara memutus “fuse” yang ada pada tanda X. b. adalah komponen yang fungsinya tergantung pada program yang diberikan. CD. Komponen Programabel Pembagian komponen elektronika berdasarkan sifatnya dapat dibedakan menjadi dua. Merupakan komponen programabel yang sudah komplek bentuk fisik rangkaian dan cara pemrogrammannya. FPGA. adalah komponen elektronika yang fungsinya tetap : pasif (R. Dioda. untuk menghapus program dapat digunakan universal programmer. C. GAL Sifat pemrograman : termasuk EEPLD (Electrically Erasable PLD). IC). Tidak dapat diprogram ulang.

4. merupakan suatu komponen digital mulai dari jenis LSI sampai ULSI (menunjukkan perkembangannya) dengan kompleksitas rangkaian sangat tinggi yang mampu melaksanakan fungsi suatu unit pemroses sentral (CPU = Central Processing Unit). mikrokontroler. Seperti mememori dan mengolah data yang masuk sesuai dengan program yang diberikan. LCA dan dapat digabungkan sebagai dengan alat komponen untuk bertindak bantu meningkatkan kinerja mikrokontroler. Dalam amplikasinya. Pada umumnya sistem mikroprosesor terdiri atas : unit mikroprosesor (MPU = mikroprocessing unit). memory baca (ROM = read only memory). Sistem Mikroprosesor Sistem mikroprosesor adalah suatu sistem yang mempergunakan mikroprosesor sebagai komponen utama. MPU Bus I/O I/O CPU Bus I/O I/O Bus A/D Bus A/D RAM ROM RAM ROM Sistem Mikroprosesor Komputer Gambar 1 Sistem Mikroprosesor dan Komputer . 3. dan unit Input Output (I/O unit). Mikroprosesor Mikroprosesor.5-6 Mikroprosesor beberapa keluarga diantara adalah LCA (Logic Cell Array). memori baca tulis (RWM = read write memory = RAM = random access memoery.

dan pengolah data. Komponen programable yang dapat diprogram satu kali saja adalah a. Mikroprosesor b. Bisa salah atau benar c. SI. Memory. Di dalam mikrokontroller terdapat komponen input output (I/O). IC c. Benar b. Bisa salah atau benar c. Istilah mikroprosesor dengan sistem mikroprosesor maksudnya sama a. Benar b. FPGA d. Komputer dan Mikroprosesor contoh jenis komponen programabel a. PAL b. Mikrokontroler d. Komputer d. 6. Perbandingan sistem mikroprosesor dan komputer dapat dilihat pada Gambar di bawah. MPU pada komputer dinamakan CPU (Central Processing Unit). C.Mikroprosesor 5-7 5. Mikrokontroller Mikrokontroller adadalah komponen programabel IC yang fungsinya mendekati dengan sistem mikroprosesor. Komponen yang fungsinya mendekati dengan sistem mikroprosesor adalah a. IC c. Komputer Mirip dengan sistem mikroprosesor. I. PLD 3. LSG. Pilihlah Satu Jawaban Yang Paling Tepat 1. ULSI adalah nama-nama jenis a. yang dikemas dalam satu chip IC. kalau masih ragu-ragu pelajari kembali materi buku ajar ini. GAL c. Mikrokontroler 2. Tergantung sistemnya 5. Salah d. hanya lebih kompleks. Tergantung sistemnya 4. Salah d. yakinkan bahwa jawaban anda benar. CPU . Komputer b. Latihan Kerjakan soal-soal di bawah. Contoh mikrokontroller yang kita miliki adalah ADMEL.

LSG. Jelaskan perbedaan sistem mikroprosesor dan komputer D. Rangkuman Beberapa istilah yang berhubungan dengan sistem mikroprosesor adalah : Perkembangan Mikroprosesor. dan ULSI. dapat diisi dan dihapus berluang kali menggunakan bantuan ultra violet. Apakah yang dimaksud dengan komponen programabel 2. merupakan sistem yang mempunyai komponen utama : CPU. Sistem mikroprosesor. dan mikrokontrolel. Jawablah dengan singkat dan benar 1.5-8 Mikroprosesor II. dan I/O. Lembar Kegiatan Peserta latih . Komputer. MSI.Peserta latih menjawab soal-soal test formatif E.Peserta latih mengerjakan latihan . Jenis-jenis bentuk fisik komponen programable membedakan sifat pemrograman. dapat diisi dan dihapus berluang kali menggunakan bantuan komputer.Peserta latih mendengarkan asesor penjelaskan materi pelajaran . Mikroprosesor. dimuali dari : SSI. Mikroprosesor adalah komponen digital yang mampu melaksanakan fungsi mememori dan mengolah data. Komponen Sitem Mikroelektonika. yaitu : hanya dapat diprogram sekali.Peserta latih mempelajari materi buku ajar . dan Perkembangan komponen mikroelektronika ditandahi dengan bertambah padatnya komponen dalam satu IC. . Mikrokontroller. VLSI. Memori. komputer. Komponen Programabel.

CPU 6. Komponen Programable c. Bisa salah atau benar c.Mikroprosesor 5-9 F. Kepadatan komponen dalam chip c. Resistor d. PLD 3. Sistem programamble d. Pilihlah Satu Jawaban Yang Paling Tepat 1. RAM b. Mikroprosesor termasuk dalam golongan a. IC c. IC d. Benar b. Dioda b. Kondensator 7. FPGA d. Mikrokontroler d. Tergantung sistemnya 5. MPU pada sistem mikroprosesor fungsinya sama dengan …. ULSI adalah nama-nama jenis a. CPU d. Komputer dan Sistem Mikroprosesor merupakan jenis komponen programabel a. Komponen programable yang dapat diprogram denagan bantuan komputer adalah a. Komponen yang fungsinya mendekati dengan sistem mikroprosesor adalah a. SSI. Mikroprosesor b.. IC jenis ULSI mengandung >10 juta ……. Bentuk volume dalam chip b. Fungsi dalam chip d. Salah d. I/O mkroelektronika ditandai dengan . ROM 8. Komputer c. Transistor c.. Daya dalam chip komponen c. Komputer c. Test Formatif I. LSG. Mikrokontroler 2./Chip a. PAL b. Peralatan programable b. Perkembangan meningkatnya a. GAL c. pada komputer a. Semua jawabab benar 4.

Dua c. Berdasarkan sifatnya komponen elektronika dapat dibedakan menjadi a. Enam d.5-10 Mikroprosesor 9. Empat 10 Transistor termasuk golongan komponen elektronika jenis a. Lima b. Non Programabel c. Aktif d. Mengapa mokroprosesor dimasukkan dalam golongan jenis komponen programmabel ? . Pasif II. Gambarkan perbedaan sistem mikroprosesor dan komputer 3. Apakah yang dimaksud dengan sistem miroprosesor 2. Programabel b. Jawablah dengan singkat dan benar 1.

dengan : sejumlah saluran data (data bus).BAB III KEGIATAN BELAJAR 2 MIKROPROSESOR A. Kompetensi dan Indikator Komptensi : Setelah selesai mengikuti pelajaran. saluran alamat (address bus). Dapat menjelaskan dan menggambar mikroprosesor ideal 3. catu daya. Dapat menjelaskan komponen mikroprosesor 4. address bus Mikroprosesor data bus kontro bua Power Supply Gambar 2 Model Mikroprosesor . dan sejumlah saluran kontrol (control bus). Model Mikroproseor Mikroprosesor merupakan suatu kotak (black box). peserta latih mampu mendekripsikan tentang mikroprosesor Indikator : 1. Dapat menggambarkan hubungan mikroprosesor dengan memori internal B. Dapat menjelaskan dan menggambar model mikroprosesor 2. Uraian Materi 1.

Umumya m saluran data masuk sama dengan k saluran data keluar jumlahnya sama. “Data Word” 4 bit disebut “nybble”. Komponen Mikroprosesor Berbeda dengan keadaan ideal. Jumlah saluran data tersebut dinamakan “lebar jalur data” (data path width = word size). dikatakan mikroprosesor 8 bit. bilamana m = k = 4 dikatakan mikroprosesor 4 bit. komponen utama mikroprosesor. Data diterima dari saluran masuk kemudian diproses (diolah) sesuai dengan program yang tersimpan (stored program) sehingga diperoleh sejumlah data keluaran sebagai hasil pengolahan data tersebut. seperti saluran data masuk dan saluran data keluar jumlahnya terbatas. Bila jumlah m = k = 8. .5-12 Mikroprosesor 2. Pada Gambar 4 diperlihatkan suatu mikroprosesor dengan 8 buah saluran data masuk dan 8 buah saluran data keluar. fungsi mikroprosesor dapat ditulis sebagai : Keluaran = Masukkan * Program Mikroprosesor ideal mempunyai m data saluran masuk (input) dan k saluran data keluaran (ouput) yang jumlahnya tidak terbatas. Secara metematis. “Data Word “ 8 bit disebut “byte”. artinya fungsi komponen programabel tergantung dari “ propram” yang diberikan. 1 2 Saluran masuk Program 1 2 Saluran keluar k m Gambar 3 Blok Diagram Mikroprosesor Ideal 3. Mikroprosesor Ideal Mikroprosesor adalah komponen programabel yaitu suatu komponen yang fungsinya dapat diprogram.

Hubungan Mikroprosesor dan Memori Eksternal Suatu memori ideal dianggap mempunyai “memori dalam” (“Internal Memory”) dengan jumlah tidak terbatas. Hubungan mikroprosesor melalui bus data dan bus alamat seperti Gambar 5. Dengan demikian mikroprosesor harus mampu untuk mencapai (to access) suatu memori luar (external memory). Saluran Alamat 1 2 3 Mikroprosesor p Memori n Saluran data/Alamat Gambar 5 Hubungan Mikroprosesor dan Memori Luar Dengan Bus Data dan Bus Alamat . dalam keadaan yang sebenarnya mikroprosesor mempunyai jumlah “memori dalam” yang sangat terbatas untuk keperluan menyimpan data dan program.Mikroprosesor 5-13 0 1 Program 1 2 8 k 0 1 Program 1 2 8 k 7 7 Gambar 4 Blok Diagram Mikroprosesor Dengan 8 Saluran Data Masuk dan 8 Saluran Data Keluar 4. Umumnya mikroprosesor harus dapat melakukan penyimpanan informasi (melakukan proses penulisan memori) dan mengambil informasi (melakukan proses pembacaan memori) dari memori luar.

5-14 Mikroprosesor 5. CMOS-SOS (CMOS Silicon-On-Sapphire). 6802. Pembagian Teknologi dan Contoh Mikroprosesor Jenis Teknologi Teknologi MOS NMOS Contoh Mikroprosesor Intel 4004.ECL . Perbedaan jumlah bit saluran data menyebabkan perbedaan kecepatan akses data suatu sistem mikroprosesor. 14500 Intersil 80C41. Bipolar I2L (Integrated Injection Logic). Mikroprosesor sekarang menggunakan teknologi apa ?. namun demikian pada tahun 1986 telah diganti dengan teknologi NMOS. Z 8000 Nasional seminductor NS 32032 Motorola 146805. SBP 990 CMOS Teknologi Bipolar Bipolar Tak Jenuh . 6. Teknologi PMOS teknologi yang paling murah dan yang dipergunakan untuk mikroprosesor pertama intel 4004 (th. Dimulai dengan 4 bit. NMOS( MOS kanal N). 8048. sampai saat ini sudah 64 bit. Perkembangan Mikroprosesor Perkembangan mikroprosesor ditandai dengan meningkatnya jumlah bit saluran data. 2903 (‘Saturated’) Texas Instrumens ABP 0400. CMOS (Complentay MOS). 8080. 8008. 6805 Zilog Z-80. Teknologi Mikroprosesor Jenis-jenis teknologi mirkoprosesor : PMOS (Metal Oxide Semoconductor kanal P). 87C48 (‘unsaturated’) Motorola 10800 Intel 3001 Advance Micro Devices Am 2901. Bipolar Schottky. Bipoler ECL (Emiter Couple Logic). 1971). 8085. 6809. Dengan clock yang sama mikroprosesor 64 bit mempunyai kecepatan akses 16 kali lipat mikroprosesor 4 bit.Schottky Bipolar Jenuh . 6801.IIL . 4040. 8749 motorola 6800.

Mikroprosesor dengan memori eksternal biasa dihubungkan dengan a. Semua jawaban benar . Black box b. Semua jawaban benar 3. Saluran Alamat c. Perekembangan mikroprosesor ditandai dengan meningkatnya jumlah bit a. Mikrokomputer c. Latihan I. Bus b. Saluran Data d. IC d. Pilih Satu Jawaban Yang Paling Tepat 1. Dekoder c. PMOS b. Mikroprosesor pertama menggunakan teknologi a. Saluran kontrol 4.Mikroprosesor 5-15 Gambar 6 Bentuk Fisik dan Pinout Z-80 C. Mikroprosesor biasa dibaratkan dengan a. Mikrokontroller 2. Interface d. NMOS d. Saluran b. CMOS c.

Mengapa saluran data menunju dua arah ? 2. lengkapi yang lain saluran apa namanya D. Zilog-8000 c. Intel 404 II Jawablah dengan singkat dan benar 1. Gambarkan chip mikroprosesor yang mempunyai saluran alamat 8 bit. Motorola 10800 b. Hubungan mikroprosesor dan memori eksternal dilakukan oleh saluran. Jenis-jenis teknologi mikroprosesor : PMOS. Lembar Kegiatan Peserta Latih Peserta latih mendengarkan asesor penjelaskan materi pelajaran Peserta latih mempelajari materi buku ajar Peserta latih mengerjakan latihan Peserta latih menjawab soal-soal test formatif E. Perkembangan mikroprosesor ditandai dengan meningkatnya jumlah saluran bit data. Pilih Satu Jawaban Yang Paling Tepat 1. Balck box d.5-16 Mikroprosesor 5. tetapi dalam realitas saluran masuk dan saluran keluar jumlahnya terbatas. Rangkuman Mikroprosesor merupakan suatu kotak dengan sejumlah saluran alamat. salauran kontrol. Zilog-80 d. salauran data 8. Test Formatif I. Mikrokontroller . CMOS-SOS dll. F. Mikroprosesor ideal mempunyai saluran masuk dan keluar tak terhingga. Mikroprosesor biasa dibaratkan dengan sebuah a. Salah satu contoh mikroprosesor yang menggunakan teknologi CMOS adalah : a. IC b. Mikrokomputer c. saluran data.

Mikroprosesor pertama kali dibuat pada tahun a. CMOS c. Komponen utama yang ada pada model mikroprosesor adalah a. Mikroprosesor tidak ideal mempunyai keterbatasan dalam hal a. Saluran c. Saluran kontrol 6. Dekoder b. Zilog-80 d. Interface d. Teknologi Mikroprosesor yang paling murah adalah a. Bit b. 1955 . CMOS c.Mikroprosesor 5-17 2. Semua jawaban benar 4. Intersil 80C41 10. Byte c. PMOS d. Jumlah data b. Semua jawaban benar 5. Kontrol d. PMOS d. Zilog-8000 c. Saluran Alamat c. Jumlah saluran masuk c. Nybble d. Satuan saluran adalah a. Perekembangan mikroprosesor ditandai dengan meningkatnya jumlah bit a. Saluran b. Address b. 1976 d. Semua jawaban benar 8. Saluran Data d. NMOS b. Semua jawaban benar 9. Motorola 10800 b. Salah satu contoh mikroprosesor yang menggunakan teknologi CMOS adalah : a. 1971 c. Mikroprosesor pertama menggunakan teknologi a. 1986 b. Semua jawaban benar 3. Mikroprosesor dengan memori eksternal biasa dihubungkan dengan a. Jumlah program d. Semau jawaban benar 7. Bus c. NMOS b.

Mengapa saluran data menunju dua arah sedangkan saluran alamat menunju satu arah ? 2. Tuliskan teknologi mikroposesor yang anda ketahui (lengkap dengan singkatannya) . Gambarkan chip mikroprosesor yang mempunyai saluran alamat 4 bit.5-18 Mikroprosesor II Jawablah dengan singkat dan benar 1. lengkapi yang lain saluran apa namanya 3. saluran data 4.

Kompetensi dan Indikator Kompetensi Setelah selesai mengikuti pelajaran. a. Perangkat Keras Bus : Bus Data. peserta latih mampu mendekripsikan tentang Sistem Mikroprosesor Indikator : 1. Perangkat Lunak Pemrograman Mikroprosesor Perencanaan Program (menyangkut peta memori dan memori internal/register) .BAB IV KEGIATAN BELAJAR 3 A. arah pembelajaran dapat dibedakan menjadi dua hal. dan Bus Kontrol Peta Memori Komponen-komponen Penunjang Sistem Mikroprosesor b. Dapat menjelaskan dan menggmbarkan peta memory 4. Dapat menjelaskan arah pembelajaran Sistem Mikroprosesor 2. yaitu : perangkat keras (hardware) dan perangkat lunak (software). Dapat menjelaskan dan menggambar Dekoder B. Dapat menjelaskan komponen-komponen Sistem Mikroprosesor 5. Bus Alamat. Dapat menjelaskan BUS (Saluran) 3. Uraian Materi 1. Arah Pembelajaran Sistem Mikroprosesor Dalam pembelajaran sistem mikroprosesor.

Misal mikroprosesor 8 bit. secara hardware terdiri dari 8 buah bus (D7MSB… D0LSB). Octal 11. bus alamat. yaitu dengan kode biner. Bus Data (Saluran Data) Bus data adalah saluran yang digunakan untuk menyalurkan data dari CPU ke Memori dan sebaliknya.5-20 Mikroprosesor 2. Beberapa bus yang ada dalam sistem mikroprosesor adalah : bus data. Biner 11110111B b. atau hexadesimal (yang banyak dipergunakan) Contoh cara menyatakan suatu word data 8 bit dalam berbagai cara : a. dan bus kontrol. a.0111 sama dengan FBH atau FB16 digunakan sebagai klasifikasi sama dengan 367Q atau 3678 111101112 % 1111011 Lebar bus data biasanya mikroprosesor.111 c. Besar data yang dapat disalurkan sekaligus mulai (00000000 s/d 11111111)(B) atau (000 s/d 377)(Q) atau (00 s/d FF)(H). BUS (SALURAN) Komponen utama yang perlu dipelajari dalam sistem mikroprosesor adalah “BUS” / “SALURAN”. Mikroposesor 8 bit atau 1 byte. 16 atau 32. . 16 bit. mikroprosesor riil mempunyai keterbatasan “BUS’. artinya dia memiliki lebar bus data 8. Word Data pada bus data dapat dinyatakan dengan beberapa cara. Bus data menunjukkan kemampuan Mikroprosesor untuk menyalurkan sejumlah data sekaligus. Tidak seperti mikroprosesor ideal. actal. Hexsadesimal 1111.110. atau 32 bit.

Dengan Bus Adress CPU dapat mengambil (membaca/read) dan menyimpan (menulis/write) dari/ke memori. 0 LSB A0 A1 A2 A3 A4 A5 A6 A7 0 0 1 1 0 1 1 MSB Mikropro sesor Gambar 7 Bus Alamat 8 Bit (Contoh Data Alamat : 1B) . tetapi kondisi riil yang ada untuk menyimpan data dan program jumlahnya perlu dibatasi. Akibatnya mikroprosesor harus mampu mencapai memori luar (external memory) untuk menyimpan data (read) dan mengambil kembali (write). Mikroprosesor ideal akan memiliki memory internal tak terbatas.Mikroprosesor 5-21 0 LSB D0 D1 D2 D3 D4 D5 D6 D7 0 0 1 1 0 1 1 MSB Mikropro sesor Gambar 6 Bus Data 8 Bit (Word Data Tersalurkan : 0001101) b. Komunikasi antara mikroprosesor dengan external memory dilakukan melalui “bus alamat”. Bus Adress (Saluran Alamat) Bus Address adalah saluran yang digunakan CPU untuk menjangkau tempat penyimpanan data di memori.

Lebar Bus Data Alamat Lokasi Memori 1 Lebar/Space Peta Memory ………… Lokasi Memori n B8 ………… Lokasi Memori n Lokasi Memori 2 Alamat 00 Lokasi Memori 1 Lokasi Memori 2 AC FF Gambar 9 Peta Memori (Contoh Peta Memori : 00 – FF) . Blok diagram Mikroprosesor Z-80 seperti Gambar 8. Setiap data informasi disimpan dalam memori pada suatu kumpulan lokasi memori. Susunan lokasi memori dinamakan peta memory (space memory). Gambar 8 Blok Diagram Z-80 3.5-22 Mikroprosesor c. Peta Memori. Ukuran data pada setiap alamat memori ditentukan oleh lebar bus data. Bus Kontrol Bus Kontrol adalah saluran yang digunakan CPU untuk menjalankan program. Dengan Bus Kontrol CPU dapat mulai melakukan pekerjaan mengambil (membaca/read) dan menyimpan (menulis/write) dari/ke memori.

. Gambar 9 menunjukkan posisi/arti : lebar bus data. lebar peta memori 200 (tanpa satuan biasanya ditunjukkan dengan alamat awal dan akhir : 00 FF). untuk merencanakan tempat menyimpanan data informasi pada saat melakukan perencanaan program. latch. diperlukan beberapa komponen penunjang yang lain. maka jumlah memori yang tersimpan dalam peta memori : 8 * 200 = 1600 bit atau 1. rangkaian clock. Kumpulan alamat ruang memori disebut “lebar peta memori”. 4. Rangkaian interface dapat berupa : rangkaian decoder (disusun dari rangkaian logika menggunakan gerbang-gerbang logika digital). seperti : power supply. sehingga jumlah data yang tersimpan dalam peta memori tergantung dari : lebar bus data * lebar peta memori (akan dibahas lebih lanjut pada pembahasan dekoder dan register). Gerbang-Gerbang Logika Gerbang-gerbang logika digital yang biasa digunakan untuk membentuk rangkaian interface adalah komponen-komponen digital dasar. Dalam buku ajar ini rangkaian interface akan dibahas lebih lanjut. dan NOT. Komponen-Komponen Penunjang Sistem Mikroprosesor Dalam sistem mikroprosesor selain komponen utama μp. EXNOR. dan lebar peta memori dalam peta memori. a. B8. AC. EXOR. FF). b. Sebagai contoh : lebar bus data : 8 bil . atau konverter Digital to Analog (D/A) atau Analog to Digital (A/D). Rangkaian Interface Rangkaian interface atau rangkaian antar muka fungsi utamanya adalah menghubungkan sistem μp dengan dunia luar. seperti : AND.6 K bit = 200 byte = 400 nybble. OR. NOR. buffer.Mikroprosesor 5-23 Pemahaman tentang peta memori sangat diperlukan. alamat. Setiap ruang memori mempunyai satu alamat sendiri-sendiri yang unik. memori eksternal. dan rangkaian interface. NAND. yaitu tidak ada yang kembar/sama (00.

Io. Fan-in menunjukkan besar tegangan yang diperlukan sebagai masukan gebang logika Vout. Fan-out. menunjukkan besar arus keluaran dari gerbang logika digital. Arus-in. maka karateristik yang perlu diperhatikan. sebagai berikut : Vin : Vin(1) Vin(0) = besar tegangan minimal yang diperlukan untuk masukkan suatu gebang logika = besar tegangan maksimal yang diperkenan untuk masukkan suatu gebang logika Vout : Vout(1) = besar tegangan minimal yang dikeluarkan dari gerbang logika Vout(0) = besar tegangan maksimal yang dikeluarkan dari gerbang logika Iin : Iin(1) Iin(0) Iout : Iout(1) = besar arus minimal yang diperlukan untuk masukkan suatu gebang logika = besar arus maksimal yang diperkenan untuk masukkan suatu gebang logika = besar arus minimal yang dikeluarkan dari gerbang logika . Ii. Bilamana gerbang-gerbang logika digunakan sebagai komponen pembentuk rangkaian interface. Vin. Arus-out. logika 1 dan logika 0. dengan demikian karakteristik gerbang logika di atas juga dibedakan untuk logika 1 dan logika 0. Fan-out menunjukkan besar tegangan yang dikeluarkan gerbang logika digital Iout.5-24 Mikroprosesor Rangkaian interface yang banyak ditemui pada sistem mikroprosesor sebagian besar berfungsi sebagai rangkaian Dekoder untuk dekoding sinyal kontrol dan dekoding alamat. menunjukkan besar arus masukkan yang diperlukan oleh gerbang logika digital Sinyal digital mempunyai dua kondisi. adalah : Fan-in. Iin.

4. Contoh penerapan karakteristik logika : Gerbang AND (Vin(1) = 2 .5.1 . berdasarkan karateristik Vout.5. Buffer Buffer adalah suatu aplifier yang dapat digunakan untuk meningkatkan kapabilitas arus drive dari line sinyal. d. maka jumlah gerbang OR yang dapat dihubungkan dengan AND maksimal 3 buah (disarkan dengan. Z-80 memiliki arus output 1.07) Rangaian Interface Gambar 10 Contoh Rangkaian Interface Dengan rangkaian Gambar 10. Penggunaan penting .05) Gerbang OR (Vin = 3 . Vout(0) = 0. Iin(1) = 1. Vout(0) = 0.8 mA dapat men”drive” 4 gebang TTL yang memiliki IiH= 400 µA. Untuk kepentingan ini diperlukan rangkaian “Latch”.Mikroprosesor 5-25 Iout(0) = besar arus maksimal yang dikeluarkan dari gerbang logika Karateristik logika sangat diperlukan untuk menentukan julah logika yang dapat dihubungkan dengan logika lain dalam rangka membentuk rangkaian interface atau dekoder. Vout(1) = 6. Iin = 0. tanpa buffer. Iin(0) = 0. Vout = 8. Iout = 5 Vin(0) = 0. Iout AND dan Vin.2 . Latch Dalam sistem mikroprosesor sering kali data informasi yang ada pada bus mikroprosesor harus dipertahankan agar dapat dipakai oleh sistem berikutnya. c. Iout(0) = 0. Iin(0) = 0.6 Iout(0) = 0. Iin OR. Iout(1) = 10 Vin(0) = 0.3.

dan 5E. data disimpan pada alamat D3. Dalam penjelasan Dekoder ini akan diambil contoh Sistem mikroproseor yang disusun dari komponen mikroprosesor 8 biat . Data disimpan pada alamat : D3.gerbang logika yang dirangkai berdasarkan konsep penyusunan rangkaian logika. dan 5E. Minimisasi. Dekoder dibentuk dari gerbang . Menentukan persamaan logika dari hasil minimisasi. Bus alamat 8 bit. Perencanaan Peta Memori Lebar bus alamat 8 bit sehingga space alamat memori yang dapat dicapai dari FF(h) s/d 00(h). Rencanakan tabel kebenaran. Dengan rangkaian dekoder. maka peta memorinya adalah : Peta Memori Alamat FF D3 B6 9E 5E 00 Data 1 Data 2 Data 3 Data 4 .5-26 Mikroprosesor dari buffer adalah pada port input mikroprosesor. 9E. Gambar rangkaian dekoder. B6. 5. B6. 9E. bisa diatur/digubungi diperlukan. a. Dekoder Dekoder dalam sistem miroprosesor digunakan pada bus alamat untuk mengatur alamat memori yang akan dihubungi. Prosedur alamat-alamat pada memori yang perencanaan dekoder dengan urutan : Rencanakan peta memori. yaitu mengisolasi data input dari saluran data mikroprosesor.

Mikroprosesor 5-27 b. Minimisasi Tabel A A5A4 00 01 11 10 A7A6 00 0 1 3 2 01 1 4 5 7 6 11 1 C D F E 10 1 1 8 9 B A Tabel B A1A0 00 01 11 10 A3A2 00 1 0 1 3 2 01 1 4 5 7 6 11 1 C D F E 10 1 8 9 B A Dari Tabel A diatas didapatkan persamaan : F1 = A6 A5 A4 + A7 A5 A4 + A7 A6 A4 F2 = A3 A2 A1 A0+ A3 A2 A1A0 + A3A1 A0 . Tabel Kebenaran Alamat D3 B6 9E 59 A7 1 1 1 0 A6 1 0 0 1 A5 1 1 0 0 Saluran A4 A3 0 0 1 0 1 1 1 1 A2 0 1 1 1 A1 1 1 1 1 A0 1 0 0 0 c.

Rangkaian Dekoder F2 F1 Gambar 11 Rangkaian Dekoder F A7 A6 A5 A4 A3 A2 A1 A0 AND 1A AND 2A AND 3A OR F1 F(out) AND AND 1B AND 2B AND 3B OR F2 .5-28 Mikroprosesor d.

Untuk menyalurkan data b. Kode Desimal c. Lima 2. Kode Biner b. Untuk mengambil data d.Peserta latih mendengarkan asesor penjelaskan materi pelajaran . Dua Beberapa saluran yang ada dalam mikroprosesor adalah a. Apa fungsi buffer pada rangkaian sistem mikroprosesor D. Rangkaian Dekoder b. Rangkaian yang dapat digunakan untuk menghubungan keluaran mikroprosesor dengan bunia luar dinamakan a. Lembar Kegiatan Peserta latih . Kode Octal d.Peserta latih menjawab soal-soal test formatif . Tiga b.Peserta latih mengerjakan latihan .Peserta latih mempelajari materi buku ajar . Vout. dan Iin 2. Rangakain penghubung II Jawablah dengan singkat dan benar 1. Rangkaian Interface d. Semua jawabab benar 3. Ada jawaban yang salah 4.Mikroprosesor 5-29 C. Rangkaian Dioda c. Empat d. Word data pada saluran data dapat dinyatakan dengan cara a. Saluran alamat d. Saluran kontrol c. Iout. Latihan I. c. Untuk menunjuk tempat data c. Arah pembelajaran sistem mikroprosesor secara garis besar dapat dibedakan menjadi a. Saluran data b. Pilih satu jawaban yang paling tepat 1. Untuk menulis data 5. Fungsi saluran alamat adalah a. Jelaskan apa arti karakteristik gebang logika Vin.

NAND. Octal dan Hexadesimal. Ada tiga jenis aluran (Bus) pada sistem mikroprosesor. Empat d. Pemahaman tentang peta memori sangat diperlukan. Word data pada saluran dapat dinyatakan dengan cara : Biner. Dua c. Dekoder dalam sistem mikroprosesor digunakan oleh saluran alamat sebagai rangkaian untuk mengatur alamat memori yang akan dihubungi. NOR. Lima c. Rangkuman Dalam mempelajari sistem meikroprosesor. BA16 2. Pilih Satu Jawab Yang Paling Benar 1. Komponen-komponen penunjang sistem mikroprosesor adalah Gate-Gate dasar Digital. Tiga b. AB16 dibedakan menjadi a. arah pembelajaran dibedakan menjadi dua : perangkat keras (aluran. peta memori. Arah pembelajaran sistem mikroprosesor secara garis besar dapat . saluran data. OR. Dengan Dekoder bisa diatur alamat mana yang dapat dihubungi dan yang tidak boleh dihubungi. dll. Hal yang perlu dipahami pada saat memakai adalah arakteristik IC. Susunan lokasi memori pada memori dinamakan Peta memori.5-30 Mikroprosesor E. dan saluran kontrol. CA16 b. saluran alamat. F. untuk merencanakan tempat penyimpanan data informasi pada saat melakukan perencanaan program. AND. dan komponenen penunjang sistem mikroprosesor) dan perangkat lunak (pemograman dan perencaan program). AC16 d. Word data 10101011B bilamana dinyatakan dalam dengan hexadecimal jawabnya adalah a. Tes Formatif I.

9 b. Untuk menyalurkan data b. Rangkaian Interface d. Rangkaian Dekoder b. Kode Biner b. 6 9. Untuk mengambil data d. Word data pada saluran data dapat dinyatakan dengan cara a.Mikroprosesor 5-31 3. Rangkaian yang dapat digunakan untuk menghubungan keluaran mikroprosesor dengan bunia luar dinamakan a. Semua jawabab benar 4. Untuk menulis data c. Saluran kontrol c. Untuk menunjuk tempat data c. 7 d. Kode Desimal 5. Saluran kontrol 8. Saluran alamat c. Lacth b. Rangakain penghubung 7. Kode Octal d. Saluran data b. Buffer c. Saluran data d. AND d. Saluran program b. Saluran alamat d. OR . Bilamana data disimpan dalam memori mulai alamat A5 – AE. 8 c. Menaikan arus b. maka perlu dipasang komponen a. Mempertahankan arus d. Rangkaian Dioda c. maka lebar peta memori a. Mempertahankan data informasi 10 Bilamana gerbang digital punya Vout = 4 akan digabung dengan gebang digital yang punya Vin = 5. Ada jawaban yang salah 6. Menaikan tegangan c. Beberapa saluran yang ada dalam mikroprosesor adalah a. Fungsi komponen Latch dalam sistem mikroprosesor adalah untuk a. Fungsi saluran alamat adalah a. Saluran yang biasa digunakan sebagai petunjuk karakteristik mikroprosesor adalah a.

Gambarkan rangkaian Dekodernya 3. Hasil minimisasi dalam pernencanaan rangkaian Dekoder dapat dituliskan dalam bentuk persamaan : F = A B C + BC D + AC. Hitung jumlah OR yang dapat digabung. 2.6 Volt akan digunakan sebagai input gerbang OR punya Vin(1) = 5 Volt.5 Volt. Vout(0) = 1. Gebang AND punya Vout(1) = 20 Volt. Mengapa dalam rangkaian sistem mikroprosesor banyak yang dipasang komponen Latch ? . Vin(0) = 0.5-32 Mikroprosesor II Jawablah dengan singkat dan benar 1.

Nama dan fungsi masing-masing register Z-80 adalah sebagai berikut : - Register A (Akumulator/Pengumpul).. peserta latih mampu mendekripsikan tentang Mikroprosesor Z-80 Indikator : 1. selalu digunakan untuk opresasional ALU. dan PC) dengan susunan seperti Gambar 11. Dapat menjelaskan spesifikasi Mikroprosesor Z-80 2. Dapat menjelaskan komponen pemrograman Mikroprosesor Z-80 5. Atau selalu digunakan untuk mengoperasikan perintah aritmetik dan logika. Dapat menjelaskan operasi aritmatik dan logikaa Mikroprosesor Z-80 B. F. L) dan 4 buah register 16 bit (IX. Gambar Flag seperti di bawah : . Register F hanya menyatakan hasil operasi ALU. IY. 2. E. Dapat menjelaskan Register Mikroprosesor Z-80 3. Dapat menjelaskan memprograman Mikroprosesor Z-80 4. - Register F (FLAG) adalah register kumpulan register 1 bit.526 alamat memori. C. A15). sehingga lebar peta memori yang dapat dihubungi sebanyak 65. SP. Uraian Materi 1. Register Z-80 mempunyai 8 buah register 8 bit (A. D. H. dan Saluran Alamat 16 jalur (A0 . Kompetensi dan Indikator Kompetensi Setelah : selesai mengikuti pelajaran. D7).BAB V KEGIATAN BELAJAR 4 A.. B. Spesifikasi Z-80 Mikroprosesor Z-80 mempunyai Saluran (Bus) Data 8 jalur (D0 .

H. untuk menunjuk lokasi awal program . E. - Register IX dan IY merupakan register Index. D. D’. C’. dengan konsep LIFO (Last In First Out) - Register PC (Program Counter). berfungsi untuk penunjuk lokasi memori. C. dapat digunakan untuk keperluan umum dan tempat menyimpan hasil. L merupakan register 8 bit dan dapat disambung menjadi 16 bit. L’ merupakan register cadangan dapat digunakan untuk menyimpan seluruh isi register. - Register B’. E’.5-34 Mikroprosesor 16 bit 8 bit 8 bit A F B C D E H L IX IY SP PC Gambar 11 Susunan Register Z-80 7 S 6 Z 5 4 3 2 P/O 1 N 0 C Bit Nama Bit Contoh : Bit 7 → Sign Bit 6 → Z (zero) = 1 jika hasil oparasi aritmatik sama dengan nol Bit 2 → Parity /Overflow Bit 1 → Substrack Bit 0 → C (carry) = 1 jika hasil operasi aritmatik menghasilkan carry - Register B. - Register SP (Stack Pointer) berhubungan dengan mekanisme stack (sususunan simpanan memori) dan digunakan untuk mekanisme SUBRUTIN. H’.

Namun demikian tidak semua ruang memori dapat digunakan untuk operasional program (pengisian dan penghapusan data). LD HL. (HL) .BC LD A. Penghapusan dilakukan dengan cara menumpangi data sebelumnya.526 alamat memori. LD HL.Mikroprosesor 5-35 3. POP AF Register ← memory Resister ← immediate data LD A. A15). setiap lokasi mampu menyimpan 8 bit atau 1 byte bil heksa. RAM terdiri dari 2048 alamat/lokasi memori.125AH LD (HL). Spesifikasi MPF-1 sama dengan karakteristik Z-80. Pemrograman Z-80 Pemrograman Z-80 pada hakekatnya adalah proses mengisi penghapusan register atau dengan transfer data.B .A . yaitu : Bus Data 8 jalur (D0 . berisi program monitor RAM perintah tidak permanen Memori Tambahan .5BH MPF-1 merupakan alat yang menggunakan komponen utama mikroprosesor Z-80. yang dinamakan MPF-1. sehingga space memori yang dapat dihubungi sebanyak 65.25H . ditambah dengan komponen pendudung memori eksternal : ROM dan RAM. disusun dalam Peta memori KTP sebagai beikut : Alamat 0000H s/d 07FFH 1800H s/d 1FFFH 2000H s/d 2FFFH IC EPROM 2716 RAM 6116 RAM 6116 ROM 2716 ROM 2732 Fungsi ROM.. yaitu : Jenis Tranfers Data Instruksi Register ← register Contoh : LD A. sehingga RAM mampu menyimpan 16 Kbit dalam bentuk 2k x 8 bit atau 2 Kbyte. Untuk melakukan pelatihan pemrogram Z-80 digunakan KIT Komputer Papan Tunggal (KPT). PUSH BC Memory ← register LDD Memory ← memory Memory ← immediate data LD (HL). Instruksi alih/transfer data ada beberapa jenis.. dengan alamat 1800H s/d 1FFFH. D7) dan bus alamat 16 jalur (A0 . Beberapa alamat ruang memori yang dapat digunakan.

Contoh program : ADDR 1800 1802 1803 1804 1807 1808 1809 180A OpCode 3E 47 0A 21 DD DD DD FF Mnemonic Operand LD A. .A LD A. kurang satu.05 LD B. Komponen Pemrograman Z-80. dan Komentar. Operasi Aritmatik dan Logika. yaitu : Address.Semua operasi aritmatik dan logika hanya bisa dilakukan pada register A. Operasi Aritmatik . tambah satu. dan membandingkan.1910H LD IX. Pemrograman Z-80 menggunakan bahasa “assembler” atau bahasa mesin. Mnemonic.5-36 Mikroprosesor Dari peta memori dapat diketahui hanya ruang memori alamat 1800H s/d 1FFFH yang dapat digunakan untuk operasional program.(IX+0) LD C.1915H LD C. pengurangan. .(BC) LD HL.Jenis operasi aritmatik yang dapat dioperasikan dengan Z-80 adalah : penjumlahan. Ada empat komponen yang perlu dipelajari agar dapat melakukan pemrograman dengan bahasa “assembler”. Tiga komponen untuk komunikasi dengan Z-80. 4. a. Op-Code.(IX+5) RST 38H Komentar Isikan 05H ke Reg A Kutip isi Reg A ke Reg B Kutip isi yang ditunjukkan oleh adres reg BC Isikan reg HL dengan 1910H Isikan isi addres memori 1915H ke Reg IX Kutip isi memori yang ditujukkan oleh adres Rg IX+0 = 1915H Kutip isi memori yang ditujukkan oleh adres Reg IX+5 = 191AH Kembali ke Display Op-Code dan Mnemonic dapat dilihat pada daftar Instructions Shorted By Op-Code dan Instructions Shorted By Mnemonic yang ada dalam User’s Manual MPF-1. 5. komentar untuk komunikasi dengan orang lain (manusia).

begitu juga pengurangan juga ada dua : SUB dan SBC . Operasi Logika .Contoh : ADD A. Jumlah alamat 16 d.D : A ← A-B . Jumlah intruksi alih/transfer data pada Z-80 sebanyak a. Register 16 bit artinya a. ADC A. Lebar peta memori 16 c. 6 buah d. maka lebar jalur saluran adalah a. Register yang merupakan kumulan dari register 1 bit adalah register a. Tempat operasi aritmatik dan logik adalah pada register a. Jumlah data per alamat 16 b. SUB A. 4 buah b. E 4. atau negatif informasi disimpan di register F(Flag). B b. D d.Jenis operasi yang dapat dilakukan : AND. 4 jalur 3.Hasil operasi aritmatik dan logika yang berstatus : Nol.C : A ← A+C . 8 buah 5. A b. ada carry. F c. 8 jalur b.C dalam operasi ADC / SBC adalah Carry . H . Lebar jalur 16 c.B OR N : A ← A+N . Latihan I. NOT. 12 jalur d.N : A ← A+B+cy SBC A. Pilih satu jawaban yang paling benar 1. OR B : A ← A+B .Salah satu data harus di register A .Operasi penjumlahan ada dua : ADD dan ADC. D c.N : A ← A-B-cy b. . 16 jalur 2. F d. 2 buah c. Bilamana jalur saluran ditunjukka dengan kode D0 – D15. C.Mikroprosesor 5-37 .Contoh : AND B : A ← A. dan XOR . OR.

-. -1. dan Komentar. Semua operasi aritmetik dan logika hanya bisa dilakukan dalam register A. Rangkuman Mikroprosesor Z-80 dinamakan Z-80. Operasi aritmetik yang dalakukan adalah +. Op-Code. mempunyai 8 jalur saluran data dan 16 jalur saluran alamat sehingga ada 65. dan XOR.5-38 Mikroprosesor II Jawab dengan singkat dan benar 1. NOT.256 alamat pada memori eksternal yang dapat dihubungi. Mengapa pada saat melakukan pemograman Z-80 menggunakan KPT MPF-1 tidak memakai alamat 0000H s/d 07FFH ? D. yaitu : Address. Mnemonic. OR. Z-80 memiliki 8 buah register 8 bit dan 4 buah register 16 bit.Peserta latih mempelajari materi buku ajar . Register A berfungsi tempat operasi aritmetik dan logika. Menggunakan Z-80 dapat dilakukan 6 jenis intruksi alih/transfer data. Lembar Kegiatan Peserta latih . . sedangkan operasi logika yang dapt dilakukan : AND. untuk dapat melakukan pemrograman harus nmengetahui 4 komponen.Peserta latih mengerjakan latihan . dan membandingkan. Bagaimana cara mengetahui kalau hasil operasi aritmetik Z-80 menghasilkan Carry ? 2. register F kumpulan dari register 1 bit untuk menyatkan hasil operasi ALU.Peserta latih menjawab soal-soal test formatif E.Peserta latih mendengarkan asesor penjelaskan materi pelajaran . Pada saat pemrograman menggunakan KPT MPF-1 hanya alamat 1800 s/d 1FFF yang dapat digunakan untuk operasional program. +1. Pemrograman Z-80 menggunakan bahasa Assembler.

Lebar peta memori 8 c. 8 jalur b. Register pusat operasi d. Lebar jalur 8 b. 67 c. Mengambil data dari reg B. 6 buah b. Pilih satu jawaban yang paling benar 1. Register AF dan IX adalah a. Mengisi reg B. Test Formatif I. Jumlah intruksi alih/transfer data pada Z-80 sebanyak a. Register 8 bit artinya a. Bilamana jalur saluran ditunjukkan dengan kode D0 – D11. 8 buah 6. menggunakan MPF-1 akan tampil angka a. Register ← memory d. A9 . Register 16 bit 3. 2 buah c. Register 8 dan 16 bit d. Semua jawaban salah c. Register ← register b. D a. Mengisi 25 dari reg B c. Jumlah data per alamat 8 c. 4 register 8 bit c. LD B. Kumpulan dari register 1 bit b.D adalah merupakan instruksi transfer data 9. Register F adalah merupakan register a. 76 d. 12 jalur d. F d. 16 jalur 2. Tempat operasi aritmatik dan logik adalah pada register a. 26 b. 4 buah d. Resister ← immediate 7. 2 register 16 bit b. maka lebar jalur saluran adalah a. Memory ← register 8. H c.25 d. Jumlah alamat 8 d. A b. LD C. Hasil operasi A9 + 67. 25 c. Register 16 bit 5.Mikroprosesor 5-39 F.25 artinya adalah a. 4 jalur 4. Register Kontrol c.

tiga II Jawablah dengan singkat dan benar 1. Rencanakan program untuk : - memasukkan data 25 ke reg A memasukkan data 13 ke reg B Mengurangi isi reg A dengan B 3. satu c. dua d. maka Bit C pada reg F akan menunjukan angka a. Menggunakan Z-80 data sebesar 322 akan diakses sebanyak berapa kali ? 2. nol b.5-40 Mikroprosesor 10 Hasil operasi soal no 9. Mengapa pada saat melakukan pemograman Z-80 menggunakan KPT MPF-1 hanya boleh memakai alamat 1800 s/d 1FFF ? .

b 4. b 10 c menggunakan mikroprosesor sebagai komponen utamnya 2. b 5. c 5. komputer pengolah data menggunakan CPU (central processing Unit). b 3. 2. b 7. Suatu sistem yang 6. Karenan fungsi saluran data antara lain adalah mengambil data dari memori dikirim ke CPU dan mengambil data dai CPU disimpan ke memori 2. b 9. d 7.Mikroprosesor 5-41 KUNCI JAWABAN TES FORMATIF 1. 3. c 9. c II 1. 1. address bus (jlm 4 ) data bus Mikroprosesor (jlm 4) kontro bus Power Supply . c 2. Karenan mikroprosesor merupakan komponen yang kinerjanya ditentukan oleh program. Pembelajaran 1 I. Sistem mikroprosesor pengolah data menggunakan MPU (Mikroprosesor processing Unit). 1. c 8. b II 1. c 8. b 4. Pembelajaran 2 I. b 3. d 10. c 2. c 6.

a 8. d 4. c 7. b 2. 3. c 8. 3. CMOS-SOS (CMOS Silicon-On-Sapphire). Bipolar I2L (Integrated Injection Logic). 3 buah 2. 5. 1. Pembelajaran 4 I. Karena arus atau tegangan dalam rangkaian tidak kuat atau tidak dapat mencatu komponen berikutnya dalam suatu rangkaian 4. c 10. 4. a 7. 2. b 6. 3. c 9. d 5. Jenis-jenis teknologi mirkoprosesor : PMOS (Metal Oxide Semoconductor kanal P). NMOS( MOS kanal N). c b d a a 6. b . Pembeljaran 3 I 1. d 3. CMOS (Complentay MOS). a 9. Bipolar Schottky. b II 1. Bipoler ECL (Emiter Couple Logic).5-42 Mikroprosesor 3. d 10.

21 kali 2. 13 SUBC A.B Op-Code Komentar 3. ADDR 1800 1802 1804 Mnemonic LD A. Karena alamat yang lain sudah digunakan untuk program intern mikroprosesor atau untuk fasilitas exspan memori. Contoh : Manajemen Memori MPF-1 Alamat 0000H s/d 07FFH 1800H s/d 1FFFH 2000H s/d 2FFFH IC EPROM 2716 RAM 6116 RAM 6116 ROM 2716 ROM 2732 Fungsi ROM.Mikroprosesor 5-43 II.25 LD B. 1. berisi program monitor RAM perintah tidak permanen Memori Tambahan .

adalah teknik komando/instruksi standar untuk memerintah komputer mengolah data Data adalah deskripsi dari sesuatu dan kejadan yang kita hadapi (data is the description of things and events that we face). terkandung rangkaian ALU (arithmetic-logic unit) Mnemonic adalah singkatan-singkatan yang mcngindikasikan suatu operasi .5-44 Mikroprosesor GLOSARIUM Bahasa Assembly adalah bahasa komputer yang kedudukannya di antara bahasa mesin dan bahasa level tinggi misalnya bahasa C atau Pascal Bahasa pemrograman. Mikroprosesor adalah suatu chip (IC=integrated circuits) yang di dalamnya. atau sering diistilahkan juga dengan bahasa komputer.

Garland. Bandung : PAU Bid Mikroelektrika . Pengantar Mikroprosesor. Z-80 Assembly language programming.co. 1991.id/ mikroprosesor+Z80 SoegijardjoSoegijoko. 1991. California : McGraw-Hill http://www. Leventhal. Terjemahan : Barnawi. Experiment Manual (Software/Hardware) Harry. Jakarta : Erlangga Lance A. 1984. MPF-1. 1986.co.Mikroprosesor 5-45 DAFTAR PUSTAKA Acer. Pengantar desain sistem mikroprosesor.id/mikroprosesor http://www.google. 1979. MPF-1.google. User’s Manual Acer.

BUKU AJAR PEMBELAJARAN INOVATIF .

guru merupakan salah satu faktor yang sangat mempengaruhi hasil belajar siswa. Guru adalah salah satu komponen utama dalam sistem pendidikan yang sangat mempengaruhi hasil pendidikan. tidak adaptif dan antisipatif terhadap perubahan. dan kompetensi kepribadian. Dengan demikian sistem pendidikan harus senantiasa menyesuaikan diri dengan kebutuhan pembangunan nasional. kualitas. guru dituntut dapat mendidik atau mengajar dan melatih. kompetensi kompetensi profesional yang diperoeh melalui pendidkan profesi. Keberhasilan suatu sistem pendidikan antara lain diukur dari keberhasilannya memasok tenagatenaga terampil dalam jumlah yang memadai bagi kebutuhan sektorsektor pembangunan dan harus dapat berperan dalam pembangunan nasional sesuai dengan kemampuan dan keterampilan yang dimiliki untuk mengisi lapangan pekerjaan yang memerlukannya. Dalam . Guru merupakan kunci utama untuk meningkatkan mutu pendidikan karena salah satu persyaratan penting bagi terwujudnya pendidikan yang bermutu adalah apabila pelaksanaannya dilakukan oleh pendidik-pendidik yang keprofesionalannya dapat diandalkan. Dalam mengemban tugas dibidang keprofesiannya sebagai pengajar. Berdasarkan dinyatakan paedagogik. RASIONAL Pada konstelasi sistem pendidikan nasional. bahwa Undang-undang kompetensi nomor guru itu 14/2005 meliputi pasal 10. tidak mau kompetensi sosial. Menurut Slamet PH (1992) dunia pendidikan tidak akan mengalami perubahan apapun sepanjang para dosen dan guru berubah. maupun jenis-jenis pekerjaan yang ada di masyarakat.BAB I PENDAHULUAN A. pendidikan sering dikaitkan dengan pembangunan nasional. baik dalam jumlah.

berdasarkan hasil analisis penelitian terhadap rendahnya hasil belajar siswa. dengan dengan pendekatan yang semula bersifat tekstual berubah menjadi kontekstual. Pada pembelajaran tersebut suasana kelas cenderung teacheroriented sehingga siswa menjadi pasif. misalnya. mediator. Tugas-tugas ini secara tidak langsung melebur dalam diri guru yang akan tercermin dalam tindakannya sehari-hari. serta sebagai evaluator terhadap siswa harus terjadi dengan baik.7-2 Pembelajaran Inovatif pelaksanaan dikelas. pendidikan yang bertumpu pada kemandirian Demikian pula sekarang dalam konteks menyesuaikan . Sembilan dari 10 orang yang kami jumpai. by their education. manager kelas. Agar diperoleh hasil yang maksimal perlu adanya perubahan paradigma pembelajaran yang berorientasi pada siswa dengan metodologi yang berorientasi pada partisipatori. menjelang era reformasi bergulir. nine parts of ten are what they are. Juga usaha-usaha nyata telah banyak dilakukan untuk meningkatkan mutu sumber daya manusia melalui pendidikan. gagasan-gagasan tentang bagaimana meningkatkan mutu pendidikan telah banyak dilontarkan. Manajemen peningkatan mutu berbasis sekolah (MPMBS). Secara empiris. Menurut Locke. Gagasan Locke ini menyegarkan komitmen bahwa pendidikan itu memang penting. Di Indonesia. fasilitator. merupakan strategi peningkatan mutu sekolah. hal tersebut lebih banyak disebabkan proses pembelajaran yang didominasi oleh pembelajaran tradisional. Hal ini nampak dari rata-rata hasil belajar yang masih memprihatinkan. Salah satu masalah pokok dalam pembelajaran pada pendidikan formal saat ini adalah masih rendahnya daya serap peserta didik. Of all the men we meet with. ditentukan oleh pendidikannya. baik budi atau jahat. useful or not. good or evil. saat proses belajar mengajar setidak-tidaknya tugas guru seperti sebagai demonstrator. bermanfaat atau sebaliknya. Tidak ada manusia di dunia sekarang ini yang mengingkari kebenaran peran pendidikan tersebut.

adanya perubahan cara berpikir produktif menjadi reflektif (productive thinking menjadi reflective thinking). dan penilaian hasil pembelajaran. Sebelum KTSP di resmikan telah diujicoba pelaksanaannya dengan Kurikulum Berbasis Kompetensi (KBK).Pembelajaran Inovatif 7-3 perkembangan dan kemajuan. Untuk itu. Sekolah harus menyusun kurikulum tingkat satuan pendidikan (KTSP) atau silabusnya dengan cara melakukan penjabaran dan penyesuaian Standar Isi dan Standar Kompentensi Lulusan yang ditetapkan dengan Permendiknas No. adanya perubahan paradigma dari mengajar menjadi belajar (Teaching menjadi Learning). 23 Tahun 2006. dan kondisi sekolah atau daerah. . Kurikulum tersebut disebut dengan KTSP (Kurikulum Tingkat Satuan Pendidikan). Jadi KTSP merupakan hasil penyempurnaan dari KBK. Hal ini dikarenakan adanya pemahaman bahwa kompetensi knowledge) bukan tetapi sekedar lebih pengetahuan (demonstrating the merupakan kemampuan/kesanggupan melakukan (ability to do). Dengan demikian KTSP juga merupakan kurikulum yang berbasis kompetensi. Oleh karena itu dalam pelaksanaanya KTSP juga menuntut adanya kreativitas dan inovasi dalam pembelajaran. Kurikulum sebagai salah satu substansi pendidikan perlu didesentralisasikan terutama dalam pengembangan silabus dan pelaksanaannya yang disesuaikan dengan tuntutan kebutuhan siswa. wacana penerapan kurikulum berbasis kompentensi diharapkan mampu meningkatkan mutu pendidikan. banyak hal yang perlu dipersiapkan oleh daerah karena sebagian besar kebijakan yang berkaitan dengan implementasi Standar Nasional Pendidikan dilaksanakan oleh sekolah atau daerah. sekolah atau daerah memiliki cukup kewenangan untuk merancang dan menentukan materi ajar. Dengan demikian. Kurikulum baru (2004) telah diresmikan penggunaannya sebagai pedoman sekolah dalam rangka melaksanakan pendidikan. keadaan sekolah. kegiatan pembelajaran.

inter/intra personal). maka pembelajaran dititikberatkan pada aktivitas belajar siswa (Student Centered Learning/SCL). . Pengetahuan dan keterampilan prasyarat (Pengetahuan awal siswa menentukan kegairahan siswa belajar) 3. beberapa saran berikut ini diharapkan diikuti untuk menciptakan KBM yang efektif. Melibatkan sebanyak mungkin Indra.7-4 Pembelajaran Inovatif Motivasi dianggap faktor yang menentukan keberhasilan KBM. musik. tata nilai siswa) 2. Latihan yang tepat dan aktif 7. Untuk itu. Kebermaknaan (Siswa bakat. Siswa yang bermotivasi dalam KBM cenderung memperlihatkan hasil yang baik. Penilaian tugas (tugas dibagi dalam rentang waktu yang tidak terlalu lama dengan frekuensi pengulangan yang tinggi) 8. bebas dari takut) 9. Model (KBM sebaiknya memberikan contoh nyata yang bisa ditiru oleh siswa) 4. 1. Keaslian dan tugas menantang (materi. 11. Keragaman pendekatan (siswa akan belajar jika KBM bervariasi) 10. Komunikasi terbuka (Penyampaian informasi terstruktur sehingga siswa menerima pesan dengan baik) 5. menyeakan belajar bila terkait dengan minat. kegiatan yang baru akan menambah konsentrasi siswa) 6. bahasa. Kondisi dan konsekuensi yang menyenangkan (KBM nangkan. Adanya perubahan paradikma dari mengajar menjadi belajar (Teaching menjadi Learning). bukan pada aktivitas guru mengajar. matematis. Mengembangkan beragam kemampuan ( siswa belajar jika KBM mendorong pengembangan kemampuan logis. kinestik.

Pembelajaran Inovatif 7-5 Mengapa SCL? Di masa datang dibutuhkan tenaga kerja: 1. konsep dan keterampilan . mampu memecahkan masalah secara efektif 4. mampu memproses dan memanfaatkan informasi 5. berpendidikan baik 2. TEACHER CENTERED LEARNING STUDENT CENTERED LEARNING Pengetahuan ditransfer dari guru ke Siswa aktif mengembangkan siswa pengetahuan dan keterampilan yang dipelajari Siswa menerima pengetahuan Siswa aktif dalam mengelola secara pasif pengetahuan Lebih menekankan pada penguasaan materi Biasanya memanfaatkan media tunggal Guru sebagai pemberi informasi utama dan evaluator Juga mengembangkan karakter siswa Multimedia Guru sbg fasilitator dan evaluasi dilakukan bersama siswa Proses pembelajaran dan penilaian Saling berkesinambungan dan dilakukan secara terpisah terintegrasi Menekankan pada jawaban yang benar saja Penekanan pada proses pengembangan pengetahuan. dan kooperatif Hanya siswa yang dianggap melakukan proses pembelajaran Siswa dan guru belajar bersama dalam mengembangkan pengetahuan. Kesalahan dapat menjadi sumber belajar Sesuai untuk mengembangkan ilmu Sesuai untuk mengembangkan ilmu dalam satu disiplin saja dengan cara pendekatan interdisipliner Iklim belajar lebih individualis dan Iklim yang dikembangkan lebih kompetitif kolaboratif. mampu memanfaatkan teknologi secara efektif. suportif. mampu bekerja sama 3.

berpasangan dan kelompok. Ruang kelas dikelola sedemikian rupa sehingga beberapa aspek penting kelas terjamin. Demikian juga pengalaman belajar (learning experiences) lain seperti kegiatan lomba. kooperasi. learning to do. toleransi dan keterampilan hidup. empati. Oleh karena itu dalam merencanakan pembelajaran memerlukan metode dan strategi yang benar-benar dapat membawa peserta didik untuk mencapai kompetensi yang diharapkan sehingga peserta didik memperoleh pengalaman belajar yang bermanfaat . bakti sosial. kerjasama. kebun/sawah dan bengkel percobaan. belajar bekerjasama untuk mendapatkan sesuatu dan belajar menjadi sesuatu yang dipelajari. solidaritas. belajar untuk dapat melakukan. metode interdisipliner Beberapa hal di atas secara teoritik telah mampu memberikan pedoman tentang bagaimana pengalaman belajar harus (sebaiknya) dikelola. Dalam hal ini mengandung pengertian bahwa pembelajaran harus mengimplementasikan belajar untuk mengetahui. penelitian latihan. perkemahan.7-6 Pembelajaran Inovatif Tatap muka di kelas merupakan bag Siswa dapat belajar dengan terbesar dlm pembelajaran berbagai cara Penekanan pada tuntasnya materi pembelajaran Penekanan pada bagaimana cara guru melakukan pembelajaran Penekanan pada pencapaian kompetensi Penekanan pada bgm cara siswa belajar dengan menggunakan berbagai bahan pelajaran. studi banding. dikembangkan dan dikelola untuk mengembangkan kompetensi. seperti: o Aksessibilitas: mudah menjangkau alat dan sumber belajar o Mobilitas: siswa dan guru mudah bergerak o Interaksi: memudahkan interaksi guru dan siswa o Variasi kerja siswa: menjamin siswa kerja perorangan. learning to life together dan learning to be. Prinsip belajar mengajar menggunakan empat prinsip yaitu learning to know. kepemimpinan.

4. maka dalam mempelajari buku ajar ini dapat dilakukan dengan langkah-langkah sebagai berikut. mengasyikkan. Lakukan kegiatan yang diharapkan dari buku ajar ini dengan sungguhsungguh. PRASYARAT Agar tidak menghambat/mengalami kesulitan dalam mengikuti materi PLPG pembelajaran inovatif dan mempelajari buku ajar ini. Baca dengan seksama dan pahami isi Bab 1 untuk mengetahui arah dan tujuan penulisan buku ajar ini. maka diharapkan peserta PLPG sudah memiliki pengalaman membuat RPP dan mengimplementasikan di kelas. C. Baca dengan seksama dan fahami isi Bab 2 (kegiatan belajar 1 berupa dan kegiatan belajar 2 berupa praktik). 2. mencerdaskan dan menguatkan. PETUNJUK BELAJAR Agar dapat mencapai kompetensi yang diharapkan. 1. Kerjakan/jawablah pertanyaan/tugas latihan yang ada pada buku ajar ini. Dalam melaksanakan pembelajaran dirancang kegiatan yang menyenangkan. Cari dan tandai kata/kalimat kunci/penting pada setiap alinea dan catatlah untuk memudahkan mengingat kembali isinya.Pembelajaran Inovatif 7-7 bagi pengembangan keterampilan hidupnya. . Apabila ternyata belum bisa menjawab dengan benar. B. Agar pembelajaran menyenangkan seorang guru dituntut kreativitasnya untuk menciptakan situasi dan kondisi yang kondusif. 5. dan menarik. 3. baca ulang lagi materinya sampai dapat menemukan jawaban yang benar.

. • Peserta dapat mendemonstrasikan / mempraktekkan RPP yang telah dibuat pada KBM kelas simulasi. 2. TUJUAN PEMBELAJARAN • Peserta dapat menjelaskan strategi dan model pembelajaran. Indikator pencapaian Kompetensi • Mengenal strategi dan model-model pembelajaran. • Peserta dapat membuat RPP dengan model pembelajaran inovatif yang siap untuk dipraktekkan. Kompetensi dasar Mengenal model-model pembelajaran inovatif.7-8 Pembelajaran Inovatif D. • Mengenal dan mengidentifikasi berbagai model pembelajaran inovatif untuk diterapkan pada berbagai kondisi. E. KOMPETENSI DASAR DAN INDIKATOR PENCAPAIAN KOMPETENSI 1. dan menerapkannya pada RPP serta mengimplementasikan melalui demonstrasi dan simulasi. • Merencanakan dan membuat RPP dengan model pembelajaran inovatif yang sesuai dengan situasi dan kondisi lingkungan dan siswa. • Peserta dapat menjelaskan berbagai model pembelajaran inovatif untuk diterapkan pada berbagai kondisi.

BAB II PEMBELAJARAN 1 A. Secara sederhana perencanaan pembelajaran memuat materi yang akan diajarkan dalam KBM. strategi dan model pembelajaran. Seorang guru sudah barang tentu mempunyai pengalaman dalam membuat. Perubahan tersebut mencakup aspek kognitif. Jika rencana pembelajaran disusun dengan baik. akan membuat tujuan pembelajaran akan tercapai secara efektif dan efisien. Namun demikian perlu dicermati apakah RPP yang digunakan tersebut sudah sesuai dengan kurikulum. serta evaluasi yang digunakan untuk mengukur keberhasilan KBM. silabi. maupun menggunakan RPP yang sudah ada untuk digunakan dalam melaksanakan tugas mengajarnya. situasi dan kondisi siswa maupun tempat belajarnya. ALUR RPP RP dan KD -------------->> Silabus -------------->> RPP . Rencana pelaksanaan pembelajaran (RPP) adalah rencana yang menggambarkan prosedur dan pengorganisasian pembelajaran untuk mencapai satu kompetensi dasar yang ditetapkan dalam Standar Isi dan telah dijabarkan dalam silabus. Lingkup Rencana Pembelajaran paling luas mencakup 1 (satu) kompetensi dasar yang terdiri atas 1 (satu) atau beberapa indikator untuk 1 (satu) kali pertemuan atau lebih. afektif maupun psikomotornya. PERENCANAAN PEMBELAJARAN Perencanaan pembelajaran adalah suatu proses dan cara berpikir mengenai segala sesuatu yang berkaitan dengan pembelajaran yang akan dilakukan dengan tujuan agar diri seseorang atau sekelompok orang dapat berubah. mengadopsi. Perencanaan pembelajaran merupakan langkah penting untuk mencapai keberhasilan pembelajaran.

: ….. : …. : ….. Penilaian : …... : …. : ….. Langkah-langkah Pembelajaran Pertemuan pertama. : …... : ….7-10 Pembelajaran Inovatif CONTOH FORMAT RPP RENCANA PELAKSANAAN PEMBELAJARAN Mata Pelajaran Kelas/Semester Pertemuan KeAlokasi Waktu Standar Kompetensi Kompetensi Dasar Indikator I. : …... Alat/Bahan/Sumber Belajar VI.. ..... V... : ….. : …. A...... Kegiatan Inti C. Tujuan Pembelajaran II... : …. : …. : ….. dst... Materi Ajar III.. Kegiatan Awal B.. : .. Kegiatan Akhir Pertemuan kedua.. Metode dan model Pembelajaran IV....

dan Indikator yang akan digunakan (terdapat pada silabus yang telah disusun) 4. KD. INOVASI Ibrahim (1989) mengatakan bahwa inovasi adalah penemuan yang dapat berupa sesuatu ide. lembar pengamatan. (Lebih rinci dari KD dan Indikator. Menurut Prof. Materi ajar merupakan uraian dari materi pokok/pembelajaran 6. dan akhir. Merumuskan tujuan pembelajaran berdasarkan SK. Menentukan metode pembelajaran yang akan digunakan 7. contoh soal. Menentukan SK. Menentukan alokasi waktu yang dibutuhkan untuk pertemuan yang telah ditetapkan 3. karena indikator sudah sangat rinci sehingga tidak dapat dijabarkan lagi. Menentukan alat/bahan/ sumber belajar yang digunakan 9. Azis Inovasi berarti mengintrodusir suatu gagasan maupun teknologi baru. Menyusun kriteria penilaian. dan Indikator yang telah ditentukan. metode yang diamati sebagai sesuatu hal yang baru bagi seseorang atau sekelompok orang (masyarakat). inovasi merupakan genus dari change yang berarti perubahan. practice or object thatperceived as new by an individual or other unit of adoption. kejadian. teknik penskoran. barang. Inovasi dapat berupa ide. KD.) 5. inti. pada saatsaat tertentu rumusan indikator sama dengan tujuan pembelajaran. Mengidentifikasi materi ajar berdasarkan materi pokok/ pembelajaran yang terdapat dalam silabus. Merumuskan langkah-langkah pembelajaran yang terdiri dari kegiatan awal. Contoh bidangnya adalah : . 8. Inovasi dapat berupa hasil dari invention atau discovery.Pembelajaran Inovatif 7-11 Langkah-langkah Menyusun RPP 1. proses dan produk dalam berbagai bidang. Inovasi adalah an idea. Mengisi kolom identitas 2. dll B.

perkiraan yang tidak tepat terhadap inovasi. Sementara itu inovasi dalam teknologi juga perlu diperhatikan mengingat banyak hasil-hasil teknologi yang dapat dipergunakan untuk meningkatkan kualitas pendidikan. inovasi pendidikan umumnya merupakan suatu gerakan yang bersifat top down. 1. lemahnya berbagai faktor . meningkatkan kualitas pendidikan serta sebagai alat atau cara baru dalam memecahkan masalah yang dihadapi dalam kegiatan pendidikan. Dalam konteks Indonesia. (3). konflik dan motivasi yang kurang sehat. prosedur supervisi serta pengelolaan informasi pendidikan yang dapat meningkatkan efisiensi pelaksanaan pendidikan. dalam arti inisiatif dalam melakukan inovasi selalu datang dari pihak pemerintah. (2). Dengan demikian metode baru atau cara baru dalam melaksanakan metode yang ada seperti dalam proses pembelajaran dapat menjadi suatu upaya meningkatkan efektivitas pembelajaran. Kendala-kendala dalam Inovasi Pendidikan Kendala-kendala yang mempengaruhi keberhasilan usaha inovasi pendidikan antara lain: (1).7-12 Pembelajaran Inovatif --Managerial --Teknologi --Kurikulum Menurut Miles karakteristik inovasi adalah : --Deliberate --Novel --Specific --Direction to goal attaintment Aspek pokok yang mempengaruhi inovasi adalah : --Struktur --Prosedur --Personal Inovasi yang berbentuk metode atau model dapat berdampak pada perbaikan. seperti penggunaannya untuk teknologi pembelajaran.

(4). 2. para pencipta inovasi melakukan perubahan dan inovasi untuk bidang yang ditekuninya berdasarkan pemikiran. di sini ada unsur keputusan yang mendasarinya. berkaitan dengan situasi dan kondisi. Inovasi yang demikian memberi dampak yang lebih baik dari pada model sebelumnya.to forming an attitude toward the innovation. to implementation of the new ide. oleh karena itu proses inovasi dapat dimaknai sebagai proses keputusan Inovasi (Innovation decision Process). ide. Proses Inovasi Proses Inovasi berkaitan dengan bagaimana suatu inovasi itu terjadi. (6) kurang adanya hubungan sosial dan publikasi (Subandiyah 1992). dan pengalaman dalam bidangnya itu. keuangan (finacial) yang tidak terpenuhi. penolakan dari sekelompok tertentu atas hasil inovasi. Di sekolah. Untuk mengatasi masalah-masalah tersebut di atas. orang tua siswa.Pembelajaran Inovatif 7-13 penunjang sehingga mengakibatkan tidak berkembangnya inovasi yang dihasilkan. yang telah lama digeluti. (5). sehinga perubahan dan pembaharuan itu diharapkan dapat berhasil dengan baik. . dan agar mau berubah terutama sikap dan perilaku terhadap perubahan pendidikan yang sedang dan akan dikembangkan. maka guru. dan masyarakat umumnya harus dilibatkan. Di berbagai bidang. Menurut Everett M Rogers proses keputusan inovasi adalah the process through which abn individual (or other decision making unit) passes from first knowledge of an innovation. and to confirmation of this decision. administrator. to a decision to adopt or reject. Hal ini disebabkan oleh kesesuaian dengan kondisi nyata di tempat pelaksanaan inovasi tersebut. para guru menciptakan strategi atau metode mengajar yang menurutnya sesuai dengan akal yang sehat.

Atribut Dan Sumber-Sumber Inovasi Terdapat lima atribut inovasi : a. Extent of Change agents (upaya promosi) KBM merupakan salah satu bagian dari proses pembelajaran yang sangat penting dalam pengembangan daya analisis kritis dan kreatif. tingkat hubungan sosial) 4. Kondisi ini berhubungan secara positif dengan tingkat adopsi. kondisi ini berhubungan positif dengan tingkat adopsi. pemberian status. Communication (Saluran komunikasi) 3. kolektif. Nature of Sosial system ( Norma. otoritas) 2. Complexity d. 3.7-14 Pembelajaran Inovatif 3. Keadaan ini berpengaruh negatif terhadap tingkat adopsi. 2. . Oleh karena itu KBM harus dirancang sedemikian rupa sehingga dapat menstimulasi munculnya kemampuan analisis dan kreativitas siswa. Disamping hal tersebut di atas tingkat adopsi juga dipengaruhi oleh : 1. Keadaan dimana suatu inovasi dipandang konsisten dengan nilai-nilai yang ada. Kondisi dimana inovasi dipandang lebih baik dari ide sebelumnya. Keadaan dimana suatu inovasi dapat diuji secara terbatas. Keadaan dimana inivasi dipandang secara relative sulit difahami dan digunakan. Observability Penjelasan : 1. dan kebutuhan potensil adopter. Keadaan dimana hasil suatu inovasi dapat dilihat orang lain. Trialibility e. Compatibility c. 5. pengalaman masa lalu. 2) Previously introduces idea.yang nampak dari keuntungan ekonomis. 4. atau cara lainnya. Tipe keputusan inovasi (optional. atau inovasi itu dipandang sesuai dengan : 1) Socio cultural value and belief. Relative Advantage b. 3) Clients needs for innovation.

Di bawah ini di sampaikan beberapa contoh model pembelajaran yang dapat dipilih untuk dijadikan acuan pembuatan RPP. maupun keinginan guru. E-learning merupakan suatu teknologi pembelajaran yang relatif masih baru di Indonesia.Pembelajaran Inovatif 7-15 Pengembangan model pembelajaran erat kaitannya dengan perkembangan teknologi. video atau perangkat komputer atau kombinasi dari ketiganya. maka electronic learning disingkat menjadi e-learning. Jadi e-learning berarti pembelajaran dengan menggunakan jasa bantuan perangkat elektronika dapat berupa audio. Kata ini terdiri dari dua bagian. Termasuk dalam aspek pendidikan khususnya inovasi dalam pembelajaran. yaitu ‘e’ yang merupakan singkatan dari ‘electronica’ dan ‘learning’ yang berarti ‘pembelajaran’. CTL (Contextual Teaching and Learning) Mengingat (gagasan) dan belajar adalah proses siswa membangun makna pemahaman sendiri. Perkembangan Teknologi Informasi saat ini sangat berperan dan memasuki seluruh aspek kehidupan. ketersediaan sarana-prasarana. . kondisi siswa. 1. MODEL-MODEL PEMBELAJARAN Banyak model pembelajaran yang telah dikembangkan oleh para ahli bidang pendidikan melalui penelitian. C. Pembelajaran yang berbasis teknologi informasi adalah e-learning. Pola pembelajaran kontekstual berbeda dengan pembelajaran konvensional yang selama ini dikenal. dan dapat pula menggunakan jaringan internet. Untuk menyederhanakan istilah. kegiatan KBM hendaknya memberikan kesempatan kepada siswa untuk membangun makna (gagasan) tersebut secara berkesinambungan. Perbedaan mendasar ke duanya dapat dilihat pada tabel di bawah.

untuk mengembangkan problem-solving skills.7-16 Pembelajaran Inovatif Konvensional Menekankan hafalan Informasi ditentukan oleh guru Terfokus pada satu bidang studi Memberi tumpukan informasi Penilaian hanya menggunakan ulangan/ test Kontekstual Menekankan memori spasial Pemilihan informasi berdasarkan kebutuhan siswa Cenderung mengintegrasikan beberapa bidang studi Mengaitkan informasi dengan pengetahuan awal Penilaian autentik Pembelajaran kontekstual memenuhi syarat sebagai berikut: o Problem-based Learning (KBM yang menggunakan masalah kehidupan nyata sebagai konteks bagi siswa untuk belajar berfikir kritis. Prinsip kerja metode ilmiah mewarnai kegiatan siswa dalam memenuhi inkuirinya) o Project-based Learning (Belajar berbasis proyek/tugas: KBM yang mendorong kerja mandiri siswa dalam meningkatkan pemahaman terhadap materi pelajaran) o Work-based Learning (belajar berbasis kerja /tempat kerja: tempat kerja dirancang sebagai tempat siswa menimba pengalaman. dan apa yang dipelajari siswa dikaitkan dengan kebutuhan kerja) o Service-based Learning (belajar berbasis layanan: KBM yang mengaitkan pembelajaran akademis di sekolah dengan pengala- man jasa-layanan) o Cooperative Learning (KBM yang mengoptimalkan penggunanan kelompok kecil untuk memaksimalkan kondisi belajar dan pencapaian tujuan) . serta untuk menarik pengetahuan yang esensi dari materi pelajaran) o Inquiry-based Learning (Pembelajaran berbasis inkuiri yang mendorong inkuiri siswa dalam KBM.

proses KBM yang mengarah ke Berfikir tingkat tinggi Mendorong siswa berfikir tingkat tinggi merupakan ' perilaku baru' yang perlu ditingkatkan untuk menciptakan mutu KBM.1980): 1. (b) kedalaman pengetahuan. 3. model pembelajaran berbasis berita menunjukkan segi-segi keunggulan tertentu ditemukan pada proses pembelajaran yang tidak mungkin mendorong/ yang lain. (c) berfikir rasional dan kritis. Dalam Biologi. 'comprehension' (pemahaman) 2. (b) interaksi aktif di kelas. Istilah 'authentic' digunakan untuk membedakan dengan proses pembelajaran yang 'biasa/umum'. Lima standar (kriteria) 'authentic learning' adalah: (a) berfikir tingkat tinggi. dan (e) meningkatkan kebebasan berfikir untuk mendapatkan solusi. (2) Membaca Bermakna (3) Membandingkan Menyamakan (4) Masukan Ganda dan (5) Sinetik. yaitu: memberi pengalaman belajar kepada siswa untuk: (a) berfikir kreatif. (d) daya analisis masalah aktual. Menurut hasil penelitian. (c) keterkaitan dengan hidup (d) dialogal dan (e) dukungan sosial untuk sukses. Inquiry-to-inquiry Model pembelajaran lain sumber belajar (news-based) seperti dapat pemanfaatan berita sebagai digolongkan sebagai model pembelajaran 'Inquiry-to-inquiry Model yang terdiri atas 5 kegiatan yaitu: (1) Lingkar Pengetahuan.Pembelajaran Inovatif 7-17 2. Pembelajaran Autentik (Authentic Instruction) Gagasan tentang 'authentic learning' dilontarkan oleh Newmann (1995) yang mengkritik proses pembelajaran selama ini. 'application' (penerapan) 3. 'inquiry skills (ketrampilan berinkuiri) . telah lama dikenal 'not recalling' (tidak terlalu menekankan pada hafalan) tetapi KBM yang menekankan ( Falk.

perlu juga dikembangkan di sekolah. How could we determine if …… What could we look for…. if ….) Apa yang akan terjadi.. generalisasi. karena jawaban-jawabannya bisa terbuka. bila lingkungan hutan Jati kawasan Blora rusak? Apa yang terjadi..): Contoh: Apa perbedaan dioda dengan transistor? Jelaskan. perbedaan tegangan dengan arus? Jelaskan bagaimana kapasitor berperan dalam memperbaiki faktor daya? Apa perbedaan ion dan atom? Application (aplikasi): pertanyaan yang mendorong siswa untuk menerapkan teori. bila direndam dalam larutan garam? Inkuiri: Guru bisa pula mendorong siswa terlibat dalam proses berinkuiri bila siswa dihadapkan pada sejumlah pertanyaan: Perumusan (Formulate hypothesis) What would happen.. lihat contoh: Mengapa sambungan rel KA dibuat renggang? Mengapa sepotong ketimun mengerut. prinsip. bila musibah kabut asap akibat pembakaran hutan belum reda? Pertanyaan-pertanyaan tersebut lebih memancing siswa berfikir. bila sepotong ketimun tadi (setelah dimasukkan dalam air garam) dimasukkan kembali ke air tawar? Apa yang terjadi. seperti: What could we do …. / apa yang akan terjadi. 'making hypothesis' (menyusun hipotesa) Comprehension ( apa perbedaan… dan persamaan…. pada suatu situasi baru. bila…. . Coba bandingkan dengan yang berikut ini: Apakah enzim penting untuk pencernaan? Apakah planaria mengalami regerasi? Apakah fungi itu heteropik atau autotropik? Pertanyaan yang mengarah ke uji hipotesis.7-18 Pembelajaran Inovatif 4.

analisa. maka keberagaman kemampuan berkembang (Observing skills.Pembelajaran Inovatif 7-19 (apa yang bisa dilakukan …. men-tranformasi informasi (membuat tabel. social skills. Bukti apa yang bisa dikumpulkan untuk membuktikan bahwa ….Siswa dihadapkan pada teka-teki Dua hal tersebut umumnya menjamin partisipasi siswa lebih aktif dalam bertanya (berinkuiri) untuk menemukan jawaban. melalui proses-proses IPA (scientific methods) seperti: mengamati. Bagaimana kita bisa menentukan jika ….) Bukti apa yang bisa dikumpulkan untuk membuktikan bahwa ikan adalah penghuni bumi sebelum amphibi? Apa yang bisa dilakukan untuk membuktikan bahwa gerak reflek tidak pernah melalui pusat kesadaran? Bagaimana bisa ditentukan bahwa lebah itu butawarna? Pertanyaan-pertanyaan tingkat tinggi ini bila dibiasakan mendahului KBM akan meningkatkan partisipasi siswa. study skills). grafik). dan sebagainya. numeric skills. Jika proses belajar tersebut dilalui. bukan pengetahuan yang superfisial (dangkal).. Pengetahuan yang dalam Jawaban-jawaban terhadap jenis pertanyaan tersebut umumnya mencerminkan kedalaman pengetahuan.Siswa dihadirkan pada obyek (fenomena) kongkrit . melakukan percobaan. .. Prinsip seperti ini nafas dari pengalaman belajar (LEARNING EXPERIENCES) berbasis (bertujuan) kompetensi. Siswa menggunakan otaknya (pemikirannya) untuk menjawab. menghitung. Sekurang-kurang terdapat hal penting yang perlu diperhatikan saat mendorong siswa berfikir: .

KBM yang 'dialogal' Yang dimaksud dengan KBM yang 'dialogal' adalah KBM yang mendorong hubungan timbal balik Guru Siswa yang serasi. namun juga terdapat dukungan bagi yang masih . Dukungan sosial untuk sukses Siswa di Sekolah merupakan sistem sosial. penyalah gunaan obat) o mengoptimalkan pemanfaatan media sederhana (yang mudah ditemukan dalam kehidupan sehari-hari). Guru lebih banyak menempatkan peran sebagai fasilitator dari pada tutor. khususnya siswa yang telah memberi sumbangan pendapat yang mendekati benar. polusi.7-20 Pembelajaran Inovatif Keterkaitan dengan Kehidupan (Connectedness) Keterkaitan isi pelajaran dengan isu kehidupan sering menjamin motivasi yang tinggi dalam belajar. maka sebaiknya: o pertanyaan diarahkan kembali ke semua siswa. guru mengambil alih (memberi jawaban) o beri waktu cukup untuk menjawab o berikan umpan balik positif (bagus… baik… ok. Perlu diciptakan suatu nuansa bahwa sistem tersebut menghargai mutu. Dominasi guru berkurang. Berikut ini sebagai contoh. Suasana saling memberi (sharing of ideas) mewarnai komunikasi KBM. bisa dimengerti) o ingat akan pendapat siswa terdahulu. Keterampilan guru mengaitkan pelajaran dianggap sebagai perilaku 'baru' yang selama ini KBM masih berorientasi pada buku teks (text-book oriented). bila ada pertanyaan siswa yang ditujukan kepada guru. Terdapat dukungan bagi siswa yang maju. Usaha-usaha yang untuk menjamin keterkaitan tersebut adalah: o menghadir obyek (fenomena) yang kongkrit o mengaitkan tema dengan isu-isu kehidupan (kerusakan bisa dilakukan ekosistem. baru jika tidak bisa menjawab.

5. emua guru dalam kelompok termasuk guru yang telah mengajar kemudian bersama-sama mendiskusikan pengamatan mereka terhadap pembelajaran yang telah berlangsung. Perencanaan. Terdapat keseimbangan yang sehat antara kerja sama. Berarti tahap praktek mengajar terlaksana. Bukan sebaliknya. Refleksi/ kritikan terhadap pembelajaran. 3. Kerjasama ini meliputi: a. Salah satu guru dalam kelompok tersebut melakukan tahap perencanaan yaitu membuat rencana pembelajaran yang matang dilengkapi dengan dasar-dasar teori yang menunjang. Berarti tahap observasi terlalui. Lesson Study Lesson Study adalah suatu metode yang dikembangkan di Jepang yang dalam bahasa Jepangnya disebut Jugyokenkyuu. c. Praktek mengajar. Sejumlah guru bekerjasama dalam suatu kelompok. Adapun langkah-langkahnya sebagai berikut: 1. 4.Pembelajaran Inovatif 7-21 tertinggal. 2. Istilah ‘lesson study’ sendiri diciptakan oleh Makoto Yoshida. kompetisi untuk maju. Pendek kata. Tahap ini merupakan . solidaritas. Observasi. b. kelas tidak mendukung sebuah kesuksessan. sukses merupakan budaya yang dipupuk terus. 4. Guru-guru lain dalam kelompok tersebut mengamati proses pembelajaran sambil mencocokkan rencana pembelajaran yang telah dibuat. Guru yang telah membuat rencana pembelajaran pada (2) kemudian mengajar di kelas sesungguhnya. Lesson Study merupakan suatu proses dalam mengembangkan profesionalitas guru-guru di Jepang dengan jalan menyelidiki/ menguji praktik mengajar mereka agar menjadi lebih efektif. d.

sampai matematika dan olahraga dan pada setiap tingkatan kelas. Langkah-langkah: 1. Adapun kelebihan metode ‘lesson study’ sebagai berikut: 1. . 2. 3. Siswa lebih kritis dalam menganalisa gambar. Siswa diberi kesempatan untuk mengemukakan pendapatnya. Dalam tahap ini juga didiskusikan langkah-langkah perbaikan untuk pembelajaran berikutnya. Examples Non Examples Examples Non Examples adalah metode belajar yang menggunakan contoh-contoh. guru mulai menjelaskan materi sesuai tujuan yang ingin dicapai. 2.Tiap kelompok diberi kesempatan membacakan hasil diskusinya. Guru mempersiapkan gambar-gambar sesuai dengan tujuan pembelajaran. 5. Guru menempelkan gambar di papan atau ditayangkan lewat OHP. Hasil pada (5) selanjutnya diimplementasikan pada kelas/ pembelajaran berikutnya dan seterusnya kembali ke (2).7-22 Pembelajaran Inovatif tahap refleksi. Dapat dilaksanakan antar/ lintas sekolah. Melalui diskusi kelompok 2-3 orang siswa. 6. hasil diskusi dari analisa gambar tersebut dicatat pada kertas. bahasa. Kesimpulan. 4. Kebaikan: 1. Contoh-contoh dapat dari kasus / gambar yang relevan dengan KD. Guru memberi petunjuk dan memberi kesempatan kepada siswa untuk memperhatikan / menganalisa gambar. 2. 3. Dapat diterapkan di setiap bidang mulai seni. 5. Siswa mengetahui aplikasi dari materi berupa contoh gambar.Mulai dari komentar / hasil diskusi siswa.

Picture and Picture Picture and Picture adalah suatu metode belajar yang menggunakan gambar dan dipasangkan / diurutkan menjadi urutan logis. 7. 2. Guru menanyakan alasan / dasar pemikiran urutan gambar tersebut. Guru menunjukkan / memperlihatkan gambar-gambar yang berkaitan dengan materi. Guru menyampaikan kompetensi yang ingin dicapai. Memakan banyak waktu. Menyajikan materi sebagai pengantar. Memakan waktu yang lama. 4.Pembelajaran Inovatif 7-23 Kekurangan: 1. 5. 3. Numbered Heads Together Numbered Heads Together adalah suatu metode belajar dimana setiap siswa diberi nomor kemudian dibuat suatu kelompok kemudian secara acak guru memanggil nomor dari siswa. Kesimpulan / rangkuman. 6. Kekurangan: 1. Langkah-langkah: . 7. 2. Banyak siswa yang pasif. Melatih berpikir logis dan sistematis. 2. 6. Kebaikan: 1. Langkah-langkah: 1. Guru menunjuk / memanggil siswa secara bergantian memasang / mengurutkan gambar-gambar menjadi urutan yang logis. 2. Guru lebih mengetahui kemampuan masing-masing siswa. Tidak semua materi dapat disajikan dalam bentuk gambar. Dari alasan / urutan gambar tersebut guru memulai menanamkan konsep / materi sesuai dengan kompetensi yang ingin dicapai.

2. Kemungkinan nomor yang dipanggil. Guru dan siswa menetapkan siapa yang pertama berperan sebagai pembicara dan siapa yang berperan sebagai pendengar. Kelemahan: 1. Sementara .7-24 Pembelajaran Inovatif 1. dipanggil lagi oleh guru. Siswa dibagi dalam kelompok. dengan memasukkan ide-ide pokok dalam ringkasannya. Kelebihan: 1. Langkah-langkah: 1. 3. 5. Guru memanggil salah satu nomor siswa dengan nomor yang dipanggil melaporkan hasil kerjasama mereka. Kelompok mendiskusikan jawaban yang benar dan memastikan tiap anggota kelompok dapat mengerjakannya 4. Siswa yang pandai dapat mengajari siswa yang kurang pandai. 2. Tanggapan dari teman yang lain. Pembicara membacakan ringkasannya selengkap mungkin. Kesimpulan. Cooperative Script Skrip kooperatif adalah metode belajar dimana siswa bekerja berpasangan dan secara lisan mengikhtisarkan bagian-bagian dari materi yang dipelajari. 2. Guru membagi siswa untuk berpasangan. Tidak semua anggota kelompok dipanggil oleh guru. 2. 3. 3. 4. Dapat melakukan diskusi dengan sungguh-sungguh. Setiap siswa menjadi siap semua. kemudian guru menunjuk nomor yang lain. setiap siswa dalam setiap kelompok mendapat nomor. Guru membagikan wacana / materi tiap siswa untuk dibaca dan membuat ringkasan. 6. 8. Guru memberikan tugas dan masing-masing kelompok mengerjakannya.

Guru mendorong siswa untuk mengumpulkan informasi yang sesuai. 7. Setiap siswa mendapat peran. 2. Kekurangan: 1. 2. jadwal. Menjelaskan logistik yang dibutuhkan. Memotivasi siswa terlibat dalam aktivitas pemecahan masalah yang dipilih. Melatih pendengaran. Hanya dilakukan dua orang (tidak melibatkan seluruh kelas sehingga koreksi hanya sebatas pada dua orang tersebut). Bertukar peran. Guru membantu siswa mendefinisikan dan mengorganisasikan tugas belajar yang berhubungan dengan masalah tersebut (menetapkan topik. 3. Kesimpulan guru. Hanya digunakan untuk mata pelajaran tertentu. Langkah-langkah: 1. serta lakukan seperti di atas. ketelitian / kecermatan. Kelebihan: 1. peran guru menyajikan masalah. Melatih mengungkapkan kesalahan orang lain dengan lisan. 9.Pembelajaran Inovatif 7-25 pendengar menyimak / mengoreksi / menunjukkan ide-ide pokok yang kurang lengkap dan membantu mengingat / menghapal ide-ide pokok dengan menghubungkan materi sebelumnya atau dengan materi lainnya. tugas.) 3. Guru menjelaskan tujuan pembelajaran. Pembelajaran Berdasarkan Masalah Problem Based Instruction (PBI) memusatkan pada masalah kehidupannya yang bermakna bagi siswa. dll. 5. 6. melaksanakan eksperimen untuk mendapatkan penjelasan . Penutup. mengajukan pertanyaan dan memfasilitasi penyelidikan dan dialog. 2. semula sebagai pembicara ditukar menjadi pendengar dan sebaliknya.

Guru membantu siswa untuk melakukan refleksi atau evaluasi terhadap penyelidikan mereka dan proses-proses yang mereka gunakan. 2. 2.7-26 Pembelajaran Inovatif dan pemecahan masalah. . pemecahan masalah. 3. Untuk siswa yang malas tujuan dari metode tersebut tidak dapat tercapai. Kelebihan: 1. Membutuhkan banyak waktu dan dana. Tidak semua mata pelajaran dapat diterapkan dengan metode ini. 2. hipotesis. 5. 10. Explicit Instruction (Pengajaran Langsung) Pembelajaran langsung khusus dirancang untuk mengembangkan belajar siswa tentang pengetahuan prosedural dan pengetahuan deklaratif yang dapat diajarkan dengan pola selangkah demi selangkah. 4. Guru membantu siswa dalam merencanakan dan menyiapkan karya yang sesuai seperti laporan dan membantu mereka berbagi tugas dengan temannya. pengumpulan data. 5. Langkah-langkah: 1. Menyampaikan tujuan dan mempersiapkan siswa. 3. 3. Siswa dilibatkan pada kegiatan belajar sehingga pengetahuannya benar-benar diserapnya dengan baik. Dapat memperoleh dari berbagai sumber. Kekurangan: 1. Mendemonstrasikan pengetahuan dan ketrampilan. Dilatih untuk dapat bekerjasama dengan siswa lain. Membimbing pelatihan. 4. Mengecek pemahaman dan memberikan umpan balik. Memberikan kesempatan untuk latihan lanjutan.

Kekurangan: 1. Demikian seterusnya. Langkah-langkah: 1. 2. 2. Siswa benar-benar dapat menguasai pengetahuannya. 11. Kemudian siswa berada di lingkaran kecil diam di tempat. Separuh kelas lainnya membentuk lingkaran di luar lingkaran pertama. Pertukaran informasi ini bisa dilakukan oleh semua pasangan dalam waktu yang bersamaan. Rumit untuk dilakukan. Memerlukan waktu lama sehingga siswa yang tampil tidak begitu lama.Pembelajaran Inovatif 7-27 Kelebihan: 1. Dua siswa yang berpasangan dari lingkaran kecil dan besar berbagi informasi. Semua siswa aktif / terlibat dalam pembelajaran. Untuk mata pelajaran tertentu. Membutuhkan ruang kelas yang besar. 2. . Sekarang giliran siswa berada di lingkaran besar yang membagi informasi. 2. 3. dengan pasangan yang berbeda dengan singkat dan teratur. Kekurangan: 1. sementara siswa yang berada di lingkaran besar bergeser satu atau dua langkah searah jarum jam sehingga masing-masing siswa mendapat pasangan baru. Separuh kelas berdiri membentuk lingkaran kecil dan menghadap keluar. menghadap keluar. 5. Kelebihan: Mendapatkan informasi yang berbeda pada saat bersamaan. Inside – Outside – Circle (Lingkaran kecil – Lingkaran besar) Siswa saling membagi informasi pada saat yang bersamaan. 3. 4. Terlalu lama sehingga tidak konsentrasi dan disalahgunakan untuk bergurau.

3. 5. Guru mendemonstrasikan / menyajikan materi. Kekurangan: Pada saat presentasi hanya siswa yang aktif yang tampil. 2. 4. 4. Siswa dapat memberikan tanggapannya secara bebas. Guru memberikan wacana / kliping sesuai dengan topik pembelajaran. 5. Guru membuat kesimpulan bersama. Dilatih untuk dapat bekerjasama dan menghargai pendapat orang lain. Penutup. 6. Student Facilitator and Explaining Siswa / peserta mempresentasikan ide / pendapat pada rekan peserta lainnya. Guru menyampaikan kompetensi yang ingin dicapai. Memberikan kesempatan siswa / peserta untuk menjelaskan kepada peserta lainnya baik melalui bagan / peta konsep maupun yang lainnya. Langkah-langkah: 1. 6. . Guru menerangkan semua materi yang disajikan saat itu. Kelebihan: 1. Cooperative Integrated Reading and Composition (CIRC) Pada metode ini siswa dibentuk kelompok untuk memberikan tanggapan terhadap wacana/ kliping. 2. 13. Penutup. Membentuk kelompok yang anggotanya 4 orang yang secara heterogen. Mempresentasikan / membacakan hasil kelompok. Siswa bekerjasama saling membacakan dan menemukan ide pokok dan memberi tanggapan terhadap wacana / kliping dan ditulis pada lembar kertas.7-28 Pembelajaran Inovatif 12. Langkah-langkah: 1. 3. Guru menyimpulkan ide / pendapat dari siswa. 2.

7. 4. Nilai siswa dihitung dari jawaban benar dan jumlah horay yang diperoleh. kalau benar diisi tanda benar (v) dan salah diisi tanda silang (x). 5. 6. Adanya pendapat yang sama sehingga hanya sebagian saja yang tampil. Langkah-langkah: 1. siswa disuruh membuat kotak 9 / 16 / 25 sesuai dengan kebutuhan dan tiap kotak diisi angka sesuai dengan selera masing-masing. Guru menyampaikan kompetensi yang ingin dicapai. 8. Banyak siswa yang kurang aktif. 2. Kekurangan: 1. Memberikan siswa tanya jawab. yang paling dulu mendapatkan tanda benar langsung berteriak horay. Untuk menguji pemahaman. atau diagonal harus segera berteriak horay atau yel-yel lainnya. Guru mendemonstrasikan / menyajikan materi sesuai TPK. 3. Penutup.Pembelajaran Inovatif 7-29 Kelebihan: Siswa diajak untuk dapat menerangkan kepada siswa lain. Course Review Horay Suatu metode pembelajaran dengan pengujian pemahaman menggunakan kotak yang diisi dengan nomor untuk menuliskan jawabannya. dapat mengeluarkan ide-ide yang ada di pikirannya sehingga lebih dapat memahami materi tersebut. 14. Guru membaca soal secara acak dan siswa menulis jawaban di dalam kotak yang nomornya disebutkan guru dan langsung didiskusikan. . Siswa yang sudah mendapat tanda v vertikal atau horisontal. 2.

Evaluasi. Guru memberikan kesimpulan. Adanya peluang untuk curang. 2. 2.7-30 Pembelajaran Inovatif Kelebihan: 1. Melatih kerjasama. siapa yang memegang tongkat wajib menjawab pertanyaan dari guru setelah siswa mempelajari materi pokoknya. 4. Melatih membaca dan memahami dengan cepat. Talking Stick Metode pembelajaran dengan bantuan tongkat. 3. Guru menyampaikan materi pokok yang akan dipelajari. 7. Penutup. Pembelajarannya menarik mendorong untuk dapat terjun ke dalamnya. Menguji kesiapan siswa. 5. Kekurangan: 1. Langkah-langkah: 1. 15. demikian seterusnya sampai sebagian besar siswa mendapat bagian untuk menjawab setiap pertanyaan dari guru. kemudian memberikan kesempatan kepada siswa untuk membaca dan mempelajari 3. Guru mengambil tongkat dan memberikan kepada siswa. Siswa aktif dan pasif nilainya disamakan. Guru menyiapkan sebuah tongkat. 2. 2. Setelah materi pada pegangannya/ paketnya. membaca buku dan mempelajarinya guru selesai mempersilahkan siswa untuk menutup bukunya. 6. . Kelebihan: 1. Agar lebih giat belajar (belajar dahulu). setelah itu guru memberi pertanyaan dan siswa yang memegang tongkat tersebut harus menjawabnya.

17. mempertahankan pendapat. 2. Memerlukan waktu yang lama. 3. Semua siswa terlibat.Pembelajaran Inovatif 7-31 Kekurangan: Membuat siswa senam jantung. Setelah selesai setiap siswa yang berpasangan bergabung dengan satu pasangan lain. 2. Guru memberikan tugas dan siswa mengerjakan tugas dengan pasangannya. Langkah-langkah: 1. 5. Snowball Throwing Dibentuk kelompok yang diwakili ketua kelompok untuk mendapat tugas dari guru kemudian masing-masing siswa membuat pertanyaan yang dibentuk seperti bola (kertas pertanyaan) lalu dilempar ke siswa lain . 16. Kedua pasangan tersebut bertukar pasangan. 2. 4. Kelebihan: 1. Kekurangan: 1. Setiap siswa mendapat satu pasangan (guru biasa menunjukkan pasangannya atau siswa menunjukkan pasangannya). masing-masing pasangan yang baru ini saling menanyakan dan mengukuhkan jawaban mereka. Temuan baru yang didapat dari pertukaran pasangan kemudian dibagikan kepada pasangan semula. Siswa dilatih untuk dapat bekerjasama. Bertukar Pasangan Siswa berpasangan kemudian bergabung dengan pasangan lain dan bertukar pasangan untuk saling menanyakan dan mengukuhkan jawaban masing-masing. Guru tidak dapat mengetahui kemampuan siswa masing-masing.

kemudian menjelaskan materi yang disampaikan oleh guru kepada temannya. 4. Evaluasi. Kemudian kertas tersebut dibuat seperti bola dan dilempar dari satu siswa ke siswa yang lain selama kurang lebih 5 menit. . Kelebihan: 1. 9. Penutup. Saling memberikan pengetahuan. 6. 2. Guru membentuk kelompok-kelompok dan memanggil masingmasing ketua kelompok untuk memberikan penjelasan tentang materi. 2. Pengetahuan tidak luas hanya berkutat pada pengetahuan sekitar siswa. Tidak efektif. 5. 3. Setelah siswa mendapat satu bola / satu pertanyaan diberikan kesempatan kepada siswa untuk menjawab pertanyaan yang tertulis dalam kertas berbentuk bola tersebut secara bergantian. Guru memberikan kesimpulan. Kekurangan: 1. 8. Melatih kesiapan siswa. 7. Masing-masing ketua kelompok kembali ke kelompoknya masingmasing.7-32 Pembelajaran Inovatif yang masing-masing siswa menjawab pertanyaan dari bola yang diperoleh. 2. Langkah-langkah: 1. Kemudian masing-masing siswa diberikan satu lembar kerja untuk menuliskan pertanyaan apa saja yang menyangkut materi yang sudah dijelaskan oleh ketua kelompok. Guru menyampaikan materi yang akan disajikan.

Kelebihan: 1. Menyampaikan tujuan pembelajaran yang ingin dicapai. Materi yang didapat sedikit. 2. 2.Pembelajaran Inovatif 7-33 18. . 3. 3. Melatih kesiapan siswa. Suruh siswa secara bergiliran/ diacak menyampaikan hasil wawancaranya dengan teman pasangannya. Melatih daya serap pemahaman dari orang lain. kemudian berganti peran. bentuklah kelompok berpasangan dua orang. Mind Mapping Suatu metode pembelajaran yang sangat baik digunakan untuk pengetahuan awal siswa atau untuk menemukan alternatif jawaban. Langkah-langkah: 1. 7. Guru mengulangi / menjelaskan kembali materi yang sekiranya belum dipahami siswa. Kekurangan: 1. 5. kemudian seorang menceritakan materi yang disampaikan oleh guru dan yang lain sebagai pendengar setelah itu berganti peran. 2. Semua siswa terlibat (mendapat peran). 6. sampai sebagian siswa sudah menyampaikan hasil wawancaranya. lainnya. Suruhlah seorang dari pasangan itu menceritakan materi yang baru diterima dari guru dan pasangannya mendengar sambil membuat catatan kecil. Untuk mata pelajaran tertentu. 4. Untuk mengetahui daya serap siswa. Guru menyajikan materi sebagaimana biasa. Waktu yang dibutuhkan banyak. 3. Artikulasi Siswa membentuk kelompok berpasangan. Kesimpulan/ penutup. Begitu juga kelompok 19.

semua anggota dalam kelompok itu . 3. 5. Guru memberi tugas kepada kelompok untuk dikerjakan oleh anggota kelompok.). 4. Kekurangan: 1. 6. Dapat mengemukakan pendapat secara bebas. Guru mengemukakan konsep/ permasalahan yang akan ditanggapi oleh siswa. Kelebihan: 1. Membentuk kelompok yang anggotanya 4 orang secara heterogen (campuran menurut prestasi. Guru menyampaikan kompetensi yang ingin dicapai. 2. jenis kelamin. Student Teams – Achievement Divisions (STAD) Siswa dikelompokkan secara heterogen kemudian siswa yang pandai menjelaskan anggota lain sampai mengerti. Anggota yang tahu menjelaskan kepada anggota lainnya sampai mengerti. Tidak sepenuhnya murid yang belajar. sebaiknya permasalahan yang mempunyai alternatif jawaban. Tiap kelompok menginventarisasi/ mencatat alternatif jawaban hasil diskusi. Dari data-data di papan siswa diminta membuat kesimpulan atau guru 7. Dapat bekerjasama dengan teman lainnya. suku. 2. dll. memberi bandingan sesuai konsep yang disediakan guru. 2. Tiap kelompok membaca hasil diskusinya dan guru mencatat di papan dan mengelompokkan sesuai kebutuhan guru. Hanya siswa yang aktif yang terlibat. Guru menyajikan pelajaran. 20. 3. Membentuk kelompok yang anggotanya 2-5 orang. Langkah-langkah: 1.7-34 Pembelajaran Inovatif Langkah-langkah: 1. 2.

3. Pada saat menjawab uis tidak boleh saling membantu. 6. 5. Kekurangan: 1. 21. Membedakan siswa. Guru memberi kuis / pertanyaan kepada seluruh siswa. Penutup. Seluruh siswa menjadi lebih siap. Dapat melakukan diskusi dengan sungguh-sungguh. Melatih kerjasama dengan baik. Dapat bertukar pikiran dengan siswa yang lain. 2. setiap siswa dalam setiap kelompok mendapat nomor. 3. Kepala Bernomor Struktur (Modifikasi dari Number Heads) Siswa dikelompokkan dengan diberi nomor dan setiap nomor mendapat tugas berbeda dan nantinya dapat bergabung dengan kelompok lain yang bernomor sama untuk bekerjasama. Dalam kesempatan ini. 2. 4. . Siswa dibagi dalam kelompok. Kelebihan: 1.Pembelajaran Inovatif 7-35 4. 2. siswa disuruh keluar dari kelompoknya dan bergabung bersama beberapa siswa bernomor sama dari kelompok lain. guru bisa menyuruh kerjasama antarkelompok. Memberi evaluasi. Langkah-langkah: 1. Kesimpulan. siswa dengan tugas yang sama bisa saling membantu atau mencocokkan hasil kerjasama mereka. Penugasan diberikan kepada setiap siswa berdasarkan nomornya terhadap tugas yang berangkai. Laporan hasil kelompok dan tanggapan dari kelompok yang lain. Setiap siswa menjadi siap semua. Jika perlu. Kelebihan: 1. Anggota kelompok semua mengalami kesulitan. 2. 5.

Memudahkan mencari jawab. 22. Word Square Siswa diberikan lembar kegiatan kemudian menjawab soal dan mengarsir huruf dalam kotak sesuai jawaban. Melatih untuk berdisiplin. Langkah-langkah: 1. Bisa saja mencontek jawaban teman lain. Kelebihan: 1. 2. Siswa disuruh menjawab soal kemudian mengarsir huruf dalam kotak sesuai jawaban. Kegiatan tersebut mendorong pemahaman siswa terhadap materi pelajaran. Scramble Metode pembelajaran dengan membagikan lembar kerja yang diisi siswa. 4. Kelebihan: 1. Berikan poin setiap jawaban dalam kotak. Mendorong siswa untuk belajar mengerjakan soal tersebut. 3. 2. 2. 2. Guru tidak mengetahui kemampuan masing-masing siswa. Guru membagikan lembar kegiatan sesuai contoh. Guru menyajikan materi sesuai topik. Guru menyampaikan materi sesuai kompetensi. Langkah-langkah: 1. Kekurangan: 1. Siswa kurang berpikir kritis. 2. 23. 2. Membagikan lembar kerja dengan jawaban yang diacak susunannya. .7-36 Pembelajaran Inovatif Kekurangan: 1. Waktu yang dibutuhkan banyak.

. Kelebihan: Pembelajaran yang menarik dihubungkan dengan kehidupan nyata. Tidak semua terlibat dalam kegiatan pembelajaran. Nilai tergantung pada individu yang mempengaruhi nilai teman lain.Pembelajaran Inovatif 7-37 Kekurangan: 1. Concept Sentence Siswa dibentuk kelompok heterogen dan membuat kalimat dengan minimal 4 kata kunci sesuai materi yang disajikan. Mematikan kreatifitas siswa. Apabila jawaban benar maka siswa dipersilakan tepuk tangan atau yel-yel lainnya. Kekurangan: 1. 25. Kartu Arisan Siswa dibentuk kelompok dan setiap jawaban digulung dan dimasukkan ke dalam gelas kemudian siswa yang memegang kartu jawaban menjawab setelah dikocok terlebih dahulu. Langkah-langkah: 1. 5. Siswa tinggal menerima bahan mentah. 3. 2. Setiap jawaban yang benar diberi poin 1 sebagai nilai kelompok sehingga nilai total kelompok merupakan penjumlahan poin dari para anggotanya. 24. 2. Bentuk kelompok orang secara heterogen. Kertas jawaban bagikan pada siswa masing-masing 1 lembar / kartu soal digulung dan dimasukkan ke dalam gelas. Gelas yang telah berisi gulungan soal dikocok. kemudian salah satu yang jatuh diberikan agar dijawab oleh siswa yang memegang kartu jawaban. 2. 4.

6. Guru menyajikan materi secukupnya. Kekurangan: 1. 26. Make – A Match (Mencari Pasangan) Siswa disuruh untuk mencari pasangan kartu yang merupakan jawaban / soal sebelum batas waktunya. 3. 2. Kesimpulan. Guru menyiapkan beberapa kartu yang berisi beberapa konsep atau topik yang cocok untuk sesi review. 3. 7. 4. Tiap kelompok disuruh membuat beberapa kalimat dengan menggunakan minimal 4 kata kunci setiap kalimat. Hanya untuk mata pelajaran tertentu. Guru menyampaikan tujuan. 2. Setiap siswa mencari pasangan yang mempunyai kartu yang cocok dengan kartunya (soal jawaban). Hasil diskusi kelompok didiskusikan lagi secara pleno yang dipandu guru. Langkah-langkah: 1. Kelebihan: 1. 5. Setiap siswa mendapat satu buah kartu. . 2. Lebih memahami kata kunci dari materi pokok pelajaran.7-38 Pembelajaran Inovatif Langkah-langkah: 1. Tiap siswa memikirkan jawaban / soal dari kartu yang dipegang. 2. 4. yang dapat mencocokkan kartunya diberi poin. Guru membentuk kelompok yang anggotanya kurang lebih 4 orang secara heterogen. Menyajikan beberapa kata kunci sesuai materi/ tpk yang disajikan. Untuk yang pasif mengambil jawaban dari temannya. sebaliknya satu bagian kartu soal dan bagian lainnya kartu jawaban. Siswa yang lebih pandai mengajari siswa yang kurang pandai.

Take and Give Siswa diberi kartu untuk dihapal sebentar kemudian mencari pasangan untuk saling menginformasikan. 5. Tiap siswa harus mencatat nama pasangannya pada kartu control. Kekurangan: Waktu yang cepat. . 6. Semua siswa disuruh berdiri dan mencari pasangan untuk saling menginformasikan materi sesuai kartu masing-masing. 4.Pembelajaran Inovatif 7-39 5. Strategi ini dapat dimodifikasikan sesuai keadaan. kecermatan dan ketepatan serta kecepatan. Kesimpulan. Penutup. 8. Kesimpulan. 6. 7. Jelaskan materi sesuai topik menit. Setelah satu babak kartu dikocok lagi agar tiap siswa mendapat kartu yang berbeda dari sebelumnya. Setiap siswa yang dapat mencocokkan kartunya sebelum batas waktu diberi poin. 3. Untuk memantapkan penguasaan peserta. Kelebihan: Melatih untuk ketelitian. selanjutnya siswa diberi pertanyaan sesuai dengan kartunya. Untuk mengevaluasi keberhasilan. Demikian seterusnya. tiap siswa diberi masing-masing satu kartu untuk dipelajari (dihapal) kurang lebih 5 menit. Demikian seterusnya sampai tiap peserta dapat saling memberi dan menerima materi masing-masing. Langkah-langkah: 1. 27. 2. Siapkan kelas sebagaimana mestinya. kurang konsentrasi. berikan siswa pertanyaan yang sesuai dengan kartunya (kartu orang lain). 7. 8.

. Kelebihan: Sangat menarik sehingga setiap siswa ingin mencobanya.7-40 Pembelajaran Inovatif Kelebihan: Dilatih memahami materi dengan waktu yang cepat. Kekurangan: Bila siswa tidak menjawab dengan benar maka tidak semua siswa dapat maju karena waktu terbatas. Jelaskan materi menit. Langkah-langkah: 1. Kekurangan: Tidak efektif dan terlalu bertele-tele. Jawab yang tepat bila sesuai dengan isi kartu yang ditempel di dahi. yang kedua kartu ukuran 5 x 2 cm untuk menulis kata / istilah yang mau ditebak. Suruh siswa berdiri di depan kelas dan berpasangan. Tebak Kata Model ini menggunakan kartu yaitu kartu ukuran 10 x 10 cm dan diidi ciri-ciri kata lainnya yang mengarah pada jawaban. Bila belum tepat pada waktu yang telah ditetapkan boleh mengarahkan dengan kata-kata lain asal jangan langsung memberi jawabannya. 28. Seorang siswa diberi kartu yang berukuran 10 x 10 cm yang nanti dibacakan pada pasangannya. 3. Apabila jawabannya tepat (sesuai yang tertulis pada kartu) maka pasangan itu boleh duduk. Sementara siswa membawa kartu 10 x 10 cm membacakan katakata yang tertulis di dalamnya sementara pasangannya menebak apa yang dimaksud pada kartu 10 x 10cm. Seorang siswa lainnya diberi kartu berukuran 5 x 2 cm yang isinya tidak boleh dibaca (dilipat) kemudian ditempelkan di dahi atau diselipkan di telinga. 5. 2. 4.

mendapatkan balikan dari siswa apakah tujuan telah tercapai d. b. Metode Diskusi Metode diskusi adalah suatu cara mengajar yang dicirikan oleh suatu keterikatan pada suatu topik atau pokok pernyataan atau problem dimana para peserta diskusi dengan jujur berusaha untuk mencapai atau memperoleh suatu keputusan atau pendapat yang disepakati bersama. membantu siswa menyadari dan mampu merumuskan berbagai masalah sendiri maupun dari pelajaran sekolah g. Menjaga suasana kelas dan mengatur setiap pembicara agar seluruh kelas dapat mendengarkan apa yang sedang dikemukakan. Mengatur giliran berbicara agar jangan siswa yang berani dan berambisi menonjolkan diri saja yang menggunakan kesempatan untuk mengeluarkan pendapatnya.Pembelajaran Inovatif 7-41 29. Guru mengatur giliran pembicara agar tidak semua siswa serentak berbicara mengeluarkan pendapat. f. memanfaatkan berbagai kemampuan yang ada pada siswa b. membantu siswa belajar menilai kemampuan dan peranan diri sendiri maupun teman-teman f. Guru menjelaskan tujuan diskusi. Diskusi sebagai metode pembelajaran lebih cocok dan diperlukan apabila guru hendak: a. Guru memberikan ceramah dengan diselingi tanya jawab mengenai materi pelajaran yang didiskusikan. Adapun kegiatan guru dalam pelaksanaan metode diskusi sebagai berikut: a. c. e. . membantu siswa belajar berpikir secara kritis e. memberi kesempatan pada siswa untuk mengeluarkan kemampuannya c. d. mengembangkan motivasi untuk belajar lebih lanjut. Guru menetapkan suatu pokok atau problem yang akan didiskusikan atau guru meminta kepada siswa untuk mengemukakan suatu pokok atau problem yang akan didiskusikan.

Menghormati pendapat teman-teman atau kelompok lainnya walau berbeda pendapat. Mendengarkan dengan teliti dan mencoba memahami pendapat yang dikemukakan oleh siswa atau kelompok lain. Menelaah topik/pokok masalah yang diajukan oleh guru atau mengusahakan suatu problem dan topik kepada kelas. Mendengar tanggapan reaksi atau tanggapan kelompok lainnya terhadap pendapat yang baru dikemukakan. b. Menyusun kesimpulan-kesimpulan diskusi dalam bahasa yang baik dan tepat. agar dapat mengemukakan jawaban pemecahan problem yang diajukan. Bukan lagi menjadi pembicara utama melainkan menjadi pengatur pembicaraan. c. Mengatur agar sifat dan isi pembicaraan tidak menyimpang dari pokok/problem. f. j. Mengemukakan pendapat baik pemikiran sendiri maupun yang diperoleh setelah membicarakan bersama-sama teman sebangku atau sekelompok. Ikut aktif memikirkan sendiri atau mencatat data dari buku-buku sumber atau sumber pengetahuan lainnya. g. Tidak bertujuan untuk mencari kemenangan dalam diskusi melainkan berusaha . Selalu berusaha agar diskusi berlangsung antara siswa dengan siswa. i. j. Ikut menjaga dan memelihara ketertiban diskusi. i. e. d. h.7-42 Pembelajaran Inovatif g. h. Mencatat hal-hal yang menurut pendapat guru harus segera dikoreksi yang memungkinkan siswa tidak menyadari pendapat yang salah. Mencatat sendiri pokok-pokok pendapat penting yang saling dikemukakan teman baik setuju maupun bertentangan. Kegiatan siswa dalam pelaksanaan metode diskusi sebagai berikut: a.

f. Diskusi yang mendalam memerlukan banyak waktu.Pembelajaran Inovatif 7-43 mencari pendapat yang benar yang telah dianalisa dari segala sudut pandang. atau keputusan yang akan atau telah diambil. i. Melatih siswa untuk berdiskusi di bawah asuhan guru. d. c. siap dan kefasihan berbicara saja tetapi juga menuntut kemampuan berbicara secara sistematis dan logis. b. Dengan mendengarkan semua keterangan yang dikemukakan oleh pembicara. Sulit untuk menentukan batas luas atau kedalaman suatu uraian diskusi. Berdiskusi bukan hanya menuntut pengetahuan. kesimpulan. h. Membina suatu perasaan tanggung jawab mengenai suatu pendapat. . Adapun kelebihan metode diskusi sebagai berikut: a. b. Tidak semua topik dapat dijadikan metode diskusi hanya hal-hal yang bersifat problematis saja yang dapat didiskusikan. Memberi kesempatan kepada siswa untuk memperoleh penjelasanpenjelasan dari berbagai sumber data. Memberi kesempatan kepada siswa untuk menghayati pembaharuan suatu problem bersama-sama. Mengembangkan rasa solidaritas/toleransi terhadap pendapat yang bervariasi atau mungkin bertentangan sama sekali. g. j. e. Membina siswa untuk berpikir matang-matang sebelum berbicara. pengetahuan dan pandangan siswa mengenai suatu problem akan bertambah luas. menyetujui atau menentang pendapat teman-temannya. Kelemahan metode diskusi sebagai berikut: a. Merangsang siswa untuk ikut mengemukakan pendapat sendiri. Mendidik siswa untuk belajar mengemukakan pikiran atau pendapat. c.

30. setiap siswa dalam kelompok harus menguasai topik secara keseluruhan. remeh atau lebih bodoh. Dengan demikian. Ahli dalam subtopik lainnya juga bertindak serupa.7-44 Pembelajaran Inovatif d. e. b) merencanakan bagaimana mengajarkan subtopik bagiannya kepada anggota kelompoknya semula. Metode Jigsaw Pada dasarnya. Siswa-siswa ini bekerja sama untuk menyelesaikan tugas kooperatifnya dalam: a) belajar dan menjadi ahli dalam subtopik bagiannya. Memungkinkan timbulnya rasa permusuhan antarkelompok atau menganggap kelompoknya sendiri lebih pandai dan serba tahu daripada kelompok lain atau menganggap kelompok lain sebagai saingan. lebih rendah. Siswa pemalu dan pendiam tidak akan menggunakan kesempatan untuk berbicara. f. Biasanya tidak semua siswa berani menyatakan pendapat sehingga waktu akan terbuang karena menunggu siswa mengemukakan pendapat. Sehingga seluruh siswa bertanggung jawab untuk menunjukkan penguasaannya terhadap seluruh materi yang ditugaskan oleh guru. Selanjutnya guru membagi siswa ke dalam kelompok belajar kooperatif yang terdiri dari empat orang siswa sehingga setiap anggota bertanggungjawab terhadap penguasaan setiap komponen/subtopik yang ditugaskan guru dengan sebaik-baiknya. dalam model ini guru membagi satuan informasi yang besar menjadi komponen-komponen lebih kecil. . Siswa dari masing-masing kelompok yang bertanggungjawab terhadap subtopik yang sama membentuk kelompok lagi yang terdiri dari yang terdiri dari dua atau tiga orang. Pembicaraan dalam diskusi mungkin didominasi oleh siswa yang berani dan telah biasa berbicara. Setelah itu siswa tersebut kembali lagi ke kelompok masing-masing informasi sebagai “ahli” dalam subtopik subtopiknya tersebut dan mengajarkan penting dalam kepada temannya.

Para siswa selanjutnya diorganisasikan menjadi kelompok-kelompok yang berorientasi pada tugas (task oriented groups) yang beranggotakan 2 hingga 6 orang. mengikuti investigasi mendalam terhadap berbagai subtopik yang telah dipilih. baik dalam menentukan topik maupun cara untuk mempelajarinya melalui investigasi. Metode ini melibatkan siswa sejak perencanaan. Komposisi kelompok heterogen baik dalam jenis kelamin. Para siswa memilih topik yang ingin dipelajari. Implementasi Para siswa melaksanakan rencana yang telah dirumuskan pada langkah b). Metode ini menuntut para siswa untuk memiliki kemampuan yang baik dalam berkomunikasi maupun dalam ketrampilan proses kelompok (group process skills). etnik maupun kemampuan akademik. Metode Investigasi Kelompok (Group Investigation) Metode investigasi kelompok sering dipandang sebagai metode yang paling kompleks dan paling sulit untuk dilaksanakan dalam pembelajaran kooperatif. Adapun deskripsi mengenai langkah-langkah metode investigasi kelompok dapat dikemukakan sebagai berikut: a. Pembelajaran harus melibatkan berbagai aktivitas dan ketrampilan .Pembelajaran Inovatif 7-45 31. Pembagian kelompok dapat juga didasarkan atas kesenangan berteman atau kesamaan minat terhadap suatu topik tertentu. Merencanakan kerjasama Para siswa beserta guru merencanakan berbagai prosedur belajar khusus. kemudian menyiapkan dan menyajikan suatu laporan di depan kelas secara keseluruhan. Seleksi topik Para siswa memilih berbagai subtopik dalam suatu wilayah masalah umum yang biasanya digambarkan lebih dahulu oleh guru. c. tugas dan tujuan umum yang konsisten dengan berbagai topik dan subtopik yang telah dipilih dari langkah a) di atas. b. Para guru yang menggunakan metode investigasi kelompok umumnya membagi kelas menjadi beberapa kelompok yang beranggotakan 5 hingga 6 siswa dengan karakteristik yang heterogen.

Evaluasi Guru beserta siswa melakukan evaluasi mengenai kontribusi tiap kelompok terhadap pekerjaan kelas sebagai suatu keseluruhan. Analisis dan sintesis Para siswa menganalisis dan mensintesis berbagai informasi yang diperoleh pada langkah c) dan merencanakan agar dapat diringkaskan dalam suatu penyajian yang menarik di depan kelas. tidak semua materi pelajaran mengandung masalah. f. jujur dan terbuka. dan tidak efektif jika terdapat beberapa siswa yang pasif. atau keduanya. intuitif dan bekerja atas dasar inisiatif sendiri. . Kelemahannya memerlukan waktu yang cukup lama. d. Metode Inquiry Metode ini menekankan pada penemuan dan pemecahan masalah secara berkelanjutan. Presentasi kelompok dikoordinir oleh guru. memerlukan perencanaan yang teratur dan matang. kreatif. Guru secara terus-menerus mengikuti kemajuan tiap kelompok dan memberikan bantuan jika diperlukan. e. 32. Evaluasi dapat mencakup tiap siswa secara individu atau kelompok. Kelebihan metode ini mendorong siswa berpikir secara ilmiah. menumbuhkan sikap objektif.7-46 Pembelajaran Inovatif dengan variasi yang luas dan mendorong para siswa untuk menggunakan berbagai sumber baik yang terdapat di dalam maupun di luar sekolah. Penyajian hasil akhir Semua kelompok menyajikan suatu presentasi yang menarik dari berbagai topik yang telah dipelajari agar semua siswa dalam kelas saling terlibat dan mencapai suatu perspektif yang luas mengenai topik tersebut.

agar semua model berhasil seperti yang diharapkan pembelajaran kooperatif. peran pencatat (recorder).Pembelajaran Inovatif 7-47 33. pengatur materi (material manager). Peran tersebut mungkin bermacam-macam menurut tugas. Materi ajar dipilih dan disusun menjadi paket pro dan kontra. Ketrampilan sosial yang dibutuhkan dalam usaha berkolaborasi harus dipandang penting dalam keberhasilan menyelesaikan tugas kelompok. 34. Selanjutnya guru dapat mengevaluasi setiap siswa tentang penguasaan materi yang meliputi kedua posisi tersebut dan mengevaluasi seberapa efektif siswa terlibat dalam prosedur debat. Pengembangan imajinasi dan penghayatan dilakukan siswa dengan memerankannya sebagai tokoh hidup atau benda mati. Siswa dibagi ke dalam beberapa kelompok dan setiap kelompok terdiri dari empat orang. siswa (dua orang mengambil posisi pro dan dua orang lainnya dalam posisi kontra) melakukan perdebatan tentang topik yang ditugaskan. Pada dasarnya. pembuat kesimpulan (summarizer). Permainan ini . setiap model harus melibatkan materi ajar yang memungkinkan siswa saling membantu dan mendukung ketika mereka belajar materi dan bekerja saling tergantung (interdependen) untuk menyelesaikan tugas. Laporan masing-masing kelompok yang menyangkut kedua posisi pro dan kontra diberikan kepada guru. atau fasilitator dan peran guru bisa sebagai pemonitor proses belajar. Di dalam kelompoknya. Ketrampilan ini dapat diajarkan kepada siswa dan peran siswa dapat ditentukan untuk memfasilitasi proses kelompok. Metode Debat Metode debat merupakan salah satu metode pembelajaran yang sangat penting untuk meningkatkan kemampuan akademik siswa. Metode Role Playing Metode Role Playing adalah suatu cara penguasaan bahan-bahan pelajaran melalui pengembangan imajinasi dan penghayatan siswa. misalnya.

4. e. b. Guru dapat mengevaluasi pemahaman tiap siswa melalui pengamatan pada waktu melakukan permainan.7-48 Pembelajaran Inovatif pada umumnya dilakukan lebih dari satu orang. Berpikir dan bertindak kreatif. Siswa bebas mengambil keputusan dan berekspresi secara utuh. Metode Pemecahan Masalah (Problem Solving) Metode pemecahan masalah (problem solving) adalah penggunaan metode dalam kegiatan pembelajaran dengan jalan melatih siswa menghadapi berbagai masalah baik itu masalah pribadi atau perorangan maupun masalah kelompok untuk dipecahkan sendiri atau secara bersama-sama. Adapun keunggulan metode problem solving sebagai berikut: a. hal itu bergantung kepada apa yang diperankan. f. g. Menafsirkan dan mengevaluasi hasil pengamatan. Melatih siswa untuk mendesain suatu penemuan. Mengidentifikasi dan melakukan penyelidikan. Kelebihan metode Role Playing: 1. 5. Memecahkan masalah yang dihadapi secara realistis d. c. Merangsang perkembangan kemajuan berfikir siswa untuk menyelesaikan masalah yang dihadapi dengan tepat. 3. 35. Permainan merupakan penemuan yang mudah dan dapat digunakan dalam situasi dan waktu yang berbeda. . Orientasi pembelajarannya adalah investigasi dan penemuan yang pada dasarnya adalah pemecahan masalah. Melibatkan seluruh siswa dapat berpartisipasi mempunyai kesempatan untuk memajukan kemampuannya dalam bekerjasama. khususnya dunia kerja. Permainan merupakan pengalaman belajar yang menyenangkan bagi anak. Dapat membuat pendidikan sekolah lebih relevan dengan kehidupan. 2.

Pembelajaran Inovatif 7-49 Kelemahan metode problem solving sebagai berikut: a. Kelompok (team) Kelompok biasanya terdiri dari 4 sampai 5 orang siswa yang anggotanya heterogen dilihat dari prestasi akademik. diskusi yang dipimpin guru. 2. b. biasanya dilakukan dengan pengajaran langsung atau dengan ceramah. Aktivitas belajar dengan permainan yang dirancang dalam pembelajaran kooperatif model TGT memungkinkan siswa dapat belajar lebih rileks disamping menumbuhkan tanggung jawab. 36. melibatkan aktivitas seluruh siswa tanpa harus ada perbedaan status. persaingan sehat dan keterlibatan belajar. Beberapa pokok bahasan sangat sulit untuk menerapkan metode ini. melibatkan peran siswa sebagai tutor sebaya dan mengandung unsur permainan dan reinforcement. Memerlukan alokasi waktu yang lebih panjang dibandingkan dengan metode pembelajaran yang lain. Misal terbatasnya alat-alat laboratorium menyulitkan siswa untuk melihat dan mengamati serta akhirnya dapat menyimpulkan kejadian atau konsep tersebut. kerjasama. Pada saat penyajian kelas ini siswa harus benar-benar memperhatikan dan memahami materi yang disampaikan guru. Fungsi kelompok adalah untuk lebih mendalami materi bersama teman . Metode Team Games Tournament (TGT) Pembelajaran kooperatif model TGT adalah salah satu tipe atau model pembelajaran kooperatif yang mudah diterapkan. Ada 5 komponen utama dalam komponen utama dalam TGT yaitu: 1. karena akan membantu siswa bekerja lebih baik pada saat kerja kelompok dan pada saat game karena skor game akan menentukan skor kelompok. jenis kelamin dan ras atau etnik. Penyajian kelas Pada awal pembelajaran guru menyampaikan materi dalam penyajian kelas.

“Great Team” apabila rata-rata mencapai 40-45 dan “Good Team” apabila rata-ratanya 30-40.7-50 Pembelajaran Inovatif kelompoknya dan lebih khusus untuk mempersiapkan anggota kelompok agar bekerja dengan baik dan optimal pada saat game. Team recognize (penghargaan kelompok) Guru kemudian mengumumkan kelompok yang menang. Skor ini yang nantinya dikumpulkan siswa untuk turnamen mingguan. Turnamen Biasanya turnamen dilakukan pada akhir minggu atau pada setiap unit setelah guru melakukan presentasi kelas dan kelompok sudah mengerjakan lembar kerja. 3. Turnamen pertama guru membagi siswa ke dalam beberapa meja turnamen. Siswa memilih kartu bernomor dan mencoba menjawab pertanyaan yang sesuai dengan nomor itu. Siswa yang menjawab benar pertanyaan itu akan mendapat skor. 4. Team mendapat julukan “Super Team” jika rata-rata skor 45 atau lebih. . tiga siswa selanjutnya pada meja II dan seterusnya. masing-masing team akan mendapat sertifikat atau hadiah apabila rata-rata skor memenuhi kriteria yang ditentukan. Kebanyakan game terdiri dari pertanyaan-pertanyaan sederhana bernomor. Tiga siswa tertinggi prestasinya dikelompokkan pada meja I. Game Game terdiri dari pertanyaan-pertanyaan yang dirancang untuk menguji pengetahuan yang didapat siswa dari penyajian kelas dan belajar kelompok. 5.

Pembelajaran Inovatif 7-51 BAB III PEMBELAJARAN 2 Pada pembelajaran 2 ini peserta PLPG diminta untuk membuat / merevisi RPP yang sudah disiapkan. . peserta dari kelompok lain memberikan masukan dan tanggapan untuk perbaikan. Saudara perlu membuat anggapan situasi dan kondisi siswa sehingga perlu dipilih model pembelajaran tersebut. Setiap kelas dibagi menjadi beberapa kelompok. Perwakilan kelompok peserta PLPG diminta untuk mendemonstrasikan KBM menggunakan salah satu RPP dikelompoknya sebagai acuan. Setelah selesai KBM. Komentar dan saran dari pengajar diberikan setelah selesai diskusi antar kelompok tersebut. Evaluasi dilakukan langsung saat KBM dengan lembar observasi/penilaian yang sudah disiapkan. sedangkan kelompok demonstrator/penyaji menanggapi masukan dari peserta kelompok lain. RPP tersebut sudah dilengkapi dengan model pembelajaran yang akan digunakan.

c. d. praktek mengajar. SOAL TEST Petunjuk: Pilih salah satu jawaban yang betul. Cara mengajar guru. Penekanan pada ketuntasan materi pelajaran. Guru. b. Perkembangan model pembelajaran. Cooperative Script. Cooperative Script. e. Problem Solving. Model pembelajaran yang meminta siswa untuk mengurutkan dan menjelaskan gambar setelah guru menyampaikan materi adalah: a. Metode Jigsaw. Siswa. b. Metode Jigsaw. Menekankan transfer pengetahuan dari guru ke siswa. c. Proses pembelajaran dan penilaian dilakukan secara terpisah. . Cara belajar siswa. Kurikulum. d. Model pembelajaran yang mengedepankan kerjasama sesama guru serta melakukan perencanaan. c. Lesson Study. Inquiry. b. Penekanan pada pencapaian kompetensi. Pemilihan model pembelajaran sangat bergantung pada: a. c. Sarana-prasarana. 4. e. Perkembangan teknologi informasi sangat mempengaruhi: a. Lebih menekankan pada penguasaan materi. b. Perkembangan bahan ajar. observasi Refleksi/kritikan terhadap pembelajaran adalah: a. Snowball Throwing. e. Semuanya benar. 3. SCL adalah salah satu inovasi di bidang pendidikan yang bercirikan: a. Picture and Picture. e. Semuanya benar. b. d. 5. c.7-52 Pembelajaran Inovatif BAB IV PENUTUP A. d. 2. Snowball Throwing. d. 1. e.

Model pembelajaran dimana guru membagi topik tertentu menjadi beberapa subtopik. adalah: a. intuitif dan bekerja atas dasar inisiatif sendiri. merangsang perkembangan kemajuan berfikir siswa untuk menyelesaikan masalah yang dihadapi dengan tepat. d. Metode Jigsaw. Problem Solving. Lesson Study. Model pembelajaran yang menggunakan dipasangkan/diurutkan menjadi urutan logis. Picture and Picture. e. Picture and Picture. Model pembelajaran yang mempunyai kelebihan mendorong siswa berpikir secara ilmiah. e. adalah: a. setiap anggota bertanggungjawab terhadap penguasaan setiap subtopik. Inquiry. adalah: a. Role Playing. b. 9. 8. Metode Jigsaw. Inquiry. e. Metode Jigsaw. c. d. 7. e. Inquiry. memecahkan masalah yang dihadapi secara realistis. c. b. kreatif. menumbuhkan sikap objektif. Model pembelajaran dengan cara membuat pertanyaan yang dituliskan pada kertas lalu diberikan pada ketua kelompok untuk dilempar ke siswa lain untuk dijawab adalah: a. jujur dan terbuka. adalah: a. berpikir dan bertindak kreatif. Snowball Throwing. Metode Jigsaw. Role Playing. d. c. Cooperative Script. Snowball Throwing. Lesson Study. e. c. c. Inquiry.Pembelajaran Inovatif 7-53 6. gambar dan 10. Problem Solving. . Problem Solving. Model pembelajaran yang mempunyai keunggulan antara lain. Metode Jigsaw. Cooperative Script. b. Inquiry. Picture and Picture. b. d. selanjutnya membagi siswa ke dalam kelompok belajar kooperatif. b. d. Role Playing.

Buat RPP ringkas untuk mata pelajaran tertentu menggunakan satu atau lebih model pembelajaran inovatif yang bapak/ibu anggap sesuai dengan mapel tersebut. Perwakilan kelompok peserta diminta untuk mendemonstrasikan KBM menggunakan RPP yang telah dibuat. 1. Setiap kelas dibagi menjadi beberapa kelompok. tetapi bila saudara baru mencapai < 85%. 3. apa kelemahan dan keunggulannya. pelajari kembali materinya mulai dari langkah awal sampai selesai. B. . Bila mencapai > 85% teruskan pada kegiatan 2 berikutnya. Apakah telah mencapai > 85. Hitung kemampuan daya serap saudara dengan menghitung persentase jawaban yang benar. Evaluasi dilakukan langsung saat KBM simulasi dengan lembar observasi. karena telah dinyatakan tuntas pada kegiatan 1. Jelaskan beberapa inovasi dalam bidang pendidikan yang bapak/ibu ketahui. UMPAN BALIK DAN TINDAK LANJUT Agar dapat mencapai kompetensi yang diharapkan. setelah mengerjakan test diharapkan untuk melakukan / mencocokkan dengan kunci jawaban. lihat kunci jawaban dan hitung persentase ketuntasan belajar saudara. Kerjakan kembali tes formatif. Jelaskan dampak perkembangan Ipteks pada inovasi bidang pendidikan dan inovasi di bidang pembelajaran.7-54 Pembelajaran Inovatif Tulis jawaban saudara pada kertas jawaban. 2.

L. Florida: Publishing Company Robert E. 2006. D. Teaching in further education. Salatiga: STAIN Salatiga Press ------. Model pembelajaran dengan pendekatan elearning untuk meningkatkan pemahaman perkuliahan mesin listrik ac. TE FT UNNES 10 Desember 2005. Rooijakkers.Gramedia Suwardi. Jakarta: Puskur Balitbang. Jakarta: PT. 1980.id. Falk. Pembelajaran. Oos M. Henry Ananta. 1982. Kurikulum berbasis kompetensi.: 2/22. 2002. Strategi belajar mengajar.B. Pengembangan Model Pembelajaran Kelas Rangkap Berbantuan Media Audio di Sekolah Dasar. Diunduh tanggal 1 Desember 2007. 2004. Okt 2006 Halaman: 162-168 John Vaizey.. Jakarta: PT. Anwas.com /2006/ 09/pembelajaran. Ad. Cassell Djamarah & Zain. Makalah Seminar nasional. Rineka Cipta. Jakarta: PT. FMIPA UNNES 28 Februari 2004. . Diunduh tanggal 1 Desember 2007. London: Educational Limited. Mengajar dengan sukses. www://learning-with-me-blogspot. 2006. 2005. Henry Ananta. 1988.Krieger Harjanto. Manajemen pembelajaran. Jurnal: Penelitian Pendidikan No. Jakata: PT. Perencanaan pengajaran. Penggunaan media belajar berbasis komputer untuk meningkatkan efisiensi dan efktifitas pembelajaran. Biology teaching methods. Rineka Cipta.1997. 2007.Pembelajaran Inovatif 7-55 DAFTAR PUSTAKA Balitbang Depdiknas. Gubnung Agung. Penerapan ide-ide inovatif pendidikan MIPA dalam seting penelitian./Vol. 1996. www:// depdiknas. Pendidikan di dunia modern.go. Makalah seminar Nasional. 1991. Curzon. Mohamad Nur.

BUKU AJAR PENILAIAN PEMBELAJARAN .

PEMBELAJARAN adalah proses interaksi peserta didik dengan pendidik dan sumber belajar pada suatu lingkungan belajar. yaitu pekerjaan guru saja.BAB I PENDAHULUAN A. Di bidang pendidikan. Pembelajaran merupakan bantuan yang diberikan pendidik agar dapat terjadi proses pemerolehan ilmu dan pengetahuan. Pembelajaran adalah proses untuk membantu peserta didik agar dapat belajar dengan baik. PENILAIAN (memperkirakan) PEMBELAJARAN nilainya hasil adalah suatu yang perbuatan dilakukan pembelajaran dalam suatu lingkungan belajar. serta pembentukan sikap dan kepercayaan pada peserta didik. juga dapat mempengaruhi perubahan sikap (aspek afektif). dalam lingkup yang terbatas hanyalah mencakup atas penilaian terhadap hasil belajar dan mengajar ( achievement ). Tingkat Satuan Pendidikan ( KTSP ) yang PENILAIAN KELAS menjadi pilar utamanya. Saat ini. dalam pelaksanaan Kurikulum berbasis kompetensi. menginterpretasikan informasi tersebut untuk membuat keputusankeputusan. Deskripsi PENILAIAN mengandung adalah suatu proses sistematis menganalisis. yang dan pengumpulan informasi. Pengajaran memberi kesan hanya sebagai pekerjaan satu pihak. serta keterampilan (aspek psikomotor) seseorang peserta didik. Sedangkan pembelajaran juga menyiratkan adanya interaksi antara guru dengan peserta didik. penguasaan kemahiran dan tabiat. suatu kegiatan guru yang PENILAIAN KELAS merupakan terkait dengan pengambilan keputusan . walaupun mempunyai konotasi yang berbeda. guru mengajar supaya peserta didik dapat belajar dan menguasai isi pelajaran hingga mencapai sesuatu objektif yang ditentukan (aspek kognitif). Dalam konteks pendidikan. Pembelajaran mempunyai pengertian yang mirip dengan pengajaran.

Karenanya. Dengan memahami serta mengaplikasikan TEKNIK PENILAIAN yang ada.D.8-2 Evaluasi Pembelajaran tentang pencapaian kompetensi atau hasil belajar peserta didik yang mengikuti proses pembelajaran tertentu. juga akan mampu memotivasi dan mengondisikan peserta didik untuk terus meningkatkan upaya dan prestasi belajarnya. Agar supaya diperoleh hasil pembelajaran yang efektif. yakni: Pertama. diperlukan data sebagai dasar pengambilan Pascasarjana Universitas Pendidikan Indonesia (UPI) Bandung ini menyatakan (BANDAR LAMPUNG. akan meningkatkan mutu kegiatan dan hasil belajarnya. Keempat. dan Kelima. Ph. berikan balikan (feedback) yang jelas dan spesifik atas hasil kerja peserta didik dan kinerja pendidik sendiri. bahwa salah satu keberhasilan pembelajaran bergantung pada efektivitas penilaian kelas yang dilakukan guru. Furqan. hal-hal berikut ini wajib diperhatikan oleh guru. dimana teknik penilaian tersebut memberikan . keputusan. Kedua. direktur Program Untuk itu. penilaian secara Ketiga. lakukan secara terus-menerus dengan kegiatan belajar secara terpadu. 29 Januari 2008). Sebaliknya. penilaian tersebut harus dirancang dan dilakukan secara sistematik dan terus-menerus sebagai strategi untuk meningkatkan mutu pembelajaran Penilaian kelas yang baik akan memberikan informasi yang bermanfaat bagi guru untuk meningkatkan efektivitas mengajarnya. setelah penilaian dirancang. gunakan berbagai metode dan teknik komplementer sehingga mampu memperoleh informasi yang objektif dan komprehensif. beri pengayaan bagi peserta didik yang yang tergolong cepat belajarnya. beri pengajaran remedial bagi mereka yang belum atau lemah menguasai materi. dalam Seminar Nasional Pendidikan (Seminasdik) di GSG Universitas Lampung. Prof. sebagai informasi yang diandalkan. merumuskan target perilaku yang jelas dan signifikan. Bagi peserta didik.

(2) pengayaan bagi peserta didik yang mencapai kriteria ketuntasan lebih . Beragam teknik penilaian dapat dilakukan untuk mengumpulkan informasi tentang kemajuan belajar peserta didik. maka teknik penilaiannya adalah penilaian tertulis. dan penugasan perseorangan atau kelompok. penggunaan portofolio. Penilaian kelas menghasilkan informasi tentang pencapaian kompetensi peserta didik yang dapat digunakan antara lain. contoh: • • • Apabila tuntutan indikator melakukan sesuatu. maka teknik penilaiannya adalah penilaian unjuk kerja (performance). dan penilaian diri. (1) perbaikan bagi peserta didik yang belum mencapai kriteria ketuntasan. Apabila tuntutan indikator memuat unsur penyelidikan. penilaian produk. baik yang berhubungan dengan proses belajar maupun hasil belajar. yaitu penilaian unjuk kerja. penilaian proyek. observasi. apakah dengan tes tertulis. tes praktek. Dalam memilih teknik penilaian harus mempertimbangkan ciri indikator.Evaluasi Pembelajaran 8-3 arah / tujuan yang jelas dan akhirnya akan bermuara pada tingkat keberhasilan peserta didiknya. penilaian tertulis. ada tujuh teknik penilaian yang dapat digunakan (dan akan dibahas dalam buku ajar ini) . Apabila tuntutan indikator berkaitan dengan pemahaman konsep. Berdasarkan indikator-indikator ini dapat ditentukan cara penilaian yang sesuai. penilaian sikap. Untuk itu. maka teknik penilaiannya adalah penilaian proyek. Penilaian kompetensi dasar dilakukan berdasarkan indikator-indikator pencapaian kompetensi yang memuat satu ranah atau lebih. Teknik pengumpulan informasi tersebut pada prinsipnya adalah cara penilaian kemajuan belajar peserta didik berdasarkan standar kompetensi dan kompetensi dasar yang harus dicapai.

penilaian tersebut merupakan ilmu yang bersifat aplikatif. dan mencoba melatih (membuat penilaian) dari setiap teknik penilaian sesuai dengan Teknik tugas/tanggungjawab-nya masing-masing di tempat kerjanya. dan ranah psikomotor. dan (5) penentuan kenaikan kelas. (3) perbaikan program dan proses pembelajaran. Ranah kognitif yang berhubungan dengan tes prestasi / hasil belajar memiliki 6 (enam) kompetensi. C. yang mencakup tiga ranah (domain). maka peserta / pemerhati diminta untuk membaca isi buku ajar ini mulai dari bab I hingga bab terakhir dengan seksama. (4) pelaporan. Prasyarat Untuk memahami dan mengaplikasikan teknik penilaian pembelajaran ini peserta / pemerhati diharapkan telah mengetahui permasalahan taksonomi Bloom. afektif berkaitan dengan minat dan sikap. . Petunjuk Belajar Setelah prasyarat di atas telah terpenuhi. ranah kognitif Ranah mengenai aspek intelektual atau fungsi fikir. yaknik ranah afektif.8-4 Evaluasi Pembelajaran cepat dari waktu yang disediakan. sedangkan ranah psikomotor mengarah pada aspek ketrampilan motorik. B. karenanya akan lebih berdaya guna dan berhasil guna apabila peserta / pemerhati bersedia untuk melatih diri (sebanyak-banyaknya dan sesering mungkin) sesuai dengan kebutuhan nya. ranah kognitif. dari yang sederhana hingga yang kompleks.

Indikator Pencapaian 1. menurut ranah yang terkait dengan penilaiannya. dengan mengingat taksonomi Bloom.Evaluasi Pembelajaran 8-5 D.mengidentifikasi teknik penilaian yang dipakai. menyimpulkan ciriciri masing-masing penilaian yang dikaji. Kompetensi dan Indikator Standar Kompetensi Mempraktikkan teknikteknik penilaian pembelajaran yang diketahui sesuai dengan bidang kajiannya Kompetensi Dasar Mempraktikkan setiap teknik penilaian pembelajaran yang dikaji. 2. 3.membedakan alat penilaian. ranah apa yang menjadi sasarannya. sesuai dengan aspek / indikator yang akan dinilai. pada bidangnya masing-masing. .

B. 2. Pengertian Penilaian unjuk kerja (kinerja atau performance) merupakan penilaian yang dilakukan dengan mengamati kegiatan peserta didik dalam melakukan sesuatu. Kompetensi dan Indikator Standar Kompetensi Mengkaji dan mempraktikkan teknik penilaian unjuk kerja Kompetensi Dasar Mempraktikkan teknik penilaian unjuk kerja sesuai bidang tugasnya Indikator Pencapaian 1. yang tepat dan sesuai dengan permasalahannya.mengidentifikasi soal / permasalahan yang ada pada bidang tugasnya. bermain peran. Cara penilaian ini dianggap lebih otentik daripada tes tertulis karena apa yang dinilai lebih mencerminkan kemampuan peserta didik yang sebenarnya. Uraian Materi 1. membaca puisi / deklamasi dll. praktek OR.BAB II KEGIATAN BELAJAR 1 ( PENILAIAN UNJUK KERJA ) A. seperti: praktek di laboratorium. Kelengkapan dan ketepatan aspek yang akan dinilai dalam kinerja tersebut. yang akan dapat dilakukan penilaian.melakukan penilaian dengan alat penilaian unjuk kerja. Penilaian unjuk kerja perlu mempertimbangkan hal-hal berikut: a. memainkan alat musik. Penilaian ini cocok digunakan untuk menilai ketercapaian kompetensi yang menuntut peserta didik melakukan tugas tertentu. bernyanyi. praktek sholat. . b. presentasi. langkah-langkah kinerja yang diharapkan dilakukan peserta didik untuk menunjukkan kinerja dari suatu kompetensi.

Kemampuan-kemampuan menyelesaikan tugas khusus yang diperlukan untuk d. Untuk menilai kemampuan berbicara peserta didik. . sehingga semua dapat diamati. misalnya. gambaran kemampuan peserta didik akan lebih utuh. e. peserta didik tidak memperoleh nilai. dan melakukan wawancara. Jika tidak dapat diamati. Kelemahan cara ini adalah penilai hanya mempunyai dua pilihan mutlak. Dengan demikian. perlu dilakukan pengamatan atau observasi berbicara yang beragam. misalnya benar-salah. Untuk mengamati unjuk kerja peserta didik dapat menggunakan alat atau instrumen berikut: a. bercerita. Dengan demikian tidak terdapat nilai tengah. berpidato. Namun daftar cek lebih praktis jika digunakan mengamati subjek dalam jumlah besar. baiktidak baik. seperti: diStandar Kompetensiusi dalam kelompok kecil. dapat diamati-tidak dapat diamati. peserta didik mendapat nilai apabila kriteria penguasaan kemampuan tertentu dapat diamati oleh penilai. Teknik Penilaian Unjuk Kerja Pengamatan unjuk kerja perlu dilakukan dalam berbagai konteks untuk menetapkan tingkat pencapaian kemampuan tertentu. Upayakan kemampuan yang akan dinilai tidak terlalu banyak. Dengan menggunakan daftar cek.Evaluasi Pembelajaran 8-7 c. Daftar Cek ( Check-list ) Penilaian unjuk kerja dapat dilakukan dengan menggunakan daftar cek (baik-tidak baik). Kemampuan yang akan dinilai diurutkan berdasarkan urutan yang akan diamati 2.

Untuk memperkecil faktor subjektivitas. agar hasil penilaian lebih akurat. perlu dilakukan penilaian oleh lebih dari satu orang. 2 = cukup kompeten. Misalnya: 1 = tidak kompeten.8-8 Evaluasi Pembelajaran b. . Skala penilaian terentang dari tidak sempurna sampai sangat sempurna. karena pemberian nilai secara kontinum di mana pilihan kategori nilai lebih dari dua. Skala Penilaian ( Rating Scale ) Penilaian unjuk kerja yang menggunakan skala penilaian memungkinkan penilai memberi nilai tengah terhadap penguasaan kompetensi tertentu. 3 = kompeten dan 4 = sangat kompeten.

Evaluasi Pembelajaran 8-9 C. Latihan Cobalah renungkan dan pikirkan hal-hal apa yang ada pada bidang tugas anda (di tempat kerja). Alat dan Bahan Kertas dan alat tulis seperlunya guna membuat borang ”Chek List” dan borang ”Rating Scale” yang akan dipakai. yang sekiranya dapat dilakukan penilaian dengan teknik penilaian unjuk kerja ini. dan kemudian kerjakan apa yang ada pada lembar kegiatan berikut ini. . D. Catat dan identifikasilah permasalahan tersebut. maka persiapkan : 1. Lembar Kegiatan Peserta PLPG Setelah dicatat permasalahan yang ada dan akan dinilai dengan teknik penilaian unjuk kerja.

Rangkuman Penilaian unjuk kerja merupakan penilaian yang dilakukan dengan mengamati kegiatan peserta didik dalam melakukan sesuatu. Cara penilaian ini dianggap lebih otentik daripada tes tertulis karena apa yang dinilai lebih mencerminkan kemampuan peserta didik yang sebenarnya. F. Pernyataan a. Kemampuan yang akan dinilai diurutkan berdasarkan urutan yang akan diamati. Bagaimana kesimpulannya. Pilihlah jawaban yang paling tepat (dari alternatif yang tersedia). c semua benar. alat penilaiannya dapat dipakai bentuk chek list atau rating scale. d. . dan apa maknanya ? E. Kemampuan-kemampuan khusus yang diperlukan untuk menyelesaikan tugas. Hitunglah biji (score) perolehannya. antara lain: a. Langkah-langkah kinerja yang diharapkan dilakukan siswa untuk menunjukkan kinerja dari suatu kompetensi. Cermati permasalahan / soal yang ditulis. 1. Prasyarat Indikator atau aspek dari permasalah atau soal yang ditulis telah sesuai dengan teknik penilaian unjuk kerja yang dipilih. b. b. Penilaian ini cocok digunakan untuk menilai ketercapaian kompetensi yang menuntut peserta didik melakukan tugas tertentu. Tes Formatif A. dan lakukan penilaian atas masing-masing unsur sesuai dengan kondisi sebenarnya. c. Langkah Kegiatan a.8-10 Evaluasi Pembelajaran 2. Dengan melihat aspek yang dinilai. atas pertanyaan / pernyataan berikut ini. Tuliskan aspek-aspek tersebut dalam borang yang telah dipersiapkan. Hal-hal yang perlu dipertimbangkan dalam penilaian unjuk kerja. e. Identifikasi aspek-aspek yang dinilai. 3. d. sesuai dengan ketentuan yang ada. b. c.

. Beragam teknik penilaian dapat dilakukan untuk mengumpulkan informasi tentang kemajuan belajar siswa.. a.Evaluasi Pembelajaran 8-11 2. afektif b. ketiganya dapat dilakukan. dapat diukur c... dapat diamati b. apa yang dinilai menunjukkan perilaku tertentu dari peserta didik c. Penilaian observasi langsung c.. Penilaian kompetensi dasar dilakukan berdasarkan indikatorindikator pencapaian kompetensi yang memuat ranah ... a. cara analitik. berpidato c. Penilaian unjuk kerja yang memungkinkan penilai memberi nilai tengah terhadap penguasaan kompetensi tertentu yaitu menggunakan . catatan harian c... a. 4.. 6. apa yang dinilai sesuai dengan standar kompetensiyang diinginkan d. 5. kognitif c. Penilaian unjuk kerja yang dilakukan dengan cara daftar cek. baik yang berhubungan dengan proses belajar maupun hasil belajar.. apa yang dinilai memberikan skore sebenarnya dari kemampuan peserta didik... apa yang dinilai lebih mencerminkan kemampuan peserta didik yang sebenarnya b. dapat dirasakan d. rating scale d. melakukan wawancara d.... kecuali: a. a. Penilaian unjuk kerja b.. a. check list b.. distandar kompetensiusi dalam kelompok kecil b. dapat diraba.. Teknik-teknik penilain tersebut adalah sebagai berikut. kecuali apabila kemampuan peserta didik yang . Untuk menilai kemampuan berbicara dapat dilakukan pengamatan melalui .. ketiganya benar 7. karena . Cara penilaian unjuk kerja dianggap lebih otentik daripada penilaian tertulis.. psikomotor d. Penggunaan portofolio 3. Penilaian sikap d.

10. daftar cek c. a. maka alat penilai yang tidak tepat dipergunakan adalah . teknik penilaian tertulis c. 9.. Jika peserta didik melakukan praktik di laboratorium. Bagaimana karakteristik dari teknik penilaian unjuk kerja yang anda ketahui ? 3. catatan harian d.8-12 Evaluasi Pembelajaran 8. mengumpulkan informasi tentang kemajuan belajar peserta didik b... ketiganya benar. mengumpulkan informasi tentang kemampuan peserta didik selama dalam proses pembelajaran c. Kemampuan ketrampilan peserta didik akan kurang tepat apabila dinilai dengan a. B.. teknik penilaian kinerja b... Kemampuan apa sajakah yang dapat dinilai dengan teknik penilaian kinerja ? . Jawablah pertanyaan-pertanyaan di bawah ini ! 1.. Jelaskan secara singkat pengertian dari penilaian pembelajaran ! Berikan beberapa contoh di bidang kerja anda ! 2. lembar pengamatan. Teknik penilaian dimaksudkan untuk . teknik penilaian sikap d. teknik penilaian proyek. a. skala rentang b.. mengumpulkan informasi tentang hasil belajar peserta didik d..

Adapun komponen konatif adalah kecenderungan untuk berperilaku atau berbuat dengan cara-cara tertentu berkenaan dengan kehadiran objek sikap. komponen kognitif.mengidentifikasi soal / permasalahan yang ada pada bidang tugasnya. Pengertian Sikap bermula dari perasaan (suka atau tidak suka) yang terkait dengan kecenderungan bertindak seseorang dalam merespon sesuatu/objek. Komponen afektif adalah perasaan yang dimiliki oleh seseorang atau penilaiannya terhadap sesuatu objek.BAB III KEGIATAN BELAJAR 2 ( PENILAIAN SIKAP ) A.melakukan penilaian dengan teknik penilaian sikap. yakni: komponen afektif. Kompetensi dan Indikator Standar Kompetensi Mengkaji dan mempraktikkan teknik penilaian sikap Kompetensi Dasar Mempraktikkan teknik penilaian sikap sesuai bidang tugasnya Indikator Pencapaian 1. yang dapat dilakukan penilaian. Sikap juga sebagai ekspresi dari nilai-nilai atau pandangan hidup yang dimiliki oleh seseorang. Sikap dapat dibentuk untuk terjadinya perilaku atau tindakan yang diinginkan. dan komponen konatif. Komponen kognitif adalah kepercayaan atau keyakinan seseorang mengenai objek. 2. B. Uraian Materi 1. Sikap terdiri dari tiga komponen. objek sikap yang perlu dinilai dalam proses pembelajaran berbagai mata pelajaran adalah sebagai berikut. . yang tepat dan sesuai dengan pokok permasalahannya. Secara umum.

• Sikap terhadap proses pembelajaran. sehingga dapat mencapai hasil belajar yang maksimal. Proses pembelajaran yang menarik. Misalnya kasus atau masalah lingkungan hidup. Proses pembelajaran di sini mencakup suasana pembelajaran. berkaitan dengan materi Biologi atau kimia.8-14 Evaluasi Pembelajaran • Sikap terhadap materi pelajaran. • Sikap berhubungan dengan kompetensi afektif kurikulum yang relevan dengan mata pelajaran. peserta didik juga perlu memiliki sikap positif terhadap proses pembelajaran yang berlangsung. nyaman dan menyenangkan dapat menumbuhkan motivasi belajar peserta didik. • Sikap berkaitan dengan nilai-nilai atau norma-norma tertentu berhubungan dengan suatu materi pelajaran. peserta didik perlu memiliki sikap positif terhadap guru. Dengan sikap`positif dalam diri peserta didik akan tumbuh dan berkembang minat belajar. peserta didik memiliki sikap positif terhadap program perlindungan satwa liar. metodologi. dan teknik pembelajaran yang digunakan. peserta didik memiliki sikap negatif terhadap kegiatan ekspor kayu glondongan ke luar negeri. Dengan demikian. peserta didik juga perlu memiliki sikap yang tepat. strategi. lintas . dan akan lebih mudah menyerap materi pelajaran yang diajarkan. peserta didik yang memiliki sikap negatif terhadap guru/pengajar akan sukar menyerap materi pelajaran yang diajarkan oleh guru tersebut. Misalnya. • Sikap terhadap guru/pengajar. Dalam kasus yang lain. akan lebih mudah diberi motivasi. peserta didik yang tidak memiliki sikap positif terhadap guru akan cenderung mengabaikan hal-hal yang diajarkan. peserta didik perlu memiliki sikap positif terhadap materi pelajaran. yang dilandasi oleh nilai-nilai positif terhadap kasus lingkungan tertentu (kegiatan pelestarian/kasus perusakan lingkungan hidup).

Evaluasi Pembelajaran 8-15 2. dan laporan pribadi. Oleh karena itu. Hasil observasi dapat dijadikan sebagai umpan balik dalam pembinaan. Misalnya orang yang biasa minum kopi dapat dipahami sebagai kecenderungannya yang senang kepada kopi. Observasi perilaku Perilaku seseorang pada umumnya menunjukkan kecenderungan seseorang dalam sesuatu hal. a. Observasi perilaku di sekolah dapat dilakukan dengan menggunakan buku catatan khusus tentang kejadian-kejadian berkaitan dengan peserta didik selama di sekolah. . guru dapat melakukan observasi terhadap peserta didik yang dibinanya. pertanyaan langsung. Teknik Penilaian Sikap Penilaian sikap dapat dilakukan dengan beberapa cara atau teknik. Teknik-teknik tersebut antara lain: observasi perilaku. Teknik-teknik tersebut secara ringkas dapat diuraikan sebagai berikut. Berikut contoh format buku catatan harian.

Selain itu. . Berikut contoh format Penilaian Sikap (untuk mata diklat adaptif). dalam observasi perilaku dapat juga digunakan daftar cek (Checklist) yang memuat perilaku-perilaku tertentu yang diharapkan muncul dari peserta didik pada umumnya atau dalam keadaan tertentu. selain bermanfaat untuk merekam dan menilai perilaku peserta didik sangat bermanfaat pula untuk menilai sikap peserta didik serta dapat menjadi bahan dalam penilaian perkembangan peserta didik secara keseluruhan. 2006 Catatan dalam lembaran buku tersebut.8-16 Evaluasi Pembelajaran BUKU CATATAN HARIAN TENTANG PESERTA DIDIK ( nama sekolah ) Mata Pelajaran : ___________________ Kelas : ___________________ Program : ___________________ Tahun Pelajaran : ___________________ Nama Guru : ___________________ Jakarta.

Pertanyaan langsung Kita juga dapat menanyakan secara langsung tentang sikap seseorang berkaitan dengan sesuatu hal. Berdasarkan jawaban dan reaksi lain yang tampil dalam memberi jawaban dapat dipahami sikap peserta didik itu terhadap objek sikap. bagaimana tanggapan peserta didik tentang kebijakan yang baru diberlakukan di sekolah mengenai "Peningkatan Ketertiban". atau hal yang . keadaan. Misalnya.Evaluasi Pembelajaran 8-17 b. Laporan pribadi Melalui penggunaan teknik ini di sekolah. peserta didik diminta membuat ulasan yang berisi pandangan atau tanggapannya tentang suatu masalah. c. Dalam penilaian sikap peserta didik di sekolah. guru juga dapat menggunakan teknik ini dalam menilai sikap dan membina peserta didik.

dan kemudian kerjakan apa yang ada pada lembar kegiatan berikut ini. C. Latihan Cobalah renungkan dan pikirkan hal-hal apa yang ada pada bidang tugas anda (di tempat kerja). estetika. dan jasmani. kewarganegaraan dan kepribadian. peserta didik diminta menulis pandangannya tentang "Kerusuhan Antar etnis" yang terjadi akhir-akhir ini di Indonesia. yang sekiranya dapat dilakukan penilaian dengan teknik penilaian sikap ini. ada beberapa program keahlian yang mensyaratkan sikap melakukan pekerjaan sebagai salah satu faktor penentu. Selain itu untuk menentukan siswa SMK dinyatakan kompeten atau belum kompeten. termasuk kelompok mata pelajaran agama dan akhlak mulia. Dari ulasan yang dibuat oleh peserta didik tersebut dapat dibaca dan dipahami kecenderungan sikap yang dimilikinya. .8-18 Evaluasi Pembelajaran menjadi objek sikap. Untuk menilai perubahan perilaku atau sikap peserta didik secara keseluruhan. semua catatan dapat dirangkum dengan menggunakan Lembar Pengamatan berikut. Catat dan identifikasilah permasalahan tersebut. Misalnya.

Hitunglah biji (score) perolehannya. Cermati permasalahan / soal yang ditulis. dan apa maknanya ? E. b. Sikap tersebut terdiri dari tiga komponen. Lembar Kegiatan Peserta PLPG Setelah dicatat permasalahan yang ada dan akan dinilai dengan teknik penilaian sikap. Sikap juga sebagai ekspresi dari nilai-nilai atau pandangan hidup yang dimiliki oleh seseorang. Sikap terhadap guru/pengajar. 2. objek sikap yang perlu dinilai dalam proses pembelajaran berbagai mata pelajaran adalah sebagai berikut: (1). Alat dan Bahan Kertas dan alat tulis seperlunya guna membuat borang- borang yang diperlukan dan akan dipakai dalam penilaian sikap tersebut. e. Bagaimana kesimpulannya. d. 3. Rangkuman Sikap bermula dari perasaan (suka atau tidak suka) yang terkait dengan kecenderungan bertindak seseorang dalam merespon sesuatu/objek.Evaluasi Pembelajaran 8-19 D. Sikap dapat dibentuk untuk terjadinya perilaku atau tindakan yang diinginkan. komponen kognitif. c. dan lakukan penilaian atas masing-masing unsur sesuai dengan kondisi sebenarnya. Identifikasi aspek-aspek yang dinilai. Langkah Kegiatan a. Tuliskan aspek-aspek tersebut dalam borang yang telah dipersiapkan. (2). sesuai dengan ketentuan yang ada. Prasyarat Indikator atau aspek dari permasalah atau soal yang ditulis telah sesuai dengan teknik penilaian sikap yang dipilih. dan komponen konatif. maka persiapkanlah : 1. Secara umum. Sikap terhadap materi pelajaran. . yakni: komponen afektif.

Sikap berhubungan dengan kompetensi afektif lintas kurikulum yang relevan dengan mata pelajaran. Sikap berhubungan dengan kompetensi afektif lintas kurikulum yang relevan dengan mata pelajaran. antara lain: observasi perilaku. Sikap berkaitan dengan nilai-nilai atau norma-norma tertentu berhubungan dengan suatu materi pelajaran.. Penilaian Diri c.. Penilaian Sikap b.Pilihlah jawaban yang paling tepat (dari alternatif yang tersedia). Penilaian Kelas d. F. (4). Penilaian Portofolio 4. atas pertanyaan / pernyataan berikut ini. Sikap terhadap proses pembelajaran. Sikap terhadap materi pelajaran. dan (5). Penilaian sikap dapat dilakukan dengan beberapa cara. a. Penilaian unjuk kerja b. Teknik-teknik penilain tersebut adalah sebagai berikut.. Beragam teknik penilaian dapat dilakukan untuk mengumpulkan informasi tentang kemajuan belajar siswa. Penilaian sikap d. kecuali: a... Sikap berkaitan dengan nilai-nilai atau norma-norma tertentu berhubungan dengan suatu materi pelajaran.. Penilaian observasi langsung c. 3... yang merupakan . b.. Sikap terhadap guru dan siswa c. 1.. Penggunaan portofolio 2.8-20 Evaluasi Pembelajaran (3). keyakinan seseorang mengenai obyek c. baik yang berhubungan dengan proses belajar maupun hasil belajar. kecenderungan berperilaku terhadap suatu obyek d. .. Salah satu komponen dalam penilaian sikap yaitu komponen konatif . Tes Formatif A. Kegiatan guru yang terkait dengan pengambilan keputusan tentang pencapaian kompetensi atau hasil belajar peserta didik yang mengikuti proses pembelajaranadalah . dan laporan pribadi. d. Berikut adalah objek sikap yang perlu dinilai dalam proses pembelajaran. pertanyaan langsung. kecenderungan untuk berperilaku dengan cara tertentu berkenaan dengan kehadiran suatu obyek. perasaan yang dimiliki oleh seseorang terhadap suatu obyek b. kecuali: a.. a...

Peserta didik perlu memiliki ... check list 8... B.. a.. b. tes tertulis 6. sikap apriori c. Penilaian Portofolio b... sikap apatis 9. Mengapa lembar pengamatan dapat dipergunakan untuk penilaian sikap secara menyeluruh ? Jelaskan secara singkat ! .. Penilaian Kelas d.. a. sikap apriori c..Evaluasi Pembelajaran 8-21 5. terhadap guru. Jelaskan secara singkat ciri-ciri penilaian sikap ! 2. sikap positif b.. a. Sikap bermula dari perasaan yang terkait dengan kecenderungan seseorang bertindak dalam merespon suatu obyek. yakni dengan menggunakan bantuan alat penilai : a. daftar cek c... dimana kesemua catatan dapat terangkaum.. Mengapa dalam evaluasi pembelajaran dianjurkan untuk memadukan berbagai teknik penilaian? 3.. 10... Penilaian Pembelajaran c. skala rentang d. Penilaian Tertulis. Ketiga-tiganya benar... sikap adaptif d...... sikap positif d. Menurut saya ………. Jawablah pertanyaan-pertanyaan di bawah ini ! 1... maka sebaiknya menggunakan a.. yang menjadi pilar utamanya adalah . Sikap sebagai ekspresi dari nilai-nilai atu pandangan hidup yang dimiliki oleh seseorang. catatan harian b.. sikap pesimistis 7... Untuk menilai perubahan perilaku atau sikap peserta didik secara keseluruhan.. terhadap materi pelajaran. a. dalam pelaksanaan Kurikulum Tingkat Satuan Pendidikan ( KTSP ) yang berbasis kompetensi. c. Penilaian atas perilaku seorang peserta didik dapat dilakukan guru dengan cara melakukan observasi perilaku. rating scale d. Saat ini.... Peserta didik perlu memiliki . lembar pengamatan c... Sikap dapat dibentuk untuk terjadinya perilaku yang diinginkan.... buku harian b. sikap adaptif b.... d.

BAB IV KEGIATAN BELAJAR 3 ( PENILAIAN TERTULIS )
A. Kompetensi dan Indikator Standar Kompetensi Mengkaji dan mempraktikkan teknik penilaian tertulis Kompetensi Dasar Indikator Pencapaian

1.mengidentifikasi soal Mempraktikkan teknik penilaian tertulis sesuai / permasalahan yang ada pada bidang bidang tugasnya tugasnya, yang akan dapat dilakukan penilaian. 2.melakukan penilaian dengan alat penilaian tertulis, yang tepat dan sesuai dengan permasalahannya.

B. Uraian Materi 1. Pengertian Penilaian secara tertulis dilakukan dengan tes tertulis. Tes Tertulis merupakan tes dimana soal dan jawaban yang diberikan kepada peserta didik dalam bentuk tulisan. Dalam menjawab soal peserta didik tidak selalu merespon dalam bentuk menulis jawaban tetapi dapat juga dalam bentuk yang lain seperti memberi tanda, mewarnai, menggambar dan lain sebagainya. 2. Teknik Penilaian Ada dua bentuk soal tes tertulis, yaitu: a. memilih jawaban, yang dibedakan menjadi: 1). pilihan ganda 2). dua pilihan (benar-salah, ya-tidak) 3). menjodohkan 4). sebab-akibat

Evaluasi Pembelajaran 8-23

b. mensuplai jawaban, dibedakan menjadi: 1). isian atau melengkapi 2). jawaban singkat atau pendek 3). soal uraian Dari berbagai alat penilaian tertulis, tes memilih jawaban benarsalah, isian singkat, menjodohkan dan sebab akibat merupakan alat yang hanya menilai kemampuan berpikir rendah, yaitu kemampuan mengingat (pengetahuan). Tes pilihan ganda dapat digunakan untuk menilai kemampuan berpikir tinggi dengan cakupan materi yang luas. Peserta didik tidak mengembangkan sendiri

jawabannya, sehingga cenderung hanya memilih jawaban yang benar dan jika peserta didik tidak mengetahui jawaban yang benar, maka peserta didik akan menerka. Hal ini menimbulkan

kecenderungan peserta didik tidak belajar untuk memahami pelajaran tetapi menghafalkan soal dan jawabannya. Selain itu tes bentuk pilihan ganda kurang mampu memberikan informasi yang cukup untuk dijadikan umpan balik guna mendiagnosis kelemahan peserta didik atau memodifikasi kegiatan pembelajaran. Karena itu kurang dianjurkan pemakaiannya dalam penilaian kelas yang otentik dan berkesinambungan. Namun tes bentuk tersebut banyak digunakan untuk penilaian keterampilan berbahasa yang dilakukan secara formal. Tes tertulis bentuk uraian adalah alat penilaian yang menuntut peserta didik untuk mengingat, memahami, dan mengorganisasikan gagasannya atau hal-hal yang sudah dipelajari. Peserta didik mengemukakan atau mengekspresikan gagasan tersebut dalam bentuk uraian tertulis dengan menggunakan kata-katanya sendiri. Alat ini dapat menilai berbagai jenis kompetensi, misalnya mengemukakan pendapat, berpikir logis, dan menyimpulkan. Kelemahan alat ini antara lain cakupan materi yang ditanyakan

8-24 Evaluasi Pembelajaran

terbatas dan membutuhkan waktu lebih banyak dalam mengoreksi jawaban. Dalam menyusun instrumen penilaian tertulis perlu

dipertimbangkan hal-hal berikut. a). Karakteristik mata pelajaran dan keluasan ruang lingkup materi yang akan diuji; b). materi, misalnya kesesuian soal dengan Standar Kompetensi, kompetensi dasar, dan indikator pencapaian pada kurikulum. c). konstruksi, misalnya rumusan soal atau pertanyaan harus jelas dan tegas. d). bahasa, misalnya rumusan soal tidak menggunakan kata/kalimat yang menimbulkan penafsiran ganda. Contoh Penilaian Tertulis a). Memilih jawaban (pilihan ganda)

C. Latihan Cobalah renungkan dan pikirkan hal-hal apa yang ada pada bidang tugas anda (di tempat kerja), yang sekiranya dapat dilakukan penilaian

Evaluasi Pembelajaran 8-25

dengan teknik penilaian tertulis ini.

Catat dan identifikasilah

permasalahan tersebut, dan kemudian kerjakan apa yang ada pada lembar kegiatan berikut ini.

D. Lembar Kegiatan Peserta PLPG Setelah dicatat permasalahan yang ada dan akan dinilai dengan teknik penilaian tertulis, maka persiapkan : 1. Alat dan Bahan Kertas dan alat tulis seperlunya guna membuat borang-borang yang diperlukan dan akan dipakai dalam penilaian tertulis nantinya. 2. Prasyarat Indikator atau aspek dari permasalah atau soal yang ditulis telah sesuai dengan teknik penilaian tertulis yang dipilih. 3. Langkah Kegiatan a. Cermati permasalahan / soal yang dicatat. b. Identifikasi aspek-aspek yang dinilai. c. Tuliskan aspek-aspek tersebut dalam borang yang telah dipersiapkan, dan lakukan penilaian atas masing-masing unsur sesuai dengan kondisi sebenarnya. d. Hitunglah biji (score) perolehannya, sesuai dengan ketentuan yang ada pada penilaian tertulis. e. Bagaimana kesimpulannya, dan apa maknanya ?

E. Rangkuman Penilaian secara tertulis dilakukan dengan tes tertulis. Tes Tertulis merupakan tes dimana soal dan jawaban yang diberikan kepada peserta didik dalam bentuk tulisan, seperti juga dalam bentuk : memberi tanda, mewarnai, menggambar dan lain sebagainya. Ada dua bentuk soal tes tertulis, yaitu: a. memilih jawaban, yang dibedakan menjadi: (1) pilihan ganda, (2) dua pilihan (benar-salah, ya-tidak), (3) menjodohkan, dan (4) sebab-akibat.

8-26 Evaluasi Pembelajaran

b. mensuplai jawaban, dibedakan menjadi: (1) isian atau melengkapi, (2)jawaban singkat atau pendek, dan (3) soal uraian. A. Tes Formatif A. Pilihlah jawaban yang paling tepat (dari alternatif yang tersedia), atas pertanyaan / pernyataan berikut ini. 1. Beragam teknik penilaian dapat dilakukan untuk mengumpulkan informasi tentang kemajuan belajar siswa, baik yang berhubungan dengan proses belajar maupun hasil belajar. Teknik-teknik penilain tersebut adalah sebagai berikut, kecuali: a. Penilaian unjuk kerja b. Penilaian sikap c. Penilaian observasi langsung d. Penggunaan tertulis 2. Dalam Soal tes tertulis peserta didik tidak selalu merespon dalam bentuk menulis jawaban tetapi dapat juga dalam bentuk yang lain seperti berikut, kecuali: a. Memberi tanda b. Mewarnai c. Membaca d. Menggambar 3. Tes tertulis dalam bentuk mensuplai jawaban dapat dibedakan, kecuali menjadi: a. multiple choice b. isian c. jawaban singkat d. uraian. 4. Tes ini dapat digunakan untuk menilai kemampuanberfikir tinggi ! a. tes sebab-akibat b. tes benar – salah c. tes menjodohkan d. tes pilihan ganda. 5. Tes tertulis bentuk ini merupakan alat penilaian yang menuntut peserta didik untuk mengingat, memahami, dan mengorganisasikan agasannya atau hal-hal yang telah dipelajarinya. a. jawaban singkat b. uraian c. isian d. pilihan ganda. 6. Dalam menyusun alat penilaian tertulis perlu dipertimbangkan halhal berikut, kecuali ......... a. jumlah item b. karakteristik mata pelajaran c. materi d. konstruksi

Evaluasi Pembelajaran 8-27

7. Tes pilihan ganda memiliki beberapa kekurangan diantaranya tersebut berikut ini, kecuali ......... a. peserta didik tidak mengembangkan sendiri jawabannya b. menimbulkan kecenderungan anak didik tidak belajar c. kurang dapat untuk memodifikasi kegiatan pembelajaran d. banyak digunakan untuk penilaian ketrampilan berbahasa secara formal. 8. Kelemahan tes tertulis bentuk uraian antara lain ..... a. peserta didik dapat mengekspresikan gagasan atau pendapatnya b. dapat menilai berbagai jenis kompetensi c. cakupan materi yang ditanyakan terbatas d. peserta didik dituntut untuk mengemukakan pendapatnya dengan kata-katanya sendiri. 9. Keberhasilan pembelajaran bergantung pada beberapa hal, kecuali a. efektifitas penilaian kelas b. cost benefit yang besar c. perancangan penilaian secara sistemasis d. perlakuan penilaian yang secara terus-menerus dan berkesinambungan. 10. Penilaian kelas yang baik akan memberikan informasi yang bermanfaat, kecuali a. bagi orang tua, dapat meningkatkan gairah kerjanya agar dapat membiayai sekolah anak-anaknya b. bagi guru, dapat meningkatkan efektifitas mengajarnya c. bagi peserta didik, akan meningkatkan kualitas kegiatan/hasil belajarnya d. mampu memotivasi anak didik meningkatkan terus upaya belajarnya. B. Jawablah pertanyaan-pertanyaan di bawah ini ! 1. Dalam praktik pembelajaran, paling banyak dipergunakan teknik penilaian tertulis. Setujukah anda atas pernyataan tersebut ? Mengapa demikian ? 2. Adakah teknik penilaian yang dapatdipergunakan untuk menilai berbagai kompetensi ? Berikan alasannya ! 3. Berikan alasan! Mengapa Teknik Penilaian Tertulis, khususnya alat penilaian tes pilihan ganda kurang dianjurkan pemakaiannya dalam penilaian pembelajaran yang otentik dan berkesinambungan ?

8-28 Evaluasi Pembelajaran

BAB V KEGIATAN BELAJAR 4 ( PENILAIAN PROYEK dan PENILAIAN PRODUK )
A. Kompetensi dan Indikator Standar Kompetensi Mengkaji dan mempraktikkan teknik penilaian proyek maupun penilaian produk Kompetensi Dasar Mempraktikkan teknik penilaian proek dan penilaian produk yang sesuai bidang tugasnya Indikator Pencapaian 1.mengidentifikasi soal / permasalahan yang ada pada bidang tugasnya, yang akan dapat dilakukan penilaian. 2.melakukan penilaian dengan alat penilaian proyek, yang tepat dan sesuai dengan permasalahannya. 3.melakukan penilaian dengan alat penilaian produk dengan ketetuan yang ada.

B. Uraian Materi 1. PENILAIAN PROYEK a. Pengertian Penilaian proyek merupakan kegiatan penilaian terhadap suatu tugas yang harus diselesaikan dalam periode/waktu tertentu. Tugas tersebut berupa suatu investigasi sejak dari perencanaan, pengumpulan data, pengorganisasian, pengolahan dan penyajian produk. Penilaian proyek dapat digunakan, diantaranya untuk mengetahui pemahaman dan pengetahuan dalam bidang tertentu, kemampuan peserta didik mengaplikasikan pengetahuan tersebut dalam penyelidikan tertentu, dan kemampuan peserta didik dalam menginformasikan subyek tertentu secara jelas. Dalam penilaian proyek setidaknya ada 3 (tiga) hal yang perlu dipertimbangkan yaitu: • Kemampuan pengelolaan

Evaluasi Pembelajaran 8-29

Kemampuan peserta didik dalam memilih topik dan mencari informasi serta dalam mengelola waktu pengumpulan data dan penulisan laporan. • Relevansi Kesesuaian dengan mata pelajaran/program keahlian, dalam hal ini mempertimbangkan tahap pengetahuan, keterampilan, dan pemahaman dalam pembelajaran. • Keaslian Proyek yang dilakukan peserta didik harus merupakan hasil karyanya, dengan mempertimbangkan kontribusi guru, du/di, penilai pada proyek peserta didik, dalam hal ini petunjuk atau dukungan. b. Teknik Penilaian Proyek Penilaian cara ini dapat dilakukan mulai perencanaan, proses selama pengerjaan tugas, dan terhadap hasil akhir proyek. Dengan demikian guru perlu menetapkan hal-hal atau tahapan yang perlu dinilai, seperti penyusunan disain, pengumpulan data, analisis data, kemudian menyiapkan laporan tertulis, penyajian hasil/produk. Laporan tugas atau hasil penelitiannya juga dapat disajikan dalam bentuk poster. Pelaksanaan penilaian ini dapat menggunakan alat/instrumen penilaian berupa daftar cek (checklist), penilaian(rating scale), kesesuaian produk dengan spesifikasinya. Beberapa contoh kegiatan peserta didik dalam penilaian proyek: a) penelitian sederhana tentang air di rumah; b) Penelitian sederhana tentang perkembangan harga sembako;

8-30 Evaluasi Pembelajaran

2. PENILAIAN PRODUK a. Pengertian Penilaian produk adalah penilaian terhadap keterampilan dalam membuat suatu produk dan kualitas produk tersebut. Penilaian produk tidak hanya diperoleh dari hasil akhir saja tetapi juga proses pembuatannya. Penilaian produk meliputi penilaian terhadap kemampuan peserta didik membuat produk-produk teknologi dan seni, seperti: makanan, pakaian, hasil karya seni (patung, lukisan, gambar), barang-barang terbuat dari kayu, keramik, plastik, dan logam. Pengembangan produk meliputi 3 (tiga) tahap dan dalam setiap tahapan perlu diadakan penilaian yaitu:

Evaluasi Pembelajaran 8-31

• Tahap persiapan, meliputi: menilai kemampuan peserta didik merencanakan, menggali, dan mengembangkan gagasan, dan mendesain produk. • Tahap pembuatan (produk), meliputi: menilai kemampuan peserta didik menyeleksi dan menggunakan bahan, alat, dan teknik.

• Tahap penilaian (appraisal), meliputi: menilai kemampuan peserta didik membuat produk sesuai kegunaannya, memenuhi kriteria keindahan/presisi dsb. b. Teknik Penilaian Produk Penilaian produk biasanya menggunakan cara holistik atau analitik. a. Cara analitik, yaitu berdasarkan aspek-aspek produk, biasanya dilakukan terhadap semua kriteria yang terdapat pada semua tahap proses pengembangan (tahap: persiapan, pembuatan produk, penilaian produk). b. Cara holistik, yaitu berdasarkan kesan keseluruhan dari produk, biasanya dilakukan hanya pada tahap penilaian produk (appraisal).

maka persiapkan : 1. e. b. 2. Langkah Kegiatan a. sesuai dengan ketentuan yang ada. yang sekiranya dapat dilakukan penilaian dengan teknik penilaian proyek dan/atau penilaian produk ini. dan apa maknanya ? E. D. 3. d. c. Tuliskan aspek-aspek tersebut dalam borang yang telah dipersiapkan. dan lakukan penilaian atas masing-masing unsur sesuai dengan kondisi sebenarnya. dan kemudian kerjakan apa yang ada pada lembar kegiatan berikut ini. Alat dan Bahan Kertas dan alat tulis seperlunya guna membuat borang . Prasyarat Indikator atau aspek dari permasalah atau soal yang ditulis telah sesuai dengan teknik penilaian proyek atau produk yang dipilih.8-32 Evaluasi Pembelajaran C. Latihan Cobalah renungkan dan pikirkan hal-hal apa yang ada pada bidang tugas anda (di tempat kerja). Dalam . Bagaimana kesimpulannya. Lembar Kegiatan Peserta PLPG Setelah dicatat permasalahan yang ada dan akan dinilai dengan teknik penilaian proyek / produk. Rangkuman Penilaian proyek merupakan kegiatan penilaian terhadap suatu tugas yang harus diselesaikan dalam periode/waktu tertentu. Cermati permasalahan / soal yang ditulis. Catat dan identifikasilah permasalahan tersebut. Identifikasi aspek-aspek yang dinilai. Hitunglah biji (score) perolehannya.borang maupun media yang akan dipakai dalam penilaian itu.

Dalam tahap pembuatan. baik yang berhubungan dengan proses belajar maupun hasil belajar. Menilai kemampuan siswa menyeleksi bahan dan alat c. Penilaian produk tidak hanya diperoleh dari hasil akhir saja tetapi juga proses pembuatannya. Menilai kemampuan siswa dalam mendesain produk b. atas pertanyaan / pernyataan berikut ini. 1. a. c semua benar 3. Penilaian produk adalah penilaian terhadap keterampilan dalam membuat suatu produk dan kualitas produk tersebut. Kemampuan pengelolaan c. Penilaian sikap d. Kemampuan pengelolaan. Pengembangan produk meliputi 3 (tiga) tahap dan dalam setiap tahapan perlu diadakan penilaian yaitu: (1). Tahap penilaian (appraisal). Dalam teknik penilaian produk. dan teknik c. penilaian meliputi sebagai berikut. dan (3). Tahap persiapan. alat. Keaslian 4. Menilai kemampuan siswa menerapkan teknik pembuatan . pada tahap persiapan dan pembuatan perlu diadakan penilaian. (2). Dalam teknik penilaian produk. Pilihlah jawaban yang paling tepat (dari alternatif yang tersedia). Dalam penilaian proyek yg perlu dipertimbangkan adalah hal berikut. Tahap pembuatan (produk).Evaluasi Pembelajaran 8-33 penilaian proyek setidaknya ada 3 (tiga) hal yang perlu dipertimbangkan yaitu: (1). Beragam teknik penilaian dapat dilakukan untuk mengumpulkan informasi tentang kemajuan belajar siswa. dan teknik d. alat. Menilai kemampuan siswa menggunakan bahan dan alat d. Keaslian. Tes Formatif A. F. dan (3). kecuali: a. Relevansi d. Menilai kemampuan menggunakan bahan. pada tahap persiapan dan pembuatan perlu diadakan penilaian. Teknik-teknik penilain tersebut adalah sebagai berikut. Penilaian observasi langsung c. Relevansi. Penilaian produk biasanya menggunakan cara holistik atau analitik. (2). Penilaian unjuk kerja b. kecuali: a. Menilai kemampuan siswa dalam mendesain produk b. b. Perencanaan b. Menilai kemampuan siswa menyeleksi bahan. Penggunaan portofolio 2. kecuali: a. Dalam tahap pembuatan. penilaian meliputi antara lain: a.

kesesuai produk dengan spesifikasinya. menilai kemampuan peserta didik mengaplikasikan pengetahuannya c.8-34 Evaluasi Pembelajaran 5. Pengorganisasian dan pengolahan c... cara holistik d. 8. Karenanya guru perlu menetapkan tahapan yang perlu dinilai. daftar cek b. . menilai proses pembuatan suatu produk. menilai pembuatan suatu produk b. 10. kecuali .. kecuali : a. rating scale d. Perencanaan dan Pengumpulan data b. Penyajian produk d. pengumpulan data dan penyajian data c. Penilaian proyek dapat dilakukan mulai perencanaan. menilai kemampuan peserta didik dalam menginformasikan subyek tertentu. a.. proses selama pengerjaan tugas.. menilai kualitas hasil suatu produk c. cara analitik c. Penilaian produk dapat diaplikasikan untuk penilaian hal-hal berikut ini. 7.. Penilaian produk yang mendasarkan pada aspek-aspek produk paling tepat dinilai dengan . Pelaksanaan penilaian proyek dapat menggunakan beberapa instrumen penilaian. Penilaian proyek dapat dipergunakan untuk beberapa hal.. a.dan terhadap hasil akhir proyek. cara appraisal b. laporan / penyajian hasil akhir d. Penilaian proyek merupakan kegiatan penilaian terhadap suatu tugas yang harus diselesaikan dalam periode/waktu tertentu.. seperti .. memahami pengetahuan anak didik pada subyek tertentu d. cara berkesinambungan.. Tugas tersebut berupa suatu investigasi yang diawali oleh kegiatan: a. catatan harian c. kecuali . penyusunan desain b. Ketiganya harus dilakukan. 9. mengetahui pemahaman dan pengetahuan peserta didik di bidang tertentu b. menilai harga penjualan suatu produk d. ketiga-nya perlu dilalui.. a. 6. a.

2. teknik penilaian apa yang anda pilih dan bagaimana cara membuat alat penilaiannya serta berikan contohnya sesuai mata pelajaran yang Anda mampu. Jika Anda akan menilai kemampuan siswa dalam membuat suatu produk dan mutu produk. berikan penjelasan secara singkat ! 3. Apa yang anda ketahui tentang penilaian proyek.Evaluasi Pembelajaran 8-35 B. Jawablah pertanyaan-pertanyaan di bawah ini ! 1. Berikan penjelasan anda tentang penilaian produk yang dapat dilakukan didalam pembelajaran ! .

Penilaian portofolio pada dasarnya menilai karya-karya siswa secara individu pada satu periode untuk suatu mata pelajaran. Berdasarkan informasi perkembangan tersebut.mengidentifikasi soal / permasalahan yang ada pada bidang tugasnya. portofolio dapat memperlihatkan perkembangan kemajuan . 2. yang tepat dan sesuai dengan permasalahannya. B. atau bentuk informasi lain yang terkait dengan kompetensi tertentu dalam satu mata pelajaran.BAB VI KEGIATAN BELAJAR 5 ( PENILAIAN PORTOFOLIO ) A. Uraian Materi 1. Kompetensi dan Indikator Standar Kompetensi Mengkaji dan mempraktikkan teknik penilaian portofolio Kompetensi Dasar Mempraktikkan teknik penilaian potofolio sesuai bidang tugasnya Indikator Pencapaian 1. Informasi tersebut dapat berupa karya peserta didik (hasil pekerjaan) dari proses pembelajaran yang dianggap terbaik oleh peserta didiknya. Akhir suatu priode hasil karya tersebut dikumpulkan dan dinilai oleh guru dan peserta didik. lembar jawaban tes yang menunjukkan soal yang mampu dan tidak mampu dijawab (bukan nilai). Pengertian Penilaian portofolio merupakan penilaian berkelanjutan yang didasarkan pada kumpulan informasi yang menunjukkan perkembangan kemampuan peserta didik dalam satu periode tertentu. Dengan demikian.melakukan penilaian dengan alat penilaian portofolio. yang akan dapat dilakukan penilaian. guru dan peserta didik sendiri dapat menilai perkembangan kemampuan peserta didik dan terus melakukan perbaikan.

dsb. Saling percaya antara guru dan peserta didik Dalam proses penilaian guru dan peserta didik harus memiliki rasa saling percaya. d. Karya siswa adalah benar-benar karya peserta didik itu sendiri Guru melakukan penelitian atas hasil karya siswa yang dijadikan bahan penilaian portofolio agar karya tersebut merupakan hasil karya yang dibuat oleh peserta didik itu sendiri. c. . gambar. b. e. saling memerlukan dan saling membantu sehingga terjadi proses pendidikan berlangsung dengan baik. komposisi musik. antara lain: karangan. Kepuasan Hasil kerja portofolio sebaiknya berisi keterangan dan atau bukti yang memberikan dorongan peserta didik untuk lebih meningkatkan diri.Evaluasi Pembelajaran 8-37 belajar peserta didik melalui karyanya. lukisan. antara lain : a. puisi. laporan penelitian. surat. Hal-hal yang perlu diperhatikan dan dijadikan pedoman dalam penggunaan portofolio di sekolah. Kesesuaian Hasil kerja yang dikumpulkan adalah hasil kerja yang sesuai dengan kompetensi yang tercantum dalam kurikulum. Kerahasiaan bersama antara guru dan peserta didik Kerahasiaan hasil pengumpulan informasi perkembangan peserta didik perlu dijaga dengan baik dan tidak disampaikan kepada pihak-pihak yang tidak berkepentingan sehingga memberi dampak negatif proses pendidikan. resensi buku/ literatur. Milik bersama (joint ownership) antara peserta didik dan guru Guru dan peserta didik perlu mempunyai rasa memiliki berkas portofolio sehingga peserta didik akan merasa memiliki karya yang dikumpulkan dan akhirnya akan berupaya terus meningkatkan kemampuannya. sinopsis. f. foto.

Untuk mata diklat produktif dapat berupa kertas kerja. dan dapat dinilai dengan uang (mempunyai nilai jual bagi mata diklat produktif).8-38 Evaluasi Pembelajaran g. Proses ini tidak akan terjadi secara spontan. peserta didik mengumpulkan gambar-gambar buatannya. Tentukan bersama peserta didik sampel-sampel portofolio apa saja yang akan dibuat. tetapi membutuhkan waktu bagi peserta didik untuk belajar meyakini hasil penilaian mereka sendiri. dan minatnya. keterampilan. Portofolio antara peserta didik yang satu dan yang lain bisa sama bisa berbeda. 2. tetapi digunakan juga oleh peserta didik sendiri. Sedangkan untuk kemampuan menggambar. Manfaat utama penilaian ini sebagai diagnostik yang sangat berarti bagi guru untuk melihat kelebihan dan kekurangan peserta didik. h. patung dan lain-lain). Teknik Penilaian Portofolio Teknik penilaian portofolio di dalam kelas memerlukan langkahlangkah sebagai berikut: a. laporan. untuk kemampuan menulis peserta didik mengumpulkan karangan-karangannya. Penilaian dan pembelajaran Penilaian portofolio merupakan hal yang tak terpisahkan dari proses pembelajaran. tidak hanya merupakan kumpulan hasil kerja peserta didik yang digunakan oleh guru untuk penilaian. produk kerja (baju. Proses belajar yang dinilai misalnya diperoleh dari catatan guru tentang kinerja dan karya peserta didik. rekaman video dan bukti-bukti lainnya sesuai dengan proyek yang akan dilakukan. masakan. Penilaian proses dan hasil Penilaian portofolio menerapkan prinsip proses dan hasil. Misalnya. Dengan melihat portofolionya peserta didik dapat mengetahui kemampuan. Jelaskan kepada peserta didik bahwa penggunaan portofolio. . b.

antara peserta didik dan guru perlu dibuat “kontrak” atau perjanjian mengenai jangka waktu perbaikan. Contoh.Evaluasi Pembelajaran 8-39 c. e. Namun. Guru dapat membimbing peserta didik tentang bagaimana cara menilai dengan memberi keterangan tentang kelebihan atau kekurangan. Berilah tanggal pembuatan pada setiap bahan informasi perkembangan peserta didik sehingga dapat terlihat perbedaan kualitas dari waktu ke waktu. untuk kemampuan menulis karangan aspek yang akan dinilai. Mintalah peserta didik menilai karyanya secara berkesinambungan. misalnya: penggunaan tata bahasa. Hal ini dapat dilakukan pada saat membahas portofolio. misalnya setelah 2 minggu karya yang telah diperbaiki harus diserahkan kepada guru. jadwalkan untuk menyajikan hasil karya siswa tersebut dalam (pertunjukan. Dengan demikian. h. g. . dan sistematika penulisan. kepada peserta didik dapat diberi kesempatan untuk memperbaiki lagi. Bila perlu dalam menilai hasil karya siswa. pameran dsb) dengan mengundang orang tua maupun masyarakat sehingga orangtua dapat membantu dan memotivasi anaknya. pemilihan kosa-kata. d. kelengkapan gagasan. Diskusikan cara penilaian kualitas karya para peserta didik. Setelah suatu karya dinilai dan ternyata nilainya belum memuaStandar Kompetensian. Sebaiknya tentukan aspek-aspek yang akan dinilai dari sampel portofolio beserta pembobotannya bersama para peserta didik sebelum mereka membuat karyanya . Kumpulkan dan simpanlah karya-karya tiap peserta didik dalam satu map atau folder di rumah masing-masing atau loker masingmasing di sekolah. peserta didik mengetahui harapan (standar) guru dan berusaha mencapai standar tersebut f.

C. . Latihan Cobalah renungkan dan pikirkan hal-hal apa yang ada pada bidang tugas anda (di tempat kerja).8-40 Evaluasi Pembelajaran Catatan: Setiap karya siswa sesuai Standar Kompetensi/Kompetensi Dasar yang masuk dalam daftar portofolio dikumpulkan dalam satu file (tempat) untuk setiap peserta didik sebagai bukti pekerjaannya. Semakin baik hasil yang terlihat dari tulisan peserta didik. yang sekiranya dapat dilakukan penilaian dengan teknik penilaian portofolio ini. dan kemudian kerjakan apa yang ada pada lembar kegiatan berikut ini. Skor untuk setiap kriteria menggunakan Standar Kompetensiala penilaian 0 . Catat dan identifikasilah permasalahan tersebut.10 atau 0 100. Kolom keterangan diisi dengan catatan guru tentang kelemahan dan kekuatan tulisan yang dinilai. semakin tinggi Skor yang diberikan.

Identifikasi aspek-aspek yang dinilai.borang yang akan dipakai dalam penilaian portofolio nantinya. Cermati permasalahan / soal yang ditulis. Prasyarat Indikator atau aspek dari permasalah atau soal yang ditulis telah sesuai dengan teknik penilaian portofolio yang dipilih. 3. 2. Hitunglah biji (score) perolehannya. Alat dan Bahan Kertas dan alat tulis seperlunya guna membuat borang .Evaluasi Pembelajaran 8-41 D. Akhir suatu priode hasil karya tersebut dikumpulkan dan dinilai oleh guru dan peserta didik. maka persiapkanlah : 1. dan apa maknanya ? E. antara lain : (a). dan lakukan penilaian atas masing-masing unsur sesuai dengan kondisi sebenarnya. d. Penilaian portofolio pada dasarnya menilai karya-karya siswa secara individu pada satu periode untuk suatu mata pelajaran. (b). e. Rangkuman Penilaian portofolio merupakan penilaian berkelanjutan yang didasarkan pada kumpulan informasi yang menunjukkan perkembangan kemampuan peserta didik dalam satu periode tertentu. Lembar Kegiatan Peserta PLPG Setelah dicatat permasalahan yang ada dan akan dinilai dengan teknik penilaian portofolio. Hal-hal yang perlu diperhatikan dan dijadikan pedoman dalam penggunaan portofolio di sekolah. Bagaimana kesimpulannya. c. Karya siswa adalah benar-benar karya peserta didik itu sendiri. Saling percaya antara guru dan peserta . sesuai dengan ketentuan yang ada. Langkah Kegiatan a. Tuliskan aspek-aspek tersebut dalam borang yang telah dipersiapkan. b.

atas pertanyaan / pernyataan berikut ini.Pilihlah jawaban yang paling tepat (dari alternatif yang tersedia).. (g). Karya siswa adalah benar-benar karya peserta didik itu sendiri b... Penilaian portofolio merupakan penilaian berkelanjutan yang didasarkan pada kumpulan informasi yang menunjukkan perkembangan kemampuan peserta didik dalam kurun waktu tertentu. Penilaian unjuk kerja c. a. Penilaian sikap d. baik yang berhubungan dengan proses belajar maupun hasil belajar. (e).. Penilaian proses dan hasil. Penilaian portofolio pada dasarnya menilai : a. F. karya siswa secara individu pada satu periode untuk satu mata pelajaran c. Milik bersama (joint ownership) antara peserta didik dan guru. kecuali: a.8-42 Evaluasi Pembelajaran didik. Berikut adalah hal-hal yang perlu diperhatikan dan dijadikan pedoman dalam penggunaan portofolio di sekolah. Kerahasiaan bersama antara guru dan peserta didik. serta (h). Kepuasan. karya sekelompok siswa pada satu periode untuk beberapa matapelajaran d. lembar jawaban tes yang menunjukkan soal mana yang mampu dan tidak mampu dijawab c. Kesesuaian. karya siswa secara individu pada satu periode untuk sekelompok mata pelajaran.. Saling percaya antara guru dan peserta didik c. 3. Guru mempunyai rasa memiliki berkas portofolio d. 1. Penggunaan portofolio 2. hasil pekerjan peserta didik yang dianggap karya terbaiknya b. (d). Penilaian proses dan hasil. (c). Teknik-teknik penilain tersebut adalah sebagai berikut. Beragam teknik penilaian dapat dilakukan untuk mengumpulkan informasi tentang kemajuan belajar siswa. . Penilaian observasi langsung b. (f). Pengecualian dari bentuk informasi yang dinilai tersebut adalah . Penilaian dan pembelajaran. 4. Tes Formatif A. karya sekelompok siswa pada satu periode untuk satu mata pelajaran b. nilai pekerjaan dari lembar jawaban tes yang dikerjakan peserta didik. Bentuk informasi lain yang terkait dengan kompetensi tertentu dalam satu mata pelajaran d. kecuali: a.

Menentukan bersama peserta didik.. penilaian sikap c. a.. 9.. Teknik penilaian potofolio di dalam kelas memerlukan langkah-langkah: a.. Dari catatan guru tentang kinerja dan karya peserta didik. teknik penilaian diri c. penilaian proyek c.. teknik penilaian produk d. teknik penilaian proyek. a. 8. guru .. a.. merupakan salah satu hal yang dijadikan pedoman dalam . penilaian proyek.. portofolio... guru . Langkah perbaikan sedemikian biasanya dilakukan dalam pelaksanaan ... peserta didik c. Manfaat utama penilaian portofolio adalah sebagai diagnostik yang sangat berarti bagi .... Langkah yang dapat diambil guna memotivasi anak didik. guru dan siswa. perlu dilakukan kotrak “perjanjian” antara guru dengan siswa mengenai jangka waktu perbaikan. orangtua peserta didik .. penilaian diri b... 7. diri d... dengan cara menjanjikan hasil karya siswa tersebut dijadwalkan diikutkan dalam pameran. dan c perlu diikuti... penilaian unjuk kerja b. 6... proyek b.. paling tepat diterapkan pada teknik penilaian ..... untuk melihat kelebihan dan kekurangannya . sehingga sesuaidengan yang diharapkan pada standar kompetensi. peserta didik .. Kerahasiaan bersama antara guru dan peserta didik. Menjelaskan kepada peserta didik akan kegunaan penilalain portofolio b. adalah salah satu langkah dari ... Untuk memperpaiki nilai peserta didik... orangtua peserta didik d.. penilaian diri. penilaian portofolio d. sampel-sampel portofolio apa saja yang akan dibuat c.. a... teknik penilaian portofolio b.. orang tua peserta didik b. 10. a..Evaluasi Pembelajaran 8-43 5. .... Mengumpulkan dan menyimpan karya setiap peserta didik dalam satu map atau folder di loker masing-masing di sekolah d. b. penilaian portofolio d. Langkah a... produk c.

dan tunjukkanlah alasan anda ! 2. di Indonesia digalakkan langkah “sertifikasi” guru dan dosen dengan melaksanakan penilaian portofolio.8-44 Evaluasi Pembelajaran B. Jawablah pertanyaan-pertanyaan di bawah ini ! 1. Adakah manfaat penilaian portofolio bagi anda ? Apa alasannya ? . Kemana arah dan tujuan penilaian portofolio ? Berilah penjelasan singkat ! 3. Guna meningkatkan kualitas profesionalisme guru dan dosen. Mengapa demikian.

Meskipun demikian. hasil penilaian diri dapat digunakan guru sebagai bahan pertimbangan untuk memberikan nilai. Kompetensi dan Indikator Standar Kompetensi Mengkaji dan mempraktikkan teknik penilaian diri Kompetensi Dasar Mempraktikkan teknik penilaian diri sesuai bidang tugasnya Indikator Pencapaian 1. diantaranya: a. yang akan dapat dilakukan penilaian. pada saat atau setelah selesai melakukan tugas. 2. B. Peran penilaian diri menjadi penting bersamaan dengan bergesernya pusat pembelajaran dari guru ke siswa yang didasarkan pada konsep belajar mandiri (auonomous lening). yang tepat dan sesuai dengan permasalahannya. Pengertian Penilaian diri adalah suatu teknik penilaian di mana peserta didik diminta untuk menilai dirinya sendiri berkaitan dengan status.melakukan penilaian dengan alat penilaian diri. untuk menilai aspek-aspek kompetensi tertentu dari suatu mata pelajaran. Penilaian Langsung dan Spesifik. Ada beberapa jenis penilaian diri. yaitu penilaian secara langsung.mengidentifikasi soal / permasalahan yang ada pada bidang tugasnya. . proses dan tingkat pencapaian kompetensi yang dipelajarinya dalam mata pelajaran tertentu didasarkan atas kriteria atau acuan yang telah disiapkan. Uraian Materi 1. Tujuan utama dari penilaian diri adalah untuk mendukung atau memperbaiki proses dan hasil belajar.BAB VII KEGIATAN BELAJAR 6 ( PENILAIAN DIRI ) A.

Menentukan kompetensi atau aspek kemampuan yang akan dinilai. Penggunaan teknik ini dapat memberi dampak positif terhadap perkembangan kepribadian seseorang. Teknik Penilaian Ada kecenderungan peserta didik akan menilai diri terlalu tinggi dan subyektif. 2) peserta didik menyadari kekuatan dan kelemahan dirinya. . karena mereka diberi kepercayaan untuk menilai dirinya sendiri. Penilaian Tidak Langsung dan Holistik. membiasakan. dapat berupa pedoman penskoran. 2. untuk memberikan penilaian secara keseluruhan. atau skala penilaian. d). Menentukan kriteria penilaian yang akan digunakan. yaitu penilaian terhadap unsur-unsur afektif atau emosional. Untuk itu penilaian diri oleh peserta didik di kelas perlu dilakukan melalui langkah-langkah sebagai berikut. karena ketika mereka melakukan penilaian. a). peserta didik dapat diminta untuk membuat tulisan yang memuat curahan perasaannya terhadap suatu objek tertentu. e). penilaian diri dilakukan berdasarkan kriteria yang jelas dan objektif. karena mereka dituntut untuk jujur dan objektif dalam melakukan penilaian. untuk mendorong peserta didik supaya senantiasa melakukan penilaian diri secara cermat dan objektif. f).8-46 Evaluasi Pembelajaran b. daftar tanda cek. 3) dapat mendorong. Misalnya. Penilaian Sosio-Afektif. Meminta peserta didik untuk melakukan penilaian diri. Guru mengkaji hasil penilaian. Karena itu. Merumuskan format penilaian. dan melatih peserta didik untuk berbuat jujur. harus melakukan introspeksi terhadap kekuatan dan kelemahan yang dimilikinya. b). Keuntungan penggunaan penilaian diri di kelas antara lain: 1) dapat menumbuhkan rasa percaya diri peserta didik. Menjelaskan kepada peserta didik tujuan penilaian diri. yaitu penilaian yang dilakukan dalam kurun waktu yang panjang. c). c.

yang sekiranya dapat dilakukan penilaian dengan teknik penilaian diri ini.borang yang akan dipakai dan dibutuhkan dalam penilaian diri. Lakukan tindakan lanjutan. Alat dan Bahan Kertas dan alat tulis seperlunya guna membuat borang . . Lembar Kegiatan Peserta PLPG Setelah dicatat permasalahan yang ada dan akan dinilai dengan teknik penilaian diri. guru dan siswa membahas bersama proses dan hasil penilaian Contoh Penilaian Diri C. Latihan Cobalah renungkan dan pikirkan hal-hal apa yang ada pada bidang tugas anda (di tempat kerja). Catat dan identifikasilah permasalahan tersebut.Evaluasi Pembelajaran 8-47 g). D. antara lain guru memberikan balikan tertulis. dan kemudian kerjakan apa yang ada pada lembar kegiatan berikut ini. maka persiapkan : 1.

Tuliskan aspek-aspek tersebut dalam borang yang telah dipersiapkan. Bagaimana kesimpulannya. Ada kecenderungan peserta didik akan menilai diri terlalu tinggi dan subyektif. (b). proses dan tingkat pencapaian kompetensi yang dipelajarinya dalam mata pelajaran tertentu didasarkan atas kriteria atau acuan yang telah disiapkan. b. d. e. dan (c). Ada beberapa jenis penilaian diri. sesuai dengan ketentuan yang ada. Identifikasi aspek-aspek yang dinilai. Penilaian Tidak Langsung dan Holistik. diantaranya: (a).8-48 Evaluasi Pembelajaran 2. Penilaian Sosio-Afektif. dan lakukan penilaian atas masing-masing unsur sesuai dengan kondisi sebenarnya. Hitunglah biji (score) perolehannya. . Prasyarat Indikator atau aspek dari permasalah atau soal yang ditulis telah sesuai dengan teknik penilaian dir yang dipilih. penilaian diri dilakukan berdasarkan kriteria yang jelas dan objektif. Penilaian Langsung dan Spesifik. 3. Tujuan utama dari penilaian diri adalah untuk mendukung atau memperbaiki proses dan hasil belajar. Rangkuman Penilaian diri adalah suatu teknik penilaian di mana peserta didik diminta untuk menilai dirinya sendiri berkaitan dengan status. Cermati permasalahan / soal yang ditulis. dan apa maknanya ? E. Langkah Kegiatan a. c. Karena itu.

. Penilaian diri adalah teknik penilaian dimana peserta didik diminta untuk menilai dirinya sendiri berkaitan dengan . 1. 4.. pedoman penskoran c.. Menentukan kompetensi yang akan dinilai d. kecuali: a. skala penilaian. Pilihlah jawaban yang paling tepat (dari alternatif yang tersedia). Keuntungan penggunaan penilaian diri di kelas antara lain.. a.. Berikut beberapa jenis penilaian diri. baik yang berhubungan dengan proses belajar maupun hasil belajar.. . Penilaian observasi langsung d. tingkat pencapaian kompetensi d... memperbaiki proses dan hasil belajar .. Penilaian Langsung dan Spesifik b..b.. proses c. status b. daftar cek d. 7. kecuali : a. memperbaiki proses pembelajaran c. Teknik-teknik penilain tersebut adalah sebagai berikut.Evaluasi Pembelajaran 8-49 F. meningkatkan kemampuan peserta didik b.c) berkait. perlu dilakukan langkah-langkah sebagai berikut. Beragam teknik penilaian dapat dilakukan untuk mengumpulkan informasi tentang kemajuan belajar siswa... dapat menumbuhkan rasa percaya diri peserta didik c. Tujuan utama penilaian diri dalam pembelajaran adalah .. 6. Menentukan kriteria penilaian yang akan digunakan. dapat mendorong. dapat membiasakan peserta didik merasa mampu b. ketiganya (a. a. Menjelaskan kepada peserta didik tujuan penilaian diri b.. 5. Penilaian Sosio-Afektif 2. Format penilaian diri yang tidak dapat dipakai adalah . dalam mata pelajaran tertentu didasarkan atas kriteria atau acuan yang telah dipersiapkan. Penilaian diri c. kecuali: a. Penilaian unjuk kerja b. Penilaian Sosio-Kognitif d.. a. peserta didik menyadari kekuatan dan kelemahan dirinya d. kecuali : a. Untuk melakukan penilaian diri oleh peserta didik di kelas. lembar pengamatan b. Penilaian Tidak Langsung dan Holistik c. Tes Formatif A. atas pertanyaan / pernyataan berikut ini.. Guru mendorong peserta didik untuk melakukan penilaian diri tidak secara cermat dan obyektif c. Penilaian sikap 3. meningkatkan hasil belajar peserta didik d. melatih peserta didik untuk berbuat jujur.

Jawablah pertanyaan-pertanyaan di bawah ini ! 1. kecuali: a. kecuali : a. a. Untuk aspek apa sajakah penilaian diri diterapkan sebagai instrumen penilaian ? 3.c secara bersama..b. Menyimpan hasil penilaian di almari arsip khusus d. Mengapa dalam evaluasi pembelajaran dianjurkan untuk memadukan berbagai teknik penilaian? 2. Beberapa ketentuan yang diberlakukan dalam proses penjaminan mutu (Quality Assurance) oleh tim verifikasi internal antara lain. Proses pengendalian mutu (Quality Control) yang dilakukan dalam verifikasi eksternal memiliki ketentuan antara lain. ketrampilan seseorang c. Setujukah anda akan pernyataan tersebut? Mengapa? Berikan penjelasannya secara singkat ! . kemampuan seseorang b.. B. Menguji peserta didik secara sampling melalui bukti fisik portofolio. Memantau pelaksanaan penilaian yang dilakukan oleh guru b. a. pengetahuan dan sikap seseorang d. Memantau pelaksanaan penilaian yang dilakukan oleh guru c. Teknik penilaian tunggal tidak cukup memberikan informasi tetang .. 10. Menyusun umpan balik c. Menguji peserta didik secara sampling melalui bukti belajar berupa portofolio. ”Tidak ada satu pun alat penilaian yang dapat mengumpulkan informasi hasil dan kemajuan belajar peserta didik secara lengkap”.8-50 Evaluasi Pembelajaran 8. 9. Memverivikasi hasil penilaian guru d. Memahami tujuan pembelajaran / kriteria unjuk kerja yang harus dikuasai peserta didik b.

dengan ketentuan sebagai berikut: . a. Penilaian tunggal tidak cukup untuk memberikan gambaran / informasi tentang kemampuan. keterampilan.BAB VIII PENUTUP Perlu dicatat bahwa tidak ada satu pun alat penilaian yang dapat mengumpulkan informasi hasil dan kemajuan belajar peserta didik secara lengkap. Verifikasi eksternal Verifikasi eksternal sebagai proses pengendalian mutu (Quality Control) dilakukan oleh penilai (assessor) yang diakui lembaga sertifikasi profesi. dunia usaha / dunia industri atau asosiasi profesi. 2) Memantau pelaksanaan penilaian yang dilakukan oleh guru. pengetahuan dan sikap seseorang. ketua program keahlian dan wakil kepala sekolah. interpretasi hasil tes tidak mutlak dan abadi karena akan terus berkembang sesuai dengan pengalaman belajar yang dialaminya. 3) Memverifikasi hasil penilaian. Untuk menjamin obyektivitas hasil penilaian. bisa terdiri atas guru kejuruan. 4) Menguji peserta didik secara sampling melalui bukti fisik portfolio. dilakukan proses verifikasi oleh pemeriksa (verifier) baik pemeriksa internal maupun eksternal. Verifikasi internal Verifikasi internal sebagai proses penjaminan mutu (Quality Assurance) dilakukan oleh unsur sekolah. 5) Menyusun umpan balik. b. 6) Mengkonfirmasikan hasil verifikasi penilaian kepada guru. Lagi pula. dan 7) Mengajukan hasil verifikasi kepada external verifier. dengan ketentuan sebagai berikut: 1) Memahami tujuan pembelajaran/kriteria unjuk kerja yang harus dikuasai peserta didik.

Memantau pelaksanaan penilaian yang dilakukan oleh guru. d 3. b 8. d 2. a 9.8-52 Evaluasi Pembelajaran 1). c 2. b 5. d 10. a 4. d 6. a 5. c 3. c 5. d 8. c 9. b 2. c 6. a 9. Memverifikasi hasil penilaian guru. c 3. KUNCI JAWABAN TES FORMATIF Bab II 1. d 4. d 9. d 4. d 10. c 8. c 7. c 10. b 2. a 6. c 3. b . Menguji peserta didik secara sampling melalui bukti belajar berupa portfolio. d 7. d 5. c Bab VI 1. d 4. a 7. d 7. d 10. 3). b 6. b Bab V 1. 2). b 3. c 9. b 3. c 7. c 4. a 4. c 10. d 5. b 10. a 6. b Bab III 1. c Bab IV 1. b 6. dan 4). c 2. b 7. a 8. b 8. a Bab VII 1. a 2. d 8. Memahami tujuan pembelajaran/kriteria kinerja yang harus dikuasai peserta didik. a 5. d 9.

Pembelajaran adalah proses interaksi peserta didik dengan pendidik dan sumber belajar pada suatu lingkungan belajar Penilaian adalah suatu proses sistematis yang mengandung pengumpulan informasi. . tingkah laku. Penilaian Hasil Kerja (Produk) : Penilaian terhadap kemampuan membuat produk teknologi dan seni Penilaian Penugasan (Proyek) : Penilaian terhadap suatu tugas yang mengandung penyelidikan yang harus selesai dalam waktu tertentu Penilaian Portofolio : Penilaian melalui koleksi karya (hasil kerja) siswa yang sistematis Penilaian Unjuk Kerja (Performance) : pengamatan terhadapa aktivitas siswa sebagaimana terjadi (unjuk kerja. Penilaian Pembelajaran adalah suatu perbuatan (mengira-ngira) nilainya hasil pembelajaran yang dilakukan dalam suatu lingkungan belajar. proses. interaksi) Penilaian Sikap : Penilaian terhadap perilaku dan keyakinan siswa terhadap obyek sikap Penilaian Tertulis merupakan tes di mana soal dan jawaban yang diberikan kepada peserta didik dalam bentuk tulisan. tingkat pencapaian kompetensi yang dipelajarinya. dan menginterpretasikan informasi tersebut untuk membuat keputusan-keputusan. Penilaian Kelas merupakan suatu kegiatan guru yang terkait dengan pengambilan keputusan tentang pencapaian kompetensi atau hasil belajar peserta didik yang mengikuti proses pembelajaran tertentu Penilaian Diri : Menilai diri sendiri berkaitan dengan status. menganalisis.GLOSARIUM Belajar Tuntas (mastery learning) : peserta didik tidak diperkenankan mengerjakan pekerjaan berikutnya. dan hasil yang baik. sebelum mampu menyelesaikan pekerjaan dengan prosedur yang benar.

8-54 Evaluasi Pembelajaran Rapor adalah laporan kemajuan belajar yang berisi informasi tentang pencapaian kompetensi. . sehingga memberikan arah / tujuan yang jelas dan akhirnya akan bermuara pada tingkat keberhasilan peserta didiknya. Teknik penilaian adalah cara / prosedur penilaian yang telah ditentukan dan sesuai dengan kaidah yang berlaku.

Phillips.puskur. Norman. Houston. Jack J. Popham. 2008. Puji Iryanti. Dirjen Dikdasmen. London: Prentice Hall. 3rd Edition. Peacock Publishers. Classroom Measurement and Evaluation.J. Panduan Penilaian Kelompok Mata Pelajaran Agama dan Akhlak Mulia. Constructing Achievement Tests. Jakarta: Depdiknas. . Anonim. charles D dan Richard L Antes. 2004. 2nd Edition. Boston: Allyn & Bacon. Makalah disampaikan pada seminar nasional ”Penilaian Pembelajaran dalam Kontek KTSP” pada pengukuhan pengurus HEPI UKC Metro di Lampung tanggal 12 Juni 2008. Illinois: F. “Penilaian Hasil Pembelajaran Kurikulum Tingkat Satuan Pendidikan (KTSP)”. What Teachers Need to Know. Texas: Gulf Publishing Company. Jakarta: Pusat Kurikulum.DAFTAR PUSTAKA Anonim. E. Badan Standar Nasional Pendidikan. Gronlund. Yogyakarta: Depdiknas.net 29 Juni 2008. (1982). Hopkins.E. Balitbang Dediknas. W. 2007. 2004. Budi Susetyo. 1991. Model Penilaian Kelas. Inc. Kurikulum Berbasis Kompetensi (untuk Sekolah Menengah Kejuruan). (1995) Classroom Assessment. P3G Matematika. 1990. http://www. Penilaian Unjuk kerja (Paket Pembinaan Penataran). Handbook of Training Evaluation and Measurement Methods.

BUKU AJAR MEDIA PEMBELAJARAN .

BUKU AJAR Pemanfaatan Media Dalam Pembelajaran JURUSAN TEKNIK ELEKTRO FAKULTAS TEKNIK UNIVERSITAS NEGERI SEMARANG (UNNES) 2008 0 .

Sri Sartono. FR. NIP. 130515780 JURUSAN TEKNIK ELEKTRO FAKULTAS TEKNIK UNIVERSITAS NEGERI SEMARANG (UNNES) 2008 1 .BUKU AJAR Pemanfaatan Media Dalam Pembelajaran Penulis: Drs. MPd.

mengelola UPT Sumber Belajar dan Media UNNES Semarang. maka pasti masih banyak kekurangan di sana-sini. maka buku ajar dengan judul “Pemanfaatan Media Pembelajaran” disiapkan agar dapat dimanfaatkan para guru dalam rangka meningkatkan profesionalitasnya dalam mengelola dan mengadakan inovasi proses pembelajaran. Dalam rangka mendukung program tersebut.KATA PENGANTAR Kemajuan dalam bidang komunikasi dan informasi dewasa ini menuntut adanya sumber daya manusia yang adaptip sehingga tidak ketinggalan dari perkembangan dunia yang semakin menglobal. Akhirnya ucapan terimakasih atas kepercayaan yang diberikan. Semoga buku ini bermanfaat sebagai sumbangan bagi para guru. Buku ini ditulis dari berbagai sumber maupun dari pengalaman kami mengajar bidang komunikasi. Semarang. dan terimakasih kepada teman-teman dosen Teknik Elektro FT UNNES. media pembelajaran. 12 Juli 2008 FR. Karena keterbatasan waktu. Oleh karena itu masukan untuk kesempurnaan buku ini sangat diharapkan. Sri Sartono 2 . Perkembangan tersebut juga mengakibatkan berkembangnya teknologi komunikasi pendidikan yaitu penggunaan produk teknologi seperti computer. multimedia serta pengalaman kerja di TKPK / Media Pembelajaran. Pemerintah dalam rangka sertifikasi guru mengadakan program PLPG untuk melatih guru sehingga menjadi guru yang professional dalam mengajar. LCD. internet untuk meningkatkan kualitas pembelajaran.

Contoh media grafis 29 C. Pengertian dan Fungsi Media Pembelajaran 12 3. B. Teknik Komunikasi dan Presentasi dalam Proses Pembelajaran 2. Tes Formatif PENUTUP : KUNCI JAWABAN TES FORMATIF DAFTAR PUSTAKA 38 38 50 63 75 75 78 78 78 3 . D. Kompetensi dan Indikator 8 B. Uraian Materi 1. Klasifikasi dan Jenis Media Pembelajaran 19 7. Konsep Media dan Sumber Belajar 14 4.DAFTAR ISI HALAMAN SAMPUL HALAMAN FRANCIS KATA PENGANTAR DAFTAR ISI PETA KOMPETENSI BAB I. Manfaat dan Nilai Praktis Media Sebagai Sumber Belajar 18 6. C. Latihan 35 D. A. PENDAHULUAN Deskripsi Prasyarat Petunjuk Belajar Kompetensi dan Indikator halaman 0 1 2 3 4 5 6 6 7 BAB II. Kompetensi dan Indikator B. Produksi media OHT dan Slide Presentasi C. Tes Formatif 35 BAB II. Rasional Penggunaan Media dalam Pembelajaran 9 2. Pemilihan Media Pembelajaran 22 8. Pertumbuhan konsep Media Instruksuional 16 5. Dasar-dasar disain media presentasi 3. Pertimbangan dalam memilih media 25 9. KEGIATAN BELAJAR 2 A. KEGIATAN BELAJAR 1 A. Uraian Materi 1. Latihan D.

Dapat menjelaskan alasan-alasan pemilihan media Mengetahui rasional penggunaan media dan memiliki pengetahuan dan pemahaman untuk memilih media dalam pembelajaran BUKU AJAR PEMAN FAATAN MEDIA PEMBE LAJARAN Dapat menilih media untuk pembelajaran Memanfaatkan Media Dlm Pembelajaran scr profesional Dapat menjelaskan prinsip dan unsur disain media Dapat membuat disain dan produksi media OHT dan Slide Presentasi untuk pembelajaran Dapat mengoperasikan media (OHP. Dapat menjebutkan kriteria pemilihan media. Mampu merencanakan dan membuat media untuk presentasi mengajar 4 . LCD) untuk presentasi mengajar Dapat mengimplementasi teknik presentasi dalam proses pembelajaran.PETA KOMPETENSI Dapat menyebutkan alasan-alasan digunakanya media dalam pembelajaran Dapat menjebutkan pengertian media pembelajaran Dapat menyebutkan fungsi/peranan media dan memberikan alasanalasannya digunakan dalam pembelajaran Dapat menyebutkan dan mengidentifikasi berbagai jenis media.

oleh karena itu sudah sejak lama produk teknologi komunikasi dan informasi dimanfaatkan dalam proses pembelajaran. Deskripsi Sekarang ini telah masuk di dalam era komunikasi dan informasi. harus bisa mengadaptasi terhadap Iptek yang berkembang disekitar kehidupannya agar tidak disebut orang yang ketinggalan jaman. Guru dan calon guru dituntut memiliki kompetensi profesional dalam memilih dan memanfaatkan berbagai media dalam pembelajaran baik yang telah tersedia maupun media yang harus direncanakan sesuai dengan tujuan pembelajaran yang diharapkan (media by utilities dan media by design). Proses pembelajaran pada hakekatnya adalah merupakan proses komunikasi. komputer dan jaringan internet). Penggunaan produk teknologi komunikasi dan informasi dalam proses pembelajaran telah banyak dipelajari dan diteliti dalam kawasan teknologi pendidikan/pembelajaran yang selanjutnya berkembang menjadi teknologi komunikasi pendidikan dan kebudayaan (TKPK) yang akhirnya berkembang menjadi media pembelajaran/pendidikan. yang di dalamnya sarat dengan penggunaan teknologi komunikasi dan informasi yang makin lama makin canggih. maka dialah pemenangnya. film strip. dll). Hal ini merupakan usaha untuk mencapai kompetensi secara efektif dan efisien. Oleh karena itu buku ajar ini menyajikan materi-materi 5 . modul. film bergerak/life). poster. majalah dll ). Video. Oleh karena itu manusia termasuk guru. VCD. Produk teknologi pembelajaran yang sampai saat ini digunakan dalam proses komunikasi dalam pembelajaran. di antaranya adalah penggunaan media cetak (handout.BAB I PENDAHULUAN A. slide.TV. grafik. Pepatah mengatakan bahwa siapa yang menguasai pengetahuan dan teknologi komunikasi serta memanfaat-kannya dalam kehidupannya. buku ajar. koran. CCTV . Media grafis (gambar. chart. buku teks. Media Fotografi ( foto diam/still. Media elektronik (Radio Tape Recorder.

disain dan produksi media OHT dan slide presentasi untuk keperluan presentasi dalam proses pembelajaran. Prasyarat Agar tidak menghambat/mengalami kesulitan dalam mempelajari buku ajar ini. 3. maka diharapkan peserta didik telah memiliki keterampilan dalam mengoperasikan komputer. Kerjakan/jawablah pertanyaan/tugas latihan yang ada pada buku ajar ini. Petunjuk Belajar Agar dapat mencapai kompetensi yang diharapkan. tetapi bila anda baru mencapai < 85%. Kerjakan tes formatif yang ada pada setiap kegiatan dan cocokkan dengan kunci jawaban. Baca dengan saksama dan fahami isi Bab I untuk mengetahui arah dan tujuan penulisan buku ajar ini. Apabila ternyata belum bisa menjawab dengan benar. baca ulang lagi materinya sampai dapat menemukan jawaban yang benar. 5. dengan menghitung Hitung kemampuan daya serap anda jawaban yang benar. 6. Cari dan tandai kata/kalimat kunci/penting pada setiap alinea dan catatlah untuk memudahkan mengingat kembali isinya. Lakukan kegiatan yang diharapkan dari buku ajar ini dengan sungguh-sungguh. karena telah dinyatakan tuntas pada kegiatan 1. maka dalam mempelajari buku ajar ini dapat dilakukan dengan langkah-langkah sebagai berikut. 2. Bila prosentase mencapai > 85% teruskan pada kegiatan 2 berikutnya. Jenis-jenis dan pemilihan media pembelajaran.yang dirancang untuk mencapai kompetensi profesional yang diharapkan yaitu : Arti dan fungsi media dalam pembelajaran. B. 1. pelajari kembali materinya mulai dari langkah awal sampai 6 . 4. C. Baca dengan saksama dan fahami isi Bab II (kegiatan belajar 1).

Jangan melanjutkan belajar kegiatan berikutnya bila anda belum tuntas pada kegiatan ini. lakukan langkah-langkah yang sama untuk mempelajari kegiatan belajar berikutnya. Kerjakan kembali tes formatif. Kompetensi dan Indikator Alokasi No 1 Kompetensi Mengetahui rasional penggunaan media dan memiliki pengetahuan dan pemahaman untuk memilih media dalam pembelajaran Indikator Dapat menyebutkan alasanalasan digunakanya media dalam pembelajaran Dapat menjebutkan pengertian media pembelajaran Dapat menyebutkan fungsi/peranan media dan memberikan alasanalasannya digunakan dalam pembelajaran Dapat menyebutkan dan mengidentifikasi berbagai jenis media. lihat kunci jawaban dan hitung prosentase ketuntasan belajar anda. Dapat menjelaskan alasanalasan pemilihan media Dapat menilih media untuk waktu 2 x 50 menit pembelajaran 7 . 7.selesai. Dapat menjebutkan kriteria pemilihan media. D. Apakah telah mencapai > 85% ? bila telah tuntas anda dapat melanjutkan pada kegiatan berikutnya.

2 Mampu merencanakan dan membuat media untuk presentasi mengajar Dapat menjelaskan prinsip dan unsur disain media Dapat membuat disain dan produksi media OHT dan Slide Presentasi untuk pembelajaran Dapat mengoperasikan media (OHP. 1 x 50 menit BAB II. Kompetensi dan Indikator Alokasi No 1 Kompetensi Mengetahui rasional penggunaan media dan memiliki pengetahuan dan pemahaman untuk memilih media dalam pembelajaran Indikator Dapat menyebutkan alasanalasan digunakanya media dalam pembelajaran Dapat menjebutkan pengertian media pembelajaran Dapat menyebutkan fungsi/peranan media dan memberikan alasan-alasannya digunakan dalam pembelajaran Dapat menyebutkan dan mengidentifikasi berbagai jenis media. LCD) untuk presentasi mengajar Dapat mengimplementasi teknik presentasi dalam proses pembelajaran. 2 x 50 menit waktu 8 . KEGIATAN BELAJAR 1 A.

Oleh karena itu dalam merencanakan 9 . Dapat menjelaskan alasanalasan pemilihan media Dapat menilih media untuk pembelajaran B. Kurikulum tersebut disebut dengan KTSP (Kurikulum Tingkat Satuan Pendidikan). Hal ini dikarenakan adanya pemahaman bahwa kompetensi bukan sekedar pengetahuan (demonstrating the knowledge) tetapi lebih merupakan kemampuan/kesanggupan melakukan (ability to do). Dalam hal ini mengandung pengertian bahwa pembelajaran harus mengimplementasikan belajar untuk mengetahui. Prinsip belajar mengajar menggunakan empat prinsip yaitu learning to know. Uraian Materi 1. Sebelum KTSP di resmikan telah diujicoba pelaksanaannya dengan Kurikulum Berbasis Kompetensi (KBK). adanya perobahan cara berpikir produktif menjadi reflektif (productive thinking menjadi reflective thinking). Dengan demikian KTSP juga merupakan kurikulum yang berbasis kompetensi. learning to life together dan learning to be. Rasional Penggunaan Media dalam Pembelajaran Kurikulum baru (2004) telah diresmikan penggunaannya sebagai pedoman sekolah dalam rangka melaksanakan pendidikan. Jadi KTSP merupakan hasil penyempurnaan dari KBK. belajar untuk dapat melakukan .Dapat menjebutkan kriteria pemilihan media. learning to do. Oleh karena itu dalam pelaksanaanya KTSP juga menuntut adanya kreativitas dan inovasi dalam pembelajaran. belajar bekerjasama untuk mendapatkan sesuatu dan belajar menjadi sesuatu yang dipelajari. adanya perobahan paradikma dari mengajar menjadi belajar (Teaching menjadi Learning).

Menggunakan media dan menggunakan teknik presentasi yang baik merupakan salah satu cara untuk itu. Karena peserta didik tertarik perhatiannya. sehingga akan mencerdaskan. siapa. mengapa. STANDAR KOMPETENSI •Komp dasar •Pengalaman belj • • • • Menyenangkan Mengasyikkan Mencerdaskan Menguatkan •Berkompetensi •Cerdas •Tangguh •Berketerampilanhidup 10 . kapan . Dalam melaksanakan pembelajaran didisain kegiatan yang menyenangkan. Memberikan materi yang bermanfaat dan luas akan menambah wawasan dan menguatkan. dan bagaimana) dan merata kepada seluruh peserta didik akan melatih daya piker.dan menarik. Ilustrasi berikut ini akan memperjelas pemahaman. maka mereka akan merasa asyik sehingga tidak terasa waktu yang tersedia telah habis. Menggunakan kegiatan teknik bertanya yang bervariasi dengan menggunakan pola 4 W dan 1 H (apa. Agar pembelajaran menyenangkan seorang guru dituntut kreativitasnya untuk menciptakan situasi dan kondisi yang kondusif. mengasyikkan. mencerdaskan dan menguatkan.pembelajaran memerlukan metode dan strategi yang benar-benar dapat membawa peserta didik untuk mencapai kompetensi yang diharapkan sehingga peserta didik memperoleh pengalaman belajar yang bermanfaat bagi pengembangan keterampilan hidupnya.

Sebagai sumber belajar tidak harus bergantung dari guru. kerjasama.Dalam pelaksanaan pembelajaran digunakan pendekatan kurikulum berbasis kompetensi yang memiliki ciri-ciri sebagai berikut • Menekankan ketercapaian kompetensi siswa secara individu dan kelas • • • • Menekankan Learning Outcomes dan keberagaman Variasi Pembelajaran (strategi. Kemampuan Sosial Mengembangkan Inkuiri siswa Mengembangkan Keterampilan Pemecahan masalah Mengembangkan. dan solidaritas 11 . sehingga keberadaannya sangat mutlak diperlukan. Di sinilah peran media diperlukan sebagai sumber belajar alternatip. Dapat dimungkinkan terjadi keberragaman pengalaman belajar yang diperolehnya. Media juga merupakan subsistem dari proses pembelajaran. • • • • • • • • • • Berpusat pd siswa Learning by doing Mengembangkan. di samping sebagai pembawa pesan/informasi. karena guru bukan satu-satunya sumber belajar. Bahkan variasi kegiatan peserta didikpun dimungkinkan berbeda atau bervariasi. KBM yang berbasis kompetensi akan memiliki ciri-ciri sebagai berikut. metode) Guru bukan satu-satunya sumber belajar Penilaian menekankan proses dan hasil demikian pembelajaran harus dirancang lebih kearah Dengan pembelajaran individu/kelompok-kelompok kecil agar pengembangan individu lebih nampak nyata. Kesadaran sebagai WNI YG BAIK Life long learning Memadukan kompetensi. Kreativitas siswa Kemampuan menggunakan IPTEK Mengembangkan. Media sangat penting dalam menciptakan KBM yang kreatip dan bervariasi.

Dalam pelaksanaan KTSP juga diharapkan penggunaan pendekatan CTL (Contectual teaching and Learning) yang memungkinkan adanya variasi kegiatan seperti mengkonstruksi. inkuiri. tugas/proyek. modeling. bertanya. refleksi dan penilaian otentik. 2. Oleh karena itu didalam mengajar harus memanfaatkan media agar dapat mencapai kompetensi yang diharapkan secara efektif dan efisien. Terjadi pula kekurang ragaman pengalaman yang diterima oleh siswa sehingga hanya tujuan pembelajaran pada ranah kognitif tingkat rendah sajalah yang 12 . Pengertian dan Fungsi Media Pembelajaran Keluhan seringkali kita dengar dari lapangan. Keluhan serupa misalnya menurunnya kemampuan guru dalam mengelola pembelajaran manakala guru tersebut pindah kelas dalam waktu yang berturutan. hsl karya/produk. Pelaksanaan penilaian juga digunakan pendekatan penilaian berbasis kelas yaitu : • Dilaksanakan terpadu dengan KBM (hsl kerja siswa/porto folio. kinerja/performance dan tes tertulis/ paper and pen ) • Untuk – Umpan balik siswa – Memantau kemajuan – Umpan balik Guru – Informasi ttg efektivitas pendidikan – Pencapaian kompetensi setiap siswa meski kecepatannya berbeda Dari uraian tersebut diatas dapat diambil kesimpulan bahwa media sangat penting peranan dan kedudukannya dalam proses pembelajaran. bahwa guru mengalami kekurangan waktu untuk menyampaikan isi kurikulum kepada para siswanya sehingga berakibat kurang optimalnya pencapaian tujuan pembelajaran. sehingga terjadi kurang adanya kesamaan kualitas pengelolaan pembelajaran antara kelas paralel. diskusi. bekerjasama.

6) Lingkungan. 3) Bahan. Salah satu temuan yang disarankan oleh Sector Review Team (1988) adalah bahwa penggunaan media pembelajaaran akan mengurangi beban kerja para guru hingga sepertiganya (Sadiman. adalah semua ajaran atau informasi yang akan dipelajari. Pemanfaatan berbagai sumber belajar akan memberikan kontribusi yang sangat besar dalam keefektifan pencapaian tujuan pembelajaran. adalah perangkat keras yang digunakan untuk menyajikan pesan yang tersimpan dalam bahan. lingkungan untuk menyajikan pesan. adalah perangkat lunak yang mengandung pesan yang perlu disajikan baik dengan bantuan alat penyaji maupun tanpa alat penyaji. 4) Alat. adalah prosedur atau acuan yang disiapkan untuk digunakan orang atau dalam menggunakan alat. Gagne(1970) mengartikan media sebagai berbagai jenis komponen dalam lingkungan siswa yang dapat merangsangnya 13 . 1994). 1996). Kata media berasal dari bahasa Latin dan merupakan bentuk jamak dari medium. Sumber belajar tersebut bermacammacam yaitu: 1) Pesan. 2) Orang . sumber belajar adalah segala macam sumber yang memungkinkan siswa belajar. Setiap media pendidikan mempunyai kelebihan dan keterbatasan tersendiri. 1996). yang secara harfiah berarti perantara atau pengantar. Media adalah perantara atau pengantar pesan dari pengirim ke penerima pesan (Palmer W. Dikemukakan oleh Association for Educational Communications Technology (AECT). yang bertindak sebagai penyimpan dan pengolah pesan. Telah kita ketahui bahwa tidak ada satu jenis media pembelajaran yang paling cocok untuk semua tujuan pembelajaran. Dalam proses pembelajaran sumber-sumber belajar tersebut berfungsi sebagai media pembelajaran. bahan. adalah situasi sekitar dimana pesan diterima ( Sadiman. 5) Teknik. Keluhan-keluhan tersebut terjadi antara lain karena guru menganggap dirinya adalah satu-satunya sumber belajar bagisiswanya.dicapai.

perhatian dan minat serta perhatian penerima pesan sehingga dapat mendorong terjadinya proses belajar. Sementara itu Briggs (1970) mengatakan media sebagai alat untuk memberikan perangsang bagi siswa supaya proses belajar terjadi. dilupakannya komponen sumber belajar dan media dalam sistem pengembangan instruksional. tetapi kita dapati istilah alat peraga pada buku petunjuk pelaksanaan kegiatan belajar mengajar. Itupun tercantum pada format RP atau rencana pembelajaran. ( Depdikbud Dirjendiknas/ 1994 ) Dirjen Pendidikan Dasar dan Menengah pada tahun 1995 juga telah menerbitkan buku untuk pedoman latihan kerja pelatihan tenaga 14 . Mungkin inilah sebabnya sehingga penggunaan media pembelajaran di sekolah tidak populer. kurangnya pemahaman tentang media. Dengan demikian media pembelajaran tidak terintegrasi dalam kurikulum. Dalam kurikulum sekolah tahun 1994 berserta petunjuk pelaksanannya tidak terdapat istilah media pembelajaran. (Sadiman. 3. perasaan. posisi pelaksanaan kurikulum berbasis media pembelajaran akan sangat membantu dalam membentuk kopetensi siswa dalam tiap rumpun pelajaran. bahkan Menghadapi dalam kurikulum sekolah . Beberapa faktor lain yang barangkali menjadi sebab antara lain : adanya perbedaan pesepsi tentang pemahaman sumber belajar dan media sumber belajar dan pembelajaran. komptetensi. 1996). Apapun batasan yang diberikan. ada persamaan-persamaan di antaranya yaitu bahwa media pembelajaran adalah segala sesuatu yang dapat digunakan untuk menyalurkan pesan dari pengirim ke penerima pesan dan dapat merangsang pikiran. dan Wong mengemukakan media sebagai alat atau mekanisme untuk menyalurkan pesan. Konsep Media dan Sumber Belajar Sampai sekarang masih terdapat persepsi yang berbeda-beda mengenai pengertian media pembelajaran.untuk belajar.

dan sumber belajar.pendidikan melalui projek peningkatan SMU. untuk menganalisis masalah-masalah pembelajaran (AECT. Dengan demikian Teknologi instruksional merupakan proses kompleks. 022/C/ R/Kep/ 1979.1977: 155) Pengembangan instruksional yang dilakukan menggunakan pendekatan sistem. Dir. Di antara sumber belajar yang merupakan media adalah pesan . orang. terintegrasi. peralatan. alat. Padahal istilah media telah dipakai sejak 1979 dalam pedoman umum tentang media pendidikan dalam Surat Keputusan Dirjen Dikdasmen No. 1995) Dalam sejarah pertumbuhan teknologi instruksional istilah alat peraga dikatakan sebagai istilah tertua untuk menunjuk alat bantu ajar ( bukan alat bantu pembelajaran). meliputi ide. prosedur. dan setting atau lingkungan. dan titik perhatiannya adalah peserta didik (learner). teoriteori belajar. bahan. Untuk menyamakan persepsi tentang konsep media disarankan menggunakan konsep yang dikembangkan secara akademik yang ditempuh melalui penelitian maupun kajian konsepsional oleh Association of Educational and Communication Technology (AECT). dan hasil-hasil penelitian pendidikan. bahan dan alat.Pendidikan Menengah. Pembelajaran menurut konsep komunikasi asalah saling berinteraksi dengan sumber belajar. ) meskipun isinya mengenai media. orang.( Depdikbub. Media Instruksional merupakan salah satu komponen atau sub set dari sumber belajar Sumber belajar merupakan domein atau kawasan fungsi Teknologi Instruksional. sehingga pengertian media menurut AECT segala bentuk dan saluran yang digunakan untuk adalah menyalurkan 15 . yang judul bukunya adalah Penggunaan Alat Peraga. Dalam teknologi instruksional unsur intinya adalah belajar ( subjek yang belajar). Pengertian sumber belajar dalam teknologi pendidikan meliputi : pesan. teknik. dan organisasi. penerapan teknologi informasi dan komunikasi.

Pertumbuhan konsep Media Instruksuional Konsep tersendiri. situs di internet . museum. koran.ber belajar. dan papan tulis ( AECT. buku. laboratorium . yang cara menggunakannya menurut kebutuhan. 1981. media pendidikan dengan memiliki riwayat perkembangan teknologi sejajar perkembangan konsepsi 16 . Pengertian tentang konsep media menurut AECT adalah segala sesuatu yang dapat digunakan untuk menyalurkan pesan sehingga dapat merangsang pikiran.pesan atau informasi. lingkungan masyarakat. video. Sumber belajar yang dapat dimanfaatkan oleh guru tidak hanya yang sengaja disediakan oleh lembaga pendidikan. Sedangkan sumber belajar adalah segala daya yang dapat dimanfaatkan untuk memfasilitasi belajar manusia. sumber belajar dapat dibedakan menjadi (1) sumber belajar yang dirancang dibuat untuk membantu ( by designed ) yang sengaja meliputi : buku. di samping guru. atau semua sarana yang mampu menyajikan pesan. dan sebagainya. brosur. OHT. Dalam sistem pembelajaran sekarang ini sejalan dengan kemajuan bidang ilmu dan teknologi seorang guru tidak lagi dipandang sebagai satu-satunya sum. Sumber belajar diartikan sebagai segala daya yang dapat dimanfaatkan untuk memfasilitasi seseorang belajar Dalam perkembangannya. dan (2) sumber belajar yang tersedia ( by utilization) yang tersedia di sekeliling kita misalnya. tetapi juga yang terdapat di sekeliling kita. perasaan. majalah. slide. nara sumber. pertokoan. dan lain-lain memang dibuat khusus untuk pembelajaran. dia bukan satu-satunya sumber belajar. VCD. gambar atau foto. film. kaset audio.. Sumber belajar bukan hanya berupa buku-buku. Bagaimanapun pentingnya guru. dan minat siswa sehingga dapat mendorong terjadinya proses belajar siswa Pustekomdikbud. : 25 ) Media sebagai hasil ( dari revolusi komunikasi dapat dipakai untuk sarana pencapaian tujuan pendidikan. pembelajaran ensiklopedia.1997 : 167) 4. pasar. perpustakaan. perhatian.

pola pembelajaraan dalam sebagai komponen dalam pengembangan disain kaitannya dengan perkembangan alat peraga hingga media instruksional. benda sebenarnya. 90) 17 . yang ditandai oleh munculnya alat audio visual. Kemudian pada tahun tujupuluhan digunakan pendekatan sistem yang kemudian menempatkan prioritas tujuan pembelajaran dari BS. Pada saat itu mulai dipakai istilah media instruksional. Sesuai dengan sejarah pertumbuhan teknologi instruksional. Dengan masuknya teknologi komunikasi informasi. objek dan alat lain yang dapat menyangkut hubungannya memberi pengalaman kongkrit. instruksional . media dan sumber belajar. Alat peraga terlepas dari kurikulum dan tidak dilibatkan dalam proses pengembangan instruksional. tetapi tidak dengan instruksional atau pembelajaran. Sementara itu muncul pengaruh hasil penelitian Skinner tentang teori tingkah laku yang memasuki bidang pengajaran. 1977. Banyak teori penelitian di bidang pendidikan yang kemudian diterapkan dan hasil ke dalam teknologi pendidikan. berpengaruh pula pada dunia pengajaran ( sehingga dalam kegiatan belajar mengajar digunakan Audio Visual Aid AVA) bukan Audio visual instruction Mulai saat itu alat bantu ajar beralih fungsi menjadi alat penyalur pesan.. yang umumnya berupa alat bantu visual seperti gambar. Pada awalnya dikenal istilah alat bantu ajar ( teaching aid) atau alat peraga. ( AECT. Bloom sehingga tujuan pembelajaran dirumuskan sebagai perubahan tingkah laku seperti diperkenalkan Skinner.instruksional. Bagan ini memperlihatkan pola. maka pola – pola instruksional mengalami perubahan seperti tampak dalam bagan berikut. model (tiruan).

KURIKULUM 1 2 PERAGA 3 MEDIA 4 MEDIA GURU GURU GURU PESERTA DIDIK KETERANGAN : Nomor 1 pola pembelajaran di mana guru sebagai satu-satunya yang ditetapkan. ahli media. media pembelajaran telah diprogram dengan melibatkan guru bidang studi. sehingga peserta didik dapat langsung memanfaatkan media sebagai sumber belajar yang dirancang dengan bimbingan tutor ( ketua kelompok. Memberikan fasilitas pembelajaran siswa sehingga dapat merangsang siswa untuk berfikir. berdasarkan kurikulum sudah ada komponen alat peraga yang tersedia. Dewasa ini di sekolah telah memulai memanfaatkan media seperti pola ke 3. dirancang telah masuk komponen oleh materi guru dan dengan strategi pertinmbangan tujuan pembelajaran. Pola ke 2 sumber belajar. Manfaat dan Nilai praktis Media Sebagai Sumber Belajar Manfaat dan nilai praktis media sebagai sumber belajar adalah : a. Pada pola ke 4. sanggar. penggunaannya. yang penggunaannya tergantung dari guru kelas. media pembelajaran yang Pada pola 3. dan fihak terkait lainnya. atau guru) 5. mengaktifkan dan memotivasi siswa 18 .

dikunjungi. Media audio visual diam yang menyajikan suara gan gambar contohnya slide suara. mengatasi keterbatasan pengalaman dan kemampuan guru e. mengumpulkan. dapat memberikan peluang mengembangkan pola-pola instruksional bagi guru d. Media audio misalnya radio. contohnya film. slide. menyajikan tulisan jarak jauh dalam ujud d. dan Little Media yaitu media sederhana seperti slde. grafis. memperoleh 7 a. Ia juga membedakan media rekaman dan media telekomunikasi. Dapat menyajikan sesuatu yang tidak mungkin diadakan. audio still picture. Media audio semi gerak. menghitung. simbol dan garis. gambar. menafsirkan. video. g. dan 6. VCD TV. c. e. kaset audio. Berdasarkan identifikasi itu Brets klasifikasi sebagai berikut. CD audio 19 . Dengan kata lain memberi peluang mengembangkan ketrampilan proses. visual. Rudy Brets (1971). Bentuk visual dibedakan visual gambar. Memberi peluang siswa mengembangkan kemampuan mengamati. media cetak. b. Media visual gerak contohnya film tanpa suara f. mengukur. peta DSB. Media visual diam misalnya OHP. Dapat memberikan pengalaman belajar yang kongkrit dan langsung. radio. c. mengklasifikasi. kode suara misalnya dengan morse. dan gerak. Dapat memberi informasi akurat dan terbaru . meneliti. Film. telepon. OHP. filmstrip. mengidentifikasi ciri utama media menjadi 3 unsur : audio. Media audio visual gerak yang dapat menyajikan unsur suara dan gambar yang bergerak.b. Klasifikasi dan Jenis Media Pembelajaran Wilburn Schramm membedakan adanya Big Media yaiu media yang canggih seperti Televusu. menerapkan dan mengkomunikasikan kemampuankemampuannya . komputer.

Pengalaman melalui pameran / display h. Pengalaman langsung dan melakukan sendiri bisa Selanjutnya ia 20 .Elly membagi media menjadi delapan dalam bukunya Teaching and Media. gambar. Simulasi Gagne menyatakan bahwa media adalah komponen dalam lingkungan siswa yang dapat merangsang siswa untuk belajar. memberikan definisi media sebagai orang. Pengalaman melalui lambang kata verbal b. bahan dan kegiatan ( aktifitas ) yang menciptakan kndisi seseorang mendapatkan pengetahuan keterampilan dan sikap. Pengalaman melalui dramatisasi k. membagi jenis media sebagai berikut. Pengalaman melalui kegiatan demonstrasi j. gambar d. Pengalaman melalui lambang visual. a. Berikut dimulai dari kelas paling rendah a. Gambar gerak f. Edgar Dale mengklasifikasi berdasar pengalaman belajar yang digambarkan dalam bagan kerucut Edgar Dale. Pengalaman melalui benda tiruan l. peta. Rekaman audio g. Pengalaman melalui gambar hidup f. Pengalaman melalui televisi g. dan lain-lain Donald . Pengajaran terprogram h. Pengalaman melalui widya wisata i. Media sebenarnya b. Penyajian verbal c. Pengalaman melalui rekaman audio. majalah. gambar. koran.h. modul. diagram c. Penyajian graphik d. radio e. Gambar diam e. Media cetak seperti buku. Pengalaman melalui gambar seperti foto. album.

flow chart. model perbandingan. bagan bongkah. baik proyeksi diam maupun gerak. dan grafik lingkatan ( grafik pie) c) Media Poster d) Karikatur 21 . dan lain0-lain. penampang. d.. organogram. media bagan petunjuk / penuntun.S. Dwidjosoemarto. aneka ragam media itu ditentukan oleh dalam pelaksanaan proses belajar mengajar. replica. Media grafis c. Jenis media di sekolah dikelompokkan sebagai berikut. baga daan ( brance chart). root chart. cara penampilan. miniatur..model susunan. a. bagan wakktu. grafik gambar atau pictograph. grafik garis grafik bentuk peta. a) Media Chart yaitu penyajian diagramatik meliputi : tree chart. model kerja. maket. Media pandang dengar ( audio visual aids) f.1980: 20) 1) Media asli dan tiruan a) Spesimen makhluk hidup maupun tidak hidup b) benda asli bukan makhluk hidup c) model tiruan``benda asli ( yang diperkecil atau dioerbesar) misalnya model irisan. Media dengar ( audio) e. globe. b) Media grafik : grafik batang. Media Cetak ( . Agar supaya tidak membingungkan. tabular chart. baik menurut bentuk. model utuh.Secara teoritis masih banyak ahli mengklasifikasi jenis-jenis media pembelajaran. 2) Media Grafis Media grafis ialah semua media yang berupa tulisan / gambar antara lain termasuk jenis ini adalah. aneka ragam tujuan pembelajaran dan adanya perbedaan ketersediaan bahan di sekolah. tujuan penggunaan. bagan tembus pandang. boneka. bagan skematik. Media asli / tiruan b. Media visual atau media proyeksi.

TV. Hal ini akan berdampak positip terhadap hasil pembelajaran. Koran. Media cetak juga ada yang ditampilkan dengan Video. liftlet. dan ada pula yang disertai suara. 4. 22 . Pemilihan Media Pembelajaran Pemilihan media yang tepat akan meningkatkan motivasi dan konsentrasi belajar. dan yang bergerak misalnya 6. buku. 7. ialah slide suara dn film strip.e) Still picture / foto f) Media papan g) Media Peta 3) Media proyeksi Ada dua macam ialah media proyeksi diam dan bergerak. majalah. modul. dan sumber lain dari intertnet.) Media Audio Termasuk media audio ialah kaset audio dan radio.) Media Cetak Media cetak misalnya handout. VCD komputer yang berisi bahan ajar. album. brosur. sehingga pesan pembelajaran akan dengan mudah diserap peserta didik. 5) Media pandang dengar Media audio visual diam.

kontraksi otot.penampang gerakan sendi. ANIMASI 11 DAFTAR VIDEO PUSTAKA 12 -senam 13 Teksbook : Penjelasan. proses. harus ) dengan arah gerak dikuti anak panah.gambar berbagai macam sendi Struktur Otot . Weisz. keterangan backsound.susunan tulang rangka tubuh . McGrawHill Sobota ( bukubuku kedokteran Alvin Nason. yang memperlihatkan zona gelap terang 3 - 23 . (1963).1 .gerak orang dengan animasi. ( memutar.penampang membujur mundur dll) . Modern Biology . (1965). Narasi (tulang ) 2. Struktur rangka – dan judul dari struktur. . John Willey & Sons. New York sesuai teks . naik melintang tulang turun. Inc. The Science of Biology.penampang melintang . Musik. fungsi. sesuai gerakan sendi pada no.berbagai kesehatan Biologi 2 ( jika ada / SMA 2004 tidak Paul B.MEDIA TEKS 8 AUDIO 9 GAMBAR/FOTO 10 Gambar : 1. maju Struktur Persendian .jenis jenis tulang .

ketika mengembangkan silabus yang selanjutnya dikembangkan menjadi rencana pembelajaran.fungsi struktur.berbagai sendiMenyusu dengan macam gerak n bagianadanya energi . gerak. Struktur dan Memilih (Click SISTEM 1 Mengkaitkan 1.proses bagian organ. Menjelaskan. GBIPM dikembangkan dari silabus menjadi format seperti contoh diatas. sendi. dalam otot. metode serta materi bahan ajar. gambar berkaitan . and drag) fungsi. proses kan. Mencontohkan sistem gerak. Program media ini INDIKATOR POKOKKOMPETENSI PENCAPAIAN LATIHAN NO NO POKOK JUDUL DASAR (TPU) HASIL BELAJAR DAN TES KODE MATERI (TPK) 1 2 3 4 5 6 7 1. otot. Pemilihan media dapat dilakukan melalui penyusunan GBIPM (Garis Besar Isi Program Media). strategi dalam peksanaannya dikembangkan menjadi program media. sendi. menyebabkan kelainan pada sistem gerak 24 . tulang. pada menggambarkan gerak. Terdapat 13 kolom. otot ke bagiandalam penyakit yang struktur dan bagian sistem gerak dapat terjadi fungsi : gambar 2. :Rangka. 3. Berbagai menjadi satu yang berkaitan contoh organ utuh energi otot. kolom 1 s/d 5 sama dengan silabus dan kolom 6 s/d 13 merupakan pengembangan GBIPM.Pemilihan media dilakukan oleh guru. Media sebagai komponen pembelajaran yang terjalin secara sistemik dengan perencanaan. yang dapat dan otot. Media yang dipilih telah dikaji sesuai dengan tujuan. keterangan. terjadinya gerak. kegiatan. menjelaskan.sangkan proses gerak nama-nama terjadinya 2. quiz beberapa yang disebabkan penyakit / oleh kelainan kelainan pada tulang. penyakit pada Multiplechoise 3. PADA MANUSIA dan kelainan/ menggambarkan sendi. Macam dan pada sistem -rangka (tulang) Proses gerak Menuliskan gerak pada -persendian keterangan -berbagai -otot manusia macam gerak pada dalam kaitannya yang mampu gambarMema pada sistem dilakukan . GERAK Mengidentifikasi.

Memilih media yang cocok dengan tujuan dan materi e. Jenis media/sumber belajar apakah yang dapat dipakai secara efektip dan efisien untuk mencapai tujuan tersebut. d. pengadaan. Kematangan siswa Langkah-langkah pemilihan media dapat dilakukan sebagai berikut. tujuan apakah yang harus dicapai. Program media meliputi langkah kegiatan perencanaan. Fungsinya dalam PBM b. Kondisi pengadaan media f. Hal ini berkaitan dengan kompetensi yang diharapkan untuk mata pelajaran tertentu. Strategi pembelajaran yang dipilih c. b. Memilih metode yang sesuai d. Hasil belajar yang bagaimana yang harus diperoleh atau pengalaman belajar/ perubahan apa yang dialami peserta didik Terdapat beberapa hal yang harus diperhatikan dalam merencanakan media yaitu : 25 . a. a. a. Pertimbangan dalam memilih media.siswa dan administrasi. ujicoba dan evaluasi. Kondisi yang bagaimana yang diperlukan peserta didik untuk mencapai tujuan tersebut. ahli media. Memilih jenis perangkat keras dan perangkat lunak yang cocok Secara teoritis untuk menentukan media ditempuh melalui prosedur pemilihan media sebagai berikut. produksi. Menghubungkan tujuan dengan aktivitas belajar c. pembiayaan. ISI bahan/materi d.melibatkan guru. Menentukan tujuan b. Pemilihan media didasari atas pertimbangan sebagai berikut. Kelompok belajar/siswa e. c. 8.

PENETAPAN STRATEGI SPESIFIKASI MATERI INDIVIDUAL KELOMPOK PENELITIAN ENTERING BEHAVIOR ALOKASI WAKTU TUJUAN EVALUASI PERFORMA ALOKASI RUANG SPESIFIKASI TINGKAHLAKU PILIH MEDIA ANALISIS FEED BACK Bagan tersebut dapat digunakan untuk memilih media. Konsep dan model pengembangan media menurut D. Elli sebagai berikut. e. Media juga harus mampu dijadikan alat evaluasi proses belajar f. Mementingkan preoritas yang harus dipilih sesuai dengan tujuan d. Untuk memudahkan pemahaman bagan tersebut dapat diubah dalam bentuk matrik sebagai berikut 26 . Program media harus memberikan dorongan. bahan motifasi dan pemikiran serta dapat membantu menetapkan tujuan instruksional. Memperhatikan variabel hambatan dan alternatip dalam mengidentifikasi kebutuhan pembelajaran.a. Diusahakan berkonsultasi dengan ahli media dan mempertimbangkan bahan dan pembiayaan. Harus didasarkan pada kebutuhan dan interes pemakai c. b.

video simulasi Species. VCD Handout.TPK MATERI KEG. BM Mendengarkan. Kegiatan Belajar Mengajar. radio OHT. grafis praktek Workshop Percobaan Demontrasi observasi Model. BM METODE MEDIA Keterkaitan antara TPK. mencatat. makalah. diagram. Materi.peta. disain. situs lapangan Persyaratan media yang baik adalah sebagai berikut 27 . Metode dan pilihan media dapat digambarkan pada contoh berikut ini. peta. mengamati Diskusi Tanya jawab Mencatat MEDIA Audio kaset. TPK MATERI METODE Ceramah bervariasi KEG.benda Studio.

PERSYARATAN MEDIA u V ISIBLE u u u u u : MUDAH DILIHAT : MENARIK : SEDERHANA : BERMANFAAT : BENAR : MASUK AKAL/SAH I NTERESTING S IMPLE U SE FULL A CCURATE L EGITIMATE u S TRUKTURE : TERSUSUN DG BAIK 9. Contoh-contoh Media Grafis sebagai berikut 28 .

PENGEMBANGAN MEDIA 1 ANALISIS AUDIENCES 2 RUMUSAN KOMPETENSI 4 MATERI ALAT UKUR DISAIN / ISI 3 5 7 6 PRODUKSI UJI COBA 29 .

PENGEMBANGAN PROGRAM MEDIA MISI TUJUAN PRESENTASI MATERI DISAIN MEDIA GRAFIS PRINSIP DISAIN GRAFIS OHT SATU FRAME SATU SEDERHANA KOMPLEK BEBERAPA FRAME SATU TEKNIK OVERLAY BUKA TUTUP HURUF / VERBAL 20 KATA FONT = 16 .40 30 .

MEDIA GRAFIS 100 80 60 40 20 0 1st 2nd 3rd 4th Q tr Q tr Q tr Q tr West North East PENGGUNAAN TANDA PANAH a A b a C B b 31 .

90 80 70 60 50 40 30 20 10 0 East West North 1st Qtr 2nd Qtr3rd Qtr 4th Qtr KESAN RUANGAN 32 .

180 160 140 120 100 80 60 40 20 0 1st Qtr 2nd North West East 3rd Qtr 4th Qtr PIE CHART 1st 2nd 3rd 4th 33 .

ORGANOGRAM DIREKTUR UTAMA STAF AHLI STAF AHLI DIREKSI ASISTEN BAGAN GARIS WAKTU 100 500 1000 1500 1945 JAMAN HINDU JAMAN KERAJAAN JAMAN KOLONIAL JAMAN JEPANG JAMAN RI 34 .

3. Sebutkan dan jelaskan perkembangan pola mengajar serta berikan contoh ilustrasi masing-masing kelemahan dan keunggulannya. Latihan TUGAS : 1. 2.PIKTOGRAFI = 100 PENGUNGSI TNI GAM C. Tes Formatif Soal uraian : (untuk tugas dikumpulkan sebagai respound peserta) 1. Buatlah GBIPM dari silabus mata pelajaran yang saudara ampu 2. 35 . Buatlah salah satu media grafis dari mata ajar yang saudara ampu D. Buatlah satu buah Rancangan Program Media dari GBIPM yang telah saudara buat. Mengapa mengajar harus menggunakan media ? jelaskan alasan saudara.

cara berpikir produktip menjadi reflektip dan (d ). harus membuat terlebih dulu B. VCD B. Soal : Pernyataan tersebut merupakan konsep media yang dinyatakan oleh: A. Merepotkan dan membebani guru Soal : Dari pernyataan tersebut yang benar adalah : A. perasaan. dan minat siswa sehingga dapat mendorong terjadinya proses belajar siswa. Meningkatkan daya serap siswa (d). LCD 36 . AECT 5. Kesesuaian dengan tujuan dan bahan C. (a) dan (b) B. 4. Flip Chart D. (a) dan (d) C. Ada bermacam-macam sumber belajar yaitu yang benar terdiri dari : A. Bright D. (b). OHT E. harganya mahal dan modern D. 6. Yang termasuk bahan pertimbangan dalam memilih media dalam pembelajaran diantaranya adalah : A. pesan dan bahan ( boleh pilih lebih dari satu jawaban). Pengoperasiannya sulit. Oleh karena itu guru harus (a). Demonstrating the knowledge. perhatian. W B. Menggunakan media dan menggunakan teknik presentasi merupakan salah satu cara mengelola pembelajaran akan : (a) menarik perhatian siswa. (c)dan (d) 3. Segala sesuatu yang dapat digunakan untuk menyalurkan pesan sehingga dapat merangsang pikiran. Inovatip dan Kreatip (b) Paradikma Teaching berubah menjadi learning (c). Gagne C. D. Membosankan siswa (c). (a) dan (c) C. Sumber belajar adalah segala macam sumber yang memungkinkan siswa belajar. Palmer. (b) dan (d) D. (a) dan (b) B. Apa yang menjadi pertimbangan dalam memilih media dalam proses pembelajaran ? Sebutkan dan berikan alasan-alasannya. Lingkungan. (c) 1. KTSP menuntut adanya perubahan dalam mengelola proses pembelajaran. pesan dan orang B. Soal : dari pernyataan tersebut yang tidak sesuai adalah : A. Soal Pilihan Ganda : 1.3. Manakah media yang paling baik untuk mengajar A. Alat dan teknik C. (d) D.

Fungsi GBIPM (Garis Besar Isi Program Media) adalah A.7. Perencanaan Program Media dalam pembelajaran (boleh pilih lebih dari satu jawaban) 37 . instrument perencanaan media dalam pembelajaran B. Instrument Pengembangan Media dalam pembelajaran C. Instrument Pemilihan Media dalam pembelajaran D.

Komunikasi dalam proses belajar mengajar terjadi komunikasi edukatip. yaitu terjadi interaksi antar komponen komunikasinya yang terdiri dari guru. Dengan demikian akan komunikasi timbal balik dua arah antara guru dan peserta didik. Kompetensi dan Indikator Alokasi No 2 Kompetensi Mampu Indikator Dapat menjelaskan prinsip dan 1 x 50 menit waktu merencanakan dan unsur disain media membuat media presentasi serta Dapat membuat disain dan produksi media OHT dan Slide mempresentasikan Presentasi untuk pembelajaran dalam pembelajaran Dapat mengoperasikan media (OHP. 38 . KEGIATAN BELAJAR 2 A. peserta didik dan media yang digunakan. Teknik Komunikasi dan Presentasi dalam Proses Pembelajaran Proses pembelajaran pada hakekatnya merupakan proses komunikasi. Uraian Materi 1.BAB III. LCD) untuk presentasi mengajar Dapat mengiplementasikan teknik presentasi dalam pembelajaran B.

peserta didik berperan sebagai penerima pesan sedangkan media berperan sebagai penyalur pesan. BEL. Pesan yang disampaikan dalam hal ini adalah berupa latihan/belajar/pengalaman atau pengetahuan/ilmu yang dimiliki guru untuk disampaikan kepada peserta didik. PENGALAMAN SUMBER PESAN ANCOD MEDIA PNRM PESAN DECOD GANGGUAN MODEL KOMUNIKASI Instructional Media (Shannon. guru berperan sebagai pengirim pesan/informasi. Sebelum diterima oleh penerima pesan diolah dikembalikan pada karakteristik semula (decode) agar dapat diterima oleh penerima pesan.LAT. 39 . Dalam hal ini terjadi komunikasi timbal balik antara guru dan peserta didik. BEL.Sebelum pesan disalurkan ke penerima diperlukan pengolahan pesan (ancode) sesuai dengan kebutuhan dan karakteristik media yang digunakan agar dapat disalurkan ke penerima dengan gangguan yang seminimal mungkin. Setelah diterima pesan ini menjadi stimulus bagi peserta didik dan selanjutnya peserta didik merespound dan bertindak sebagai pengirim pesan disampaikan melalui media dan diterima oleh guru. Seperti ditunjukkan pada ilustrasi diatas. PENGALAMAN LAT. Schramm.

wawancara dan forum-forum komunikasi yang lain. Dalam hal ini sumber atau selanjutnya disebut guru akan banyak menggunakan bahasa tubuh (nonverbal) untuk memberikan penegasan. Kemampuan dan keterampilan tersebut dikenal dengan istilah oral presentation skill. 40 . Diantaranya harus mampu mempresentasikan pesan/materi pelajaran dengan baik. pelatihan. Guru harus memiliki kemampuan mengelola proses komunikasi agar gangguan komunikasi tetap dapat ditekan seminimal mungkin. sehingga terjadi konsentrasi dalam belajar yang akhirnya terjadi penyerapan materi secara optimal. guru harus menguasai 10 keterampilan mengajar. Agar pesan/informasi dapat disampaikan secara baik dan dapat difahami oleh penerima pesan/informasi. menarik dan menyenangkan. pesan disampaikan dalam bentuk ucapan melalui mulut/oral dalam bentuk verbal. penekanan ucapan dan gaya bicara yang dapat lebih memberikan daya tarik dan menimbulkan atensi terhadap informasi yang sedang disampaikan. sumber pesan memerlukan kemampuan dan keterampilan mengkomunikasikan / mempresentasikan pesan yang akan disampaikan secara lisan. rapat. Presentation skills ini diperlukan pada saat proses pembelajaran. simposium. dinamis. Untuk presentasi dengan baik tidak hanya penguasaan materi tetapi juga harus ditunjang penguasaan teknik komunikasi yang baik. seminar. Dalam komunikasi secara lisan.Agar dapat menyampaikan pesan dengan baik dalam proses belajar mengajar. Oleh karena itu media yang digunakan harus dirancang semenarik mungkin untuk merangsang perhatian peserta didik. Komunikasi secara lisan (oral presentation) adalah komunikasi yang dilakukan antara dua orang atau lebih secara lisan/verbal antara sumber pesan/informasi kepada penerima pesan/informasi. Sehingga kelas menjadi hidup. Sehingga meningkatkan pemahaman peserta didik terhadap informasi yang disampaikan. Oleh karena itu guru harus memiliki penguasaan ketrampilan presentasi (presentation skills).

Tugas seorang guru adalah dapat menjelaskan informasi sejelas mungkin. Langkah-langkah agar guru dapat menyajikan presentasi yang menarik adalah using media. Hal ini dapat dilakukan dengan cara menyampaikan informasi dengan jelas dan membuat presentasi menarik bagi peserta didik. opening/ending. Kemampuan utama yang diperlukan oleh guru dalam pembelajaran secara sukses adalah sebagai berikut. varying activities. yaitu menjelaskan informasi sejelas-jelasnya kepada peserta didik.Pada prinsipnya seorang guru dalam proses presentasi melakukan proses pembelajaran. Materi bisa disampaikan secara jelas bila tersusun dengan struktur yang baik. 1) 2) 3) 4) Kemampuan menjelaskan (explainning) Kemampuan menyajikan informasi (presenting information) Kemampuan membangkitkan minat dan perhatian (geting interest) Kemampuan mempersiapkan materi. sehingga dapat dipresentasikan dengan baik pula. Untuk lebih jelasnya dapat diperhatikan ilustrasi pada skema berikut. sehingga peserta didik tertarik untuk mengikuti dengan antusias. comparing/contrasting. Selanjutnya bagaimana membuat presentasi itu menarik. explaining clearity • • • • using MEDIA varying activities comparing/contrasting opening/ending interest presenting information persiapan PERSIAPAN getting interest 41 .

agar memudahkan pemahaman. mendapatkan kesempatan untuk mengecek kebenaran informasi dan mampu mengurangi atau menghindari kesalahpahaman yang menyebabkan konflik. Dengan mengamati perilaku peserta didik dapat mengetahui respon/reaksi peserta didik yang positif dan negatif. Dalam bicara tidak perlu tergesa-gesa dan sebaiknya ada jeda dan jangan terlalu cepat untuk memberi kesempatan peserta didik untuk mencerna informasi. Biasanya dibantu dengan alat pelantang suara (sound system). yaitu dengan langkah-langkah sebagai berikut. meringkas dengan baik sehingga akan mampu mendorong peserta didik untuk mendengar secara hati-hati. 42 . Penyampaian bahan agar diatur dengan struktur yang baik supaya bahan dapat disampaikan secara runtut dan logis sehingga mudah dipahami. Perlu ada pengulasan kembali bahan-bahan yang sekiranya sulit dipahami melalui paraphrasing. Amati reaksi peserta didik Cek pemahaman peserta didik. Reaksi ini segera dapat dikelola oleh guru sehingga tidak sampai mengganggu presentasi. gunakan jeda. sehingga semua peserta didik benar-benar bisa mendengar dengan baik. 1) 2) 3) 4) 5) Bicara dengan jelas. Menjelaskan materi informasi dengan baik sehingga mampu meningkatkan pemahaman.Menjelaskan adalah memberikan pemahaman kepada orang lain. Paraphrasing adalah teknik mendengar dengan baik. Mengamati reaksi peserta didik merupakan hal yang penting untuk dilakukan. jangan terlalu cepat Strukturisasi bahan yang akan disajikan Ulas kembali pokok-pokok pembicaraan melalui paraphrasing. Dengan demikian seorang guru harus mampu mempresentasikan informasi dengan sejelas-jelasnya agar informasi tersebut secara jelas dipahami peserta didik. Dalam melakukan presentasi bicara harus kuat dan jelas.

Mengecek pemahaman peserta didik dilakukan untuk mengetahui apakah materi yang disampaikan telah difahami. perpindahan posisi. Kontak Pandang. dan sebagainya. sehingga takut memandang peserta didik. konsep-konsep. senyuman. sehingga informasi nampak lebih meyakinkan kebenarannya. Gerakan anggota badan ini sangat baik bila disesuaikan dengan pengolahan suara 43 . Kontak pandang guru terhadap peserta didik adalah merupakan bentuk perhatian/atensi. cerita. Biasanya guru yang baru dan belum pengalaman bicara di depan orang banyak memiliki perasaan minder/nervous. Ada tiga strategi dalam membangkitkan minat peserta didik yaitu : 1) Kontak pandang (Eye contact) Bahasa Tubuh (Gestures) dan Pengaturan suara. dan Pemanfaatan humor. Makin banyak pengalaman guru akan semakin siap mentalnya dan hambatan psikhologis semakin berkurang. karena akan meningkatkan minat peserta didik untuk mengikuti presentasi dengan lebih antusias dan serius sehingga akan meningkatkan pemahaman. Membangkitkan minat peserta didik agar berminat mengikuti presentasi dengan baik adalah juga tugas seorang guru. Yang dimaksud dengan gestures dalam presentasi adalah penggunaan gerakan anggota badan/tubuh untuk memberikan penekanan/penegasan ketika informasi disampaikan. Hal ini sangat penting dan perlu untuk memenuhi kebutuhan peserta didik dalam proses komunikasi yang baik. Hal ini merupakan hambatan psikhologis yang sangat mengganggu guru untuk sukses dalam presentasi. Misalnya gerakan tangan. dari kanan ke kiri secara merata. Mengecek pemahaman dapat dilakukan dengan mengajukan pertanyaan secara acak atau memberikan kesempatan peserta didik untuk bertanya. Oleh karena itu guru harus berlatih dari pengalaman yang satu ke pengalaman yang lain. mimik/wajah. 2) 3) Penggunaan contoh-contoh yang tepat dan analogi. Gestures. Dalam presentasi kontak pandang (eyes contact) harus diusahakan secara menyeluruh mulai dari depan ke belakang.

suaranya perlu diolah/diatur sedemikian rupa sehingga jelas. tidak monoton. Biasanya digunakan sebagai selingan untuk menarik perhatian peserta didik kembali berkonsentrasi pada informasi yang disampaikan. intonasinya dinamis tidak monoton. Dengan cara seperti ini akan menghasilkan image yang baik dari peserta didik dan akan menambah kepercayaan serta kewibawaan guru di mata peserta didik. Pemanfaatan humor. ada jeda dan warna suara tidak perlu dibuat-buat. sehingga hal-hal yang statis tidak akan lama mendapatkan perhatian. Pengaturan Suara. Hal ini akan membuat presentasi lebih variatif. dengan kecepatan bicara sedang. 44 . Guru dalam berbicara. Penggunaan contoh-contoh dan analogi. Dengan demikian minat peserta didik dapat dipertahankan bahkan ditingkatkan. Dalam berbicara artikulasi harus jelas. Pengaturan suara ini disesuaikan dengan kebutuhan dan biasanya sekaligus untuk menciptakan situasi dan kondisi yang kondusif mendukung proses komunikasi. Ingat otak hanya peka terhadap perubahan. Untuk menciptakan suasana baru. Cara meningkatkan minat yaitu dengan langkah-langkah strategi sebagai berikut. tidak monoton sehingga peserta didik tidak jenuh dan tahan lama berkonsentrasi dalam mengikuti presentasi. kadang keras kadang lembut.sehingga menghasilkan gaya bicara yang meyakinkan dan simpatik. dan konsep-konsep tentang sesuatu hal juga dapat membuat variasi. enak didengar. 1) Tunjukkan bahwa guru sendiri juga menaruh minat terhadap topik yang sedang dibicarakan. cerita. mengendorkan saraf yang tegang sehingga menjadi fresh kembali dan siap menerima informasi yang baru. Penggunaan contohcontoh yang tepat dan analogi-analogi dari informasi yang disampaikan akan membantu imajinasi peserta didik sehingga dapat dengan mudah memahami informasi yang di presentasikan.

Mainkan minat / keingintahuan dengan melempar pertanyaan. mulailah dengan contoh-contohnya. 2) Handout. Media komunikasi yang berkembang saat ini adalah penggunaan laptop dan LCD proyektor/ infocus. solid dan memiliki kemampuan) 3) 4) Gunakan contoh yang tepat. Atau kalau durasinya panjang diputar secara bertahap dan diselingi penjelasan oleh guru. masalah atau teka-teki. Oleh sebab itu penggunaan media dalam presentasi sebaiknya. tetapi kalau durasinya terlalu lama akan menyebabkan peserta didik cenderung bosan dan mengantuk. audio. 45 . isi dan penutup. Penggunaan media ini softwarenya didisain dengan program aplikasi komputer diantaranya dengan program powerpoint. Presentasi perlu memanfaatkan media komunikasi. ringkasan dibuat sederhana. karena media komunikasi bila didisain dan dimanfaatkan dengan baik akan dapat memperlama kurang minat/rasa tepat/baik keingintahuan. malah akan Sebaliknya kalau penggunaannya menambah kebosanan. juga didesain sederhana dan terstruktur secara jelas terdiri dari pendahuluan. Program ini memberikan fasilitas pembuatan disain slide presentasi dengan variasi yang sangat baik dan menarik. Hal ini akan membuat penggunaan media lebih efektif. beri waktu kepada peserta didik untuk memperhatikan lalu dijelaskan. 3) Slide. Jika terdapat informasi yang penting.2) Tunjukkan bahwa guru credible. trustworthy dan having expertise (Dapat dipercaya. Pemanfaatan Media. 1) Ilustrasi. artinya peserta didik yang paling belakang/jauh dapat membaca dengan mudah. Dianjurkan durasi 10 – 20 menit maksimum. cerita dan sebagainya Bila materi masih terasa asing. analogi. diagram. film dan video/vcd dapat meningkatkan minat. singkat dan keterbacaannya tinggi.

Karena semua respon peserta didik harus dikelola baik yang berupa oral maupun gerak-gerik tubuhnya. Beri penekanan pada kata-kata yang penting. Dalam menyiapkan Slide presentasi perlu memperhatikan prinsip dasar-dasar disain yang terdiri dari Irama. warna yang berbeda sehingga menjadi point of 46 . Penekanan. supaya dapat selalu melihat peserta didik. sebaiknya gunakan remote mouse atau asisten agar anda bebas berhadapan dengan peserta didiks supaya anda bebas melakukan kontak mata dan komunikasi non verbal lainnya 6) Jangan sibuk dengan peralatan danJangan bersembunyi di balik peralatan.40 1 frame maksimum 10 baris Pilih warna yang kontras (2-3 warna) Yang ditulis hanya kata kunci saja.Hal-hal yang perlu diperhatikan dalam presentasi dengan bantuan media LCD adalah sebagai berikut : 1) 2) 3) Lakukan pengaturan optimal sebelum presentasi Siapkan icon shortcut di layar desktop Bila menggunakan timer untuk pergantian slide. pastikan bahwa telah dilakukan simulasi 4) 5) Gunakan laser pointer untuk menunjuk tampilan di layar Bila tidak menggunakan timer untuk mengatur waktu tayangan. Besar huruf/font 20 . Tulis dengan singkat. kesatuan dan kesederhanaan. Kesetimbangan. 7) Jangan sering melihat layar tampilan. alat hanya pembantu. dengan menggunakan font yang berbeda. 1) 2) 3) 4) 5) 6) Buat konsep setiap framenya Pilih font yang mudah dibaca Jangan terlalu besar dan jangan terlalu kecil. padat dan bermakna (condensed). Langkah-langkah penulisannya adalah sebagai berikut. yang utama adalah pesan. jangan berupa kalimat panjang supaya tidak rumit (complicated). 7) 8) 1 frame sebaiknya hanya berisi 1 konsep.

Meningkatkan variasi kegiatan. 47 . bidang. Penetapan pokok-pokok pikiran yang akan atau perlu pengulasan kembali juga merupakan yang penting dalam persiapan. Persiapan. Media atau alat bantu presentasi juga harus dipersiapkan. Sebaiknya datang awal di tempat presentasi untuk mengenal medan dan persiapan media yang digunakan. Perlu diingat bahwa presentation skills merupakan kemampuan yang dapat dipelajari untuk meningkatkan kemampuan berekspresi diri baik secara lisan maupun tertulis. Persiapan berupa persiapan mental psikhologis maupun fisik dan persiapan materi yang akan dipresentasikan. Mungkin akan menjadi tontonan bukan tuntunan. Hal-hal yang menjadi kekuatan didorong kemunculannya secara optimal. membagi tugas. sebab ketidak siapan hal ini akan mengganggu secara psikhologis yang akhirnya bisa membuat fatal presentasi. Sehingga enak dilihat dan menjadikan betah menikmatinya. isi dan penutup. ruang sehingga frame menjadi kesatuan disain yang tidak norak tetapi lembut dan serasi. Struktur yang baik akan menentukan ketuntasan penyampaian gagasan/ide. Bahan disiapkan dengan struktur yang baik mulai pembuka.interest. memperlihatkan video klip. dan yang menjadi kelemahan ditekan /dikurangi. Persiapan penting bagi guru agar presentasi berjalan dengan baik. Kegiatan yang bervariasi akan meningkatkan minat dan perhatian dan rasa ingin tahu dari peserta didik. mendorong pemecahan masalah secara kolektif. Pada tahap persiapan ini guru harus mengungkap kembali apa yang dimiliki yaitu yang berupa kekuatan maupun kelemahan. Prinsip-prinsip presentasi adalah bagaimana mengelola gesture atau gerak-gerik anggota badan yang dimanfaatkan untuk menjelaskan maupun gerak-gerik peserta didik yang harus dikelola. garis. Strategi untuk membuat kegiatan yang bervariasi adalah dengan melemparkan sebuah pertanyaan. mendorong terjadinya diskusi dan sebagainya. Pemahaman tentang bahasa tubuh (body language) juga merupakan peran penting dalam peningkatan kemampuan presentasi.

berwibawa. dan belajar mengatasi konflik secara efektif. disegani/dihormati. Komunikasi merupakan kebutuhan mendasar manusia sebagai makhluk sosial yang harus berkomunikasi dengan orang lain. mampu menghargai orang lain secara tulus dan menimbulkan rasa kebanggaan dan kebahagiaan pada dirinya. Dengan demikian keterampilan presentasi merupakan kebutuhan bagi setiap orang. Dalam kesempatan tersebut manusia dituntut sebagai komunikator yang efektif. Namun kemampuan tersebut bagi sementara orang harus dipelajari dan dilatih agar berkembang. Bila seorang mampu sebagai komunikator yang efektif. Menjadi komunikator yang efektif akan disegani dan dihormati. Penggunaan media yang sebaik-baiknya. Untuk belajar mengekspresikan diri pertamatama kenalkan diri sedemikian rupa sehingga orang lain/peserta didik 48 . maka dia akan percaya diri bahkan mampu menghargai dirinya sendiri. dalam keluarga. Belajar menjadi komunikator yang efektif berarti harus belajar mengekspresikan perasaan. Baik disainnya maupun penggunaannya. dan sebagainya. Bila dalam waktu itu berhasil menguasai peserta didik maka 90% presentasi akan berhasil.Pengelolaan Voice/suara . Mengekspresikan diri. bisnis. karir. Kemampuan berkomunikasi bagi sementara orang adalah sebuah talenta alami. Keterampilan komunikasi harus dimiliki dan dikembangkan secara berkelanjutan sehingga tidak ditinggalkan orang lain hanya karena lemah dalam komunikasi. pemahaman harus dipahami bahwa kenyataannya peserta didik terdiri 70 % pemalas sehingga harus dilayani. struktur penyampaian peserta didik (understanding audience) bahan. memberi pujian sepantasnya kepada orang lain. Pemanfaatan 15 menit pertama bahkan 5 menit pertama adalah waktu yang sangat menentukan keberhasilan presentasi. demikian pula sebaliknya. Dalam setiap detik kehidupan manusia dituntut mampu berkomunikasi secara efektif dalam berbagai suasana seperti di kantor. menghadirkan/ menyajikan diri secara baik.

pengetahuannya. latar belakangnya. Ajukan pertanyaan dengan baik dan terstruktur. Berbicara satu ide saja.. Jelaskan alasan-alasan ketidak setujuannya tanpa harus menyerang pribadi apalagi di depan orang banyak. Bicara secara jujur merupakan hak dan tanggungjawab bagi setiap orang. misalkan dengan cara tarik napas panjang berkali-kali.. Bila akan merespon.. putar-putar ... sampaikan secara singkat dan jelas bukan umum. ketiga. perasaannya... Coba bandingkan dan pelajari bahwa 49 . harus dilakukan dengan ringkas/padat dan tidak umum. Segera ambil langkah tindakan untuk mengatasinya....mengenal dan memahami. tetapi singkat dan jelas. usahakan jangan menginterupsi pembicaraan orang lain sebelum orang lain menyelesaikan kalimatnya. Tampilkan/tunjukkan rasa senang tidak emosional dan percaya diri dan bicaralah dengan jelas. Buatlah daftar keunggulan dan kekurangan diri. sadarilah dan pahamilah gejolak emosi diri (perut. melantur. dan seterusnya... Latihan diri untuk mengurangi kelemahan dan lebih menonjolkan keunggulan-nya .... Usahakan jangan sampai perhatian terbagi dan tunjukkan minat pada apa yang sedang dibicarakan. kedua. mimik lawan bicara untuk di kelola. jangan pertama. diam dan renungkan penyebabnya dan buang dengan melawan dengan kata-kata yang positif . Apakah gejala tersebut fair ? jangan-jangan sedang emosi. Belajar Mendengar merupakan hal yang penting untuk menghindari diri dari kesalahpahaman. Setelah itu harus berusaha mengenal mereka... Bila harus berbicara. logis dan tidak emosional dan Be Tacful artinya meskipun tidak /kurang setuju sampaikan dengan cara yang positif.. Tidak semua komunikasi berlangsung secara verbal bahkan berdasarkan penelitian 55% disampaikan secara non verbal. pandangannya dan sebagainya... namun usahakan bicara jujur tanpa menyakiti orang lain.. Oleh karena itu pelajari gerak-gerik anggota badan. Untuk meningkatkan kemampuan berkomunikasi. jantung berdebar-debar).

dan mengatasi konflik merupakan pekerjaan yang menantang dan menarik. harus diusahakan terfokus tidak membawa masalah-masalah yang lain. penerima. stimuls tujuan. Atasi masalahnya dan jangan menyerang pribadi. 2. pengirim decoder. dan cari kemungkinan yang paling memungkinkan dan menyenangkan semua pihak. Bila harus mengatasi konflik. Tetapi kalau dihayati betul. 2003: 9. perasaan. buat daftar kemungkinan penyelesaian masalah. Apa maksudnya ? Mengatasi konflik sangat memerlukan keterampilan dan kemampuan untuk itu. Ungkapkan perasaan secara tenang jangan emosional. dan lain-lain) dengan penggunaan simbol-simbol kata [tekstual atau verbal] gambar. pengambilan keputusan dapat berlangsung secara lebih baik. Lakukan analisis masalahnya.teman mengatakan ”tidak apa-apa” tetapi dengan wajah murung. Sering kali kompromi harus terjadi dan mungkin tidak bisa dihindari. dan pesan itu sendiri. pengetahuan. ide. oleh karena itu laksanakan solusi yang disepakati. Pada kondisi lebih lanjut. Proses komunikasi merupakan penyampaian pesan (informasi. aktor (presenter) respon. presentasi adalah proses komunikasi langsung antara komunikator dengan komunikan. dan memalingkan muka. lebih bisa memahami diri sendiri. Dasar-dasar disain media presentasi Pada dasarnya. sumber audience. presenter). Memang kalau dirasakan konflik itu menyakitkan. Haroldsen. yaitu pengirim pesan (komunikator. Konflik muncul saat bekerjasama dengan orang lain baik secara individual maupun kelompok. Duduk bersama. tabel. angka. menurut Reed H. audience). encoder 50 . dan sebagainya (Berelson dan Steiner. Dalam proses tersebut terdapat tiga elemen utama. Blake & Edwin O. 1964: 527). penerima pesan (komunikan. konflik tersebut juga bermanfaat yaitu menjadikan lebih memahami orang lain. akan terjadi variasi relasi: komunikator komunikan. ceria.

media sering dipandang sebagai alat bantu atau berbagai jenis komponen dalam lingkungan belajar untuk menyampaikan pesan (materi pembelajaran). perasaan. sehingga proses komunikasi (presentasi) berlangsung optimal. menurut Lasswell (dalam Blake & Haroldsen. yang menerima dan memberi balikan (feedback). tetapi pengirim pesan (presenter) adalah pihak yang bertanggung jawab mengambil inisiatif dan mengarahkan aktivitas itu. Walaupun pengirim dan penerima pesan merupakan dua pihak yang aktif. Pada faktor pesan. yaitu: (1) tanda dalam pesan. pihak penerima pesan (audience) merupakan partisipan. 51 . Hali ini mengandung pengertian bahwa media bukan semata-mata berperan sebagai perantara atau pengantar. ed. Di sisi lain. Media Presentasi Arti paling elementer dari kata “”media” (medium) adalah perantara. 2002: 7. perhatian.. juga faktor isi pesannya (content analysis). Burhan dalam Kusmayati. yang berkenaan dengan pemakaian unsur-unsur simbolis yang disusun. 2003: 41). terdapat 3 aspek utama. dan minat terhadap substansi pesan yang disampaikan. tetapi juga berperan memberi stimulus pikiran. selain memandang proses komunikasi dari faktor pengirim pesan (control analysis) dan penerima pesan (audience analysis). 2003: 9-12). Dalam lingkup pendidikan (pengajaran). dan (3) perlakuan atas pesan. Model komunikasi. a.Keberhasilan dari proses tersebut di atas mengandung suatu konsekuensi tindakan bagaimana substansi pesan dapat dikirim dan dapat pula diterima. yang berkaitan dengan pemilihan materi untuk mencapai tujuan. yang berkenaan dengan cara pesan tersebut disajikan (dipresentasikan). (2) isi dalam pesan. pengantar atau penengah (lihat Susanto.

komunikator Peran media presentasi audience. sehingga mendesain media pada prinsipnya adalah mengemas substansi pesan agar lebih menarik dan lebih mudah diterima oleh pihak penerima pesan (audience). sepenting apa pun substansi pesan tetapi bila kurang menarik media dan cara mempresentasikannya. Pada kasus tertentu desain atau pemakaian media yang kurang tepat memang dapat mereduksi. Sebagus apa pun isinya tetapi bila kemasannya tidak menarik. respon audience akan berkurang. media presentasi dapat dianalogikan dengan kemasan. Pada sisi lain. sehingga pesan tersebut tidak sepenuhnya dapat diterima. salah satu hal yang pertu diperhatikan adalah bagaimana agar ketertarikan dan perhatian audience tidak sekedar terfokus pada medianya.pesan ???!!!! Media presenter. 52 . Persoalan kemasan tidak dapat dianggap sebagai sesuatu yang remeh temeh. sebagai hal yang sekedarnya. substansi pesan justru terabaikan. tetapi merupakan salah satu faktor yang menentukan (determinant) terhadap nilai isi kemasan tersebut. komunikan Pada konteks lebih luas. orang tidak akan meresponnya. yang boleh diabaikan. bahkan mengacaukan pesan utamanya.

dipandang berhubungan dengan persoalan tentang keindahan atau aspek keindahan (Djelantik. 1999). subjektif. Pengertian dan pemahaman tentang estetika atau aspek estetis mengalami perdebatan dan pewacanaan yang panjang hingga sekarang. tetapi selalu bernuansa relatif. Pada perkembangan selanjutnya. namun hal paling signifikan dalam konteks bahasan ini adalah adanya aspek kemenarikan (interestness) di dalamnya. Unsur-Unsur Disain Grafis Komputer Istilah grafis berasal dari kata “”graphein” yang berarti menulis atau menggambar. Estetis Tampilan Media Aspek estetis bukanlah persoalan benar-salah yang harus dipandang atau dipahami secara hitam-putih. Persoalan estetis (estetika). 200: 24-25). Grafis komputer adalah istilah yang lazim 53 . Aspek ini bisa menjadi suatu acuan pertimbangan ketika berhadapan dengan ranah estetis suatu tampilan grafis (desain visual).b. yang selanjutnya berkembang menjadi pengetahuan tentang keindahan (Soemardjo. Untuk merepresentasikan atau mempersepsikan aspek kemenarikan dalam suatu tampilan grafis suatu media presentasi. Agar media presentasi tampil menarik (artistik) perlu dipertimbangkan aspek estetis yang paling mendasar pada saat mendesainnya. termasuk di dalamnya desain media presentasi. dan foto atau citra (image). dan sangat situasional. serta penataletakan (lay out)-nya. gambar (drawing). Kata “estetika” (Yunani Kuno: Aistheton) pada mulanya dipahami sebagai kemampuan mencerap melalui penginderaan. secara teknis diwujudkan dengan alat bantu komputer grafis. yang pada era masa kini. setidaknya diperlukan pengetahuan tentang dasar-dasar desain grafis. c. secara konvensional. istilah grafis digunakan untuk merujuk tentang tampilan visual yang berkenaan dengan tata huruf (tipografi).

Secara prinsip pemakaian. semua jenis huruf adalah baik. Berbagai alternatif tipografi dengan program Corel Draw (salah satu huruf dimanipulasi) 54 . misalnya. Macromedia Free Hand.digunakan untuk mengidentifikasi atau menyebut perwujudan grafis secara computerized. 1). memiliki tingkat keterbacaan dengan cepat dan sangan komunikatif. Karakter huruf tanpa kait. Adobe Illustrator) terdapat fasilitas untuk memanipulasi huruf (font) bahkan dapat mengkonversi font menjadi modus vektor atau kurve. THE QUICK BROWN FOX JUMPS OVER THE LAZY DOG THE QUICK BROWN FOX JUMPS OVER THE LAZY DOG THE QUICK BROWN FOX JUMPS OVER THE LAZY DOG THE QUICK BROWN FOX JUMPS OVER THE LAZY DOG THE QUICK BROWN FOX JUMPS OVER THE LAZY DOG THE QUICK BROWN FOX JUMPS OVER THE LAZY DOG THE QUICK BROWN FOX JUMPS OVER THE LAZY DOG THE QUICK huruf (font) memiliki kesan karakter danDOG Setiap jenis BROWN FOX JUMPS OVER THE LAZY tingkat keterbacaan tersendiri Pada program aplikasi olah grafis (Corel Draw. Program aplikasi komputer grafis menyediakan unsur tipografi (font) dengan berbagai karakter yang telah dibakukan. sehingga cocok dipakai sebagai unsur teks pada tampilan media presentasi. Tipografi Tipografi juga sering disebut seni huruf. Karakter huruf yang digayakan memiliki citra estetis (artistik) tetapi cenderung memiliki tingkat keterbacaan lambat dan kurang komunikatif. namun tergantung dari konteks kesan yang ingin diciptakan.

berbagai jenis gambar 3). bagan. foto digital. atau input eksternal dengan piranti keras pemindai (scanner). mereduksi.2). logo. model. lambang. bisa dimanfaatkan program aplikasi oleh citra MS Paint. gambar bisa tampil dalam berbagai modus seperti ikon. Untuk kepentingan praktis. Photo Deluxe. Program aplikasi olah citra memungkinkan untuk memanipulasi kualitas citra agar lebih bagus atau lebih buruk. kamera digital dan piranti capture lainnya. sedangkan untuk kepentingan profesional biasa digunakan program aplikasi Adobe Photo Shop dan didukung program lain (multi tasking). Corel Photo Paint. dengan modus kurve. mendistorsi. Photo Studio. Dalam hal ini. dari yang bersifat instan sampai yang profesional. aplikasi komputer grafis telah menyediakan program “olah citra”. Untuk memenuhi kepentingan tersebut. 55 . Foto atau citra diinput ke program komputer grafis dengan piranti eksternal seperti scanner. Gambar tersebur juga dapat dikombinasi dengan gambar dari aplikasi lain (multi tasking). dan lain-lain. menggabungkan antarcitra (montase). Photo Impact. Foto atau Citra (Image) Foto adalah salah satu unsur penting pada tampilan grafis agar menarik. Gambar (drawing) Program aplikasi komputer grafis “olah gambar” menyediakan piranti dan fasilitas untuk membuat gambar. dan sebagainya. dan piranti capture citra lainnya. grafik.

dapat diurai menjadi lebih elementer. citra (image). memberi efek. Hal ini berimplikasi adanya perbedaan teknis pengolahan antara format gambar dan format citra dalam proses mendesain. berbeda format data gambar (drawing) dengan modus vektor atau kurve. Semua unsur tersebut tersedia secara lengkap dalam program aplikasi komputer grafis. yang secara universal sering disebut sebagai unsur-unsur desain. 1). diinput dengan piranti pemindai (scanner) Ketiga unsur grafis komputer. bidang. dan lain-lain. tipografi. dan foto seperti terurai di atas. format data citra biasanya bermodus bitmap dengan pictorial cell. untuk berbagai kepentingan. variasi. meliputi garis. gambar. ruang.mendeformasi. Pada aplikasi grafis. dan barik (texture). garis Berbagai jenis. warna. dan style garis untuk mendukung tanpilan grafis tersedia dalam program aplikasi komputer grafis. Dalam kasus 56 .

berbagai jenis dan ketebalan garis 2). bidang geometris segi banyak beraturan (poligon) dan bidang organis 57 . Demikian pula. tampilan gambar secara linier (secara utuh hanya berupa garis) justru memperjelas pesannya. bidang geometris segi banyak beraturan (poligon) dapat dikonstruksi secara praktis dengan piranti (tool) yang tersedia.tertentu. Aplikasi komputer grafis memungkinkan untuk mendesain bidang-bidang geometris maupun bidang-bidang non-geometris (organis). bidang organis dapat didesain sesuai kehendak dengan piranti lain. bidang Bidang terbentuk dari unsur garis yang saling berhubungan. Dalam hal ini.

seperti warna primer. magenta. Unsur ruang terjadi dari kesan yang timbul atas penataan berbagai elemen-elemen lain. dan sebagainya. dan blue (RGB). dan black (CMYK). warna komplementer. merentang (mengkalibrasi) warna penuh (true colour) menjadi 232 warna. warna panas. sedangkan pada modus warna cahaya warna primer terdiri atas red. warna Aplikasi komputer grafis menyediakan jutaan kalibrasi (rentangan) warna. yellow. ruang (space) Ruang merupakan unsur desain yang sangat relatif keberadaannya dan berupa kesan. warna tersier. warna monokromatis. warna sekunder. Pada dasarnya kalibrasi warna tersebut dari kombinasi berbagai warna primer.3). Pada modus warna kromatik. Dalam lingkup desain grafis dikenal berbagai istilah berkaitan dengan warna. komputer grafis dengan setting 32 bit mampu membedakan. Sebagai contoh. warna primer terdiri atas warna cyan. ruang (kesan) yang tercipta sebagai efek penataan elemen 4). Mendesain tampilan media presentasi perlu mempertimbangkan unsur warna agar lebih estetis dan artistik. warna polikromatis. 58 . green. warna dingin.

berbagai jenis barik 59 . barik (texture) Secara grafis. Program aplikasi komputer grafis menyediakan berbagai alternatif barik untuk keperluan tampilan visual.lingkaran warna 5). barik atau tekstur diartikan sebagai kesan suatu permukaan.

bukan sekedar pada medianya pilih karakter font yang mudah terbaca (lebih menguntungkan jenis font tanpa kait) pilih ilustrasi grafis/ gerak/ suara yang sederhana. gerak. Prinsip Desain (Grafis) 1). image. latar belakang. atas-bawah 4). irama (rhythm) pusatkan kesan irama pandangan masuk ke ruang display. keseimbangan (balancing) kesan seimbang kanan-kiri. suara agar perhatian audience tetap pada materi (substansi) pesan yang disampaikan. animasi) 60 . warna. tidak monoton bisa terbentuk dari pengulangan (repetisi) 3). gambar. kesatuan dan keselarasan (unity and harmony) satu frame satu konsep bahasan paduan unsur-unsur serasi (warna.d. karakter font. tidak menampilkan unsur-unsur yang berlebihan dalam satu display 2).point interest/ point centre/ eye catcher penekanan pada item yang dianggap lebih penting dari yang lain 5). ilustrasi. kesederhanaan (simplisity) unsur teks. suara.

contoh display yang memperhatikan prinsip desain 61 . yang secara teknis diwujudkan dengan alat bantu komputer grafis. Agar tampilan visual media presentasi. memiliki faktor kemenarikan (interestness) maka perancang atau pengguna media presentasi perlu memiliki pemahaman tentang dasar-dasar desain grafis. Buto Cakil bertemu Srikandi Surem-surem diwangkara kingkin lir manuksma kang layon….Media menjadi salah satu faktor determinan bagi keberhasilan suatu proses komunikasi. khususnya presentasi. Salah satu aspek suatu media presentasi adalah menjadi daya tarik sekaligus merangsang perhatian audience sehingga substansi pesan yang disampaikan lebih mudah diterima.

• Gigi mencuat (mancung) •Tokoh raksasa tetapi bertubuh kecil contoh display yang tidak memperhatikan prinsip desain 62 .BUTO CAKIL •Tokoh perang kembang • Sering berperang melawan kesatria dan tidak pernah menang •Tiap kali dibunuh. tetapi ia selalu tampil lagi pada lakon yang lain • Kepalanya datar. mata juling.

geser garis atau dengan menggunakan tanda panah. masing-masing jenis pengetahuan dapat didisain bentuk transparansinya sebagai berikut. buka tutup. Disain media OHT maupun Slide presentasi harus bersumber dari kurikulum yaitu dari tujuan/kompetensi yang terdapat dalam silabus mata pelajaran. Produksi media OHT dan Slide Presentasi Langkah pertama dalam produksi materi presentasi untuk pembelajaran adalah membuat disain/perencanaan. Silabi TUJUAN PEMBELAJARAN MATERI DESAIN OHT Slide Presentasi Terdapat jenis-jenis pengetahuan dalam materi pembelajaran. Prinsip dan konsep akan lebih cocok bila di disain menjadi frame tunggal. Untuk OHTmaupun Slide presentasi. 63 . Pengetahuan yang berjenis fakta.3. Oleh karena itu perlu direncanakan bentuk media yang sesuai. Pengetahuan yang berjenis prosedur akan lebih cocok bila didisain menjadi beberapa frame sesuai dengan bagian-bagian tertentu selanjutnya bisa ditayang kan bertumpuk.

akan lebih baik bila didisain dalam bentuk animasi. JENIS PENGETAHUAN BENTUK KONSEP PRINSIP FAKTA FRAME TUNGGAL PROSEDUR BUKA TUTUP GESER-GARIS TUNJUK PROSES ANIMASI Produksi OHT write on (menulis langsung pada lembar transparant). M /L • MAL ( KERTAS GARIS UKR.Sedangkan jenis pengetahuan yang bersifat proses. KUARTO) • FONT YG MUDAH DIBACA • BESAR HURUF 20 – 48 • 1 LEMBAR 10 – 15 BARIS • WARNA YG KONTRAS (2-3 WARNA) 64 . G U N AK A N : • TRANSPARANSI KHUSUS • SPIDOL KHUSUS UKR.

Untuk penyajian dengan LCD/infocus projector.• • • • • BUAT KONSEP DESAIN TIAP FRAME YG DITULIS KATA-KATA KUNCI TULISKAN KONSEP PADA TRANSPARANT 1 LEMBAR/FRAME HANYA 1 KONSEP BERI PENEKANAN PD KATA-KATA YG PERLU PERHATIAN Produksi OHT dengan komputer program power point aturannya sama dengan produksi slide presentasi. maka tayangan proyeksi nampak pada layar. file pada komputer/laptop bisa dipanggil dan jalankan slide show. selanjutnya file bisa di print/cetak di kertas untuk di fotocopy di transparat atau di print langsung pada transparant warna untuk penyajian dengan OHP (Over Head Projector). Setelah selesai membuat materi. Power on komputer Aktifkan MS Power Point Pilih format landscape/ portrait Pilih background Pilih lay out Pilih font Tuliskan konsep sesuai aturan Insert new slide frame berikutnya 65 . Untuk produksi OHT dan Slide presentasi dengan program power point adalah dengan langkah-langkah sebagai berikut.

PowerPoint Klik pada START kemudian geser pada All Program Carilah shortcut Ms. Power Point kemudian Klik Tampilan dan Elemen Jendela Ms. PowerPoint Menu Bar dan Tool Bar Layar Edit Slide Map Task Pane Modus Tampilan Toolbar Drawing 66 .Mengaktifkan Ms.

dengan pilihan yang begitu banyak Klik salah satu bentuk layout 67 .Membuat Klik Menu File New Slide Baru Maka pada task pane akan terdapat Pilihan : • Blank Presentation • From Design templete • From Auto Content Wizard Klik salah satu Option tersebut Menentukan Layout Klik Menu Format Slide Layout Atau langsung pilihlah bentuk layout pada task pane.

• Fill Effects ..Texture .Picture Pilih salah satu pilihan • Kemudian Klik Apply Menuliskan Text Klik pada kotak text box Ketikkan text SELAMAT DATANG Atur Jenis dan Ukuran dan warna Font Dengan Menu Format Font Setelah text pertama selesai Ulangilah dengan cara yang sama Untuk text box berikutnya 68 . ...Gradient ..Menentukan Klik Menu Format Klik segitiga pulldown terdapat pilihan background Latar Belakang Background • More Color .Pattern .

aturlah ukuran dan Letaknya. setelah itu dapat ditambahkan text. dapat ditambahkan slide berikutnya dengan cara : Klik Menu Insert New Slide Kemudian ulangilah langkah langkah seperti slide pertama 69 . Menambah Slide Berikutnya Setelah slide pertama selesai. dan juga diberi animasi seperti halnya text.Me masang Gamba r Klik Menu Insert – Picture Pilih Clip Art / From File Setelah gambarnya muncul.

Jika akan ditampilkan slide tertentu saja.Mengatur Pergantian Slide Setelah anda memiliki beberapa slide. ( tampak pada Map ) Klik menu Slide show – Slide Transition dapat diatur cara pergantian tiap slide Klik untuk memilih salah satu slide transition.View Show atau tekan tombol Fungsi 5 ( F5 ) Cara Ini akan menampilkan seluruh slide. • ditampilkan langsung pada layar komputer • dicetak pada mica transparansi (OHP) • atau dipresentasikan lewat LCD projector Caranya adalah : Klik menu Slide Show . misalnya slide ke 10 Caranya adalah : 70 . dan aturlah optionnya Kemudian klik tombol Apply Menampilkan Slide Presentasi Slide dapat ditampilkan pada beberapa media.

lalu pilih Pointer Option Atau menggunakan keyboard Ctrl-OP 71 .Menampilkan Halaman Slide tertentu Untuk menampilkan Slide lain ketika presentasi sedang aktip. atau berupa pencil sehingga dapat membuat “coretan” pada slide yang sedang tampil Caranya adalah : Klik kanan mouse.Pilih Klik nomor slide pada map untuk menandai slide yang akan ditampilkan Kemudian Klik pada icon Slide show ( gb. Layar ) Membuat Freehand Note (Pointer show) Adalah menampilkan pointer. caranya : Klik kanan – Go – By Title .

Mengakhiri Presentasi Mengakhiri dan kembali pada Menu edit Tekan tombol ‘Esc’ Atau klik kanan kemudian End Show Tugas LATIHAN Buat disain OHT / Slide presentasi Materi Sesuai Bidang Keahlian Sesuai dg mata ajar masing-masing Satu tatap muka Buat Animasi setiap pergantian Slide Sajikan / Presentasikan dg Komputer dan LCD Print di Tranparansi Warna Print Pada kertas HVS Copy di Tranparansi Sajikan / presentasikan dg OHP 72 .

Jangan menunduk ! Sebelum Presentasi (dengan OHP) • Kenali peralatan yang digunakan (terutama letak tombol ON-OFFnya) • Atur fokus dan besarnya tampilan di layar.Jangan bersembunyi di balik peralatan! .Amati responsnya . bukan peralatan presentasinya ! .MENGGUNAKAN MEDIA OHP / LCD Ingat .Efektifkan kontak mata dengan audiens .! •Media komunikasi hanyalah alat •Bagian terpenting dari presentasi adalah pesan yang disampaikan Aturan Dasar Presentasi : KIS (Keep it simple ) Kelola audiens. sesuaikan dengan jumlah audiens • Siapkan transparansi sesuai urutan tampilan • Transparansi bertumpuk sebaiknya disatukan (misalnya dengan klip kertas) 73 ..

Selama Presentasi (OHP) Nyalakan OHP bila transparansi telah siap Susun transparansi yang telah ditayangkan dengan punggung menghadap ke atas Posisikan diri di sebelah kiri OHP Jangan tunjuk langsung tampilan di layar. Gunakan laser pointer bila mungkin Mematikan/menghidupkan OHP dapat digunakan untuk menarik perhatian audiens M tik OHP bil i i b k t j l b Sebelum Presentasi (dengan LCD Projector) Siapkan icon shortcut di layar desktop Bila menggunakan timer untuk pergantian slide. pastikan bahwa telah dilakukan simulasi Selama Presentasi dg LCD Gunakan laser pointer untuk menunjuk tampilan di layar Bila tidak menggunakan timer untuk mengatur waktu tayangan. sebaiknya gunakan remote mouse atau asisten agar anda bebas berhadapan dengan audiens 74 .

Jelaskan proses komunikasi yang terjadi dalam proses pembelajaran. 75 . Sajikan menggunakan OHP 6. Sebutkan dan buat analisis masingmasing. Sajikan menggunakan LCD D. 3. Print out di transparant warna 5. Apa peranan penggunaan bahasa tubuh (non verbal) dalam proses pembelajaran. Buatlah 5 lembar media OHT (write on) dari materi ajar saudara 2. Terdapat empat hal dalam usaha sukses presentasi untuk menjelaskan materi sejelas mungkin kepada peserta didik. lalu fotocopy di transparant 4. Apa saja yang harus saudara penuhi dalam membuat media OHT dan Slide presentasi untuk presentasi pembelajaran ? jelaskan alasan saudara. Latihan TUGAS : 1. Print out di kertas HVS.C. Dengan program power point 3. 2. Apa saja yang harus saudara perhatikan dalam presentasi mengajar menggunakan media OHP dan LCD ? berikan alasan-alasannya. dikumpulkan sebagai respound peserta) 1. Tes Formatif Soal uraian : (Tugas. Buatlah Slide presentasi dari materi ajar yang saudara ampu (minimal 10 frames). 4.

Pewarnaan yang paling tepat pada disain berikut menurut saudara adalah: A B C D . tetapi media juga perperan sebagai Perangsang: A. Hal ini karena media bukan semata-mata berperan sebagai perantara atau pengantar pesan. (boleh memilih dua opsi yang tepat) 2. Pikiran dan Perasaan B. Menarik perhatian D. Pilihlah jenis huruf berikut ini yang menurut saudara paling tepat untuk membuat media OHT/Slide presentasi A. C. D.Soal Pilihan Ganda : 1. 76 . Media sangat besar peranannya dalam proses pembelajaran Media sangat besar peranannya dalam proses pembelajaran Media sangat besar peranannya dalam proses pembelajaran Media sangat besar peranannya dalam proses pembelajaran B. Perhatian dan minat C. Menarik Minat. Media dalam pembelajaran harus didisain dengan baik dan menarik. 3.

4. Disain yang paling tepat adalah A CONTEXTUAL TEACHING AND LEARNING (CTL) PENDEKATAN STRATEGI DAN KBM DLM PELAKSANAAN KBK Sri sartono UPT SBM UNNES Sri sartono UPT SBM UNNES B CONTEXTUAL TEACHING AND LEARNING (CTL) PENDEKATAN STRATEGI DAN KBM DLM PELAKSANAAN KBK C PENDEKATAN STRATEGI DAN KBM DLM PELAKSANAAN KBK D CONTEXTUAL TEACHING AND LEARNING (CTL) PENDEKATAN STRATEGI DAN KBM DLM PELAKSANAAN KBK CONTEXTUAL TEACHING AND LEARNING (CTL) Sri sartono UPT SBM UNNES Sri sartono UPT SBM UNNES 77 .

B 6.. USA: Harper & Row Publishers. ABCD 4. C 3. 1999. Brown. Hartono Kasmadi . New Jersey: Prantice Hall. Bandung : PT Citra Aditya Bakti. AAM. Jakarta: Penerbit Erlangga Departemen Pendidikan dan Kebudayaan . B 4. Reed H. New York: Longman Metheu. Inc. Kemp Jerrold E dan Dayton Deane K. Effective Teaching in Higher Education. . Kamus Istilah Komputer. D Daftar Pustaka AECT. Surabaya: Papyrus.1992. Pengertian dan Penerapannya di Indonesia. Washington DC. Jakarta : Direktorat Pendidikan Umum Djelantik. Technology. C 2. 1996. 1967. Edmud Burke.:Association for Educational Communication and Technology Blake.Penutup Kunci Tes Formatif Kegiatan Belajar 1: 1. Oemar 1989. 1995 : Penggunaan Alat Peraga. Art as Image and Idea. Feldman. 1977. 1985. Palmer W. Program Media Fungsi dan Penggunaannya. Englewood Cliffs. 1980. 2003. Hamalik. 1987. Semarang : Proyek Peningkatan Guru IPS Kanwil Dekdikbud. Haroldsen. The Defuinition of Educational Technology. 1983. Media Pendidikan . Cara Pembuatan Media dan Alat Media Grafis. Task Force on Definition and Terminology. Downing and Michael Covington. Jakarta : Pustekom Depdikbud. G dan Atkins. AB 2.Taksonomi Konsep Kumunikasi.Estetika Suatu Pengantar. ABCD Kunci Tes Formatif Kegiatan Belajar 2: Kunci : 1. M. Bandung: Masyarakat Seni Pertunjukan Indonesia. & Edwin O. Teknologi Komunikasi Pendidikan. 1984. Agnew . Dauglas. Boston: 78 . Planning & Producing Instructional Media. Multimedia In The Classroom. A 3. Semarang : UPMSB IKIP Heri Subagyo. D 5. tidak ada pilihan 7. dkk.

Simbol dan Daya. 2003. 1996. ______________.1986. 2002. _____. Supatmo. Sukadi. Estetika: Makna. 2000. Rahardjo. Jakarta: Raja Grafindo Persada. No. Priyono Andreas. Alex. Desain Media. Sadiman Arief S. 1991. Media Pendidikan. Agus. 2000. Jakob. “Media Digital: Alternatif Media Seni Rupa Masa Kini” dalam Imajinasi Jurnal Seni FBS Universitas Negeri Semarang. 1994. Bandung: Rosdakarya. Yogyakarta: Galang Press. edisi Juli 2004. Pengembangan Media Instruksional. Mikke. Soemardjo. Jakarta: Depdikbud.Diksi Rupa. Sachari. Media Pendidikan. Sobur. Raja Wali . 79 .Allyn and Bacon. Yogyakarta: Kanisius. A . 1829-930X. 2002. Menimbang Ruang Mernata Rupa. Bandung: Penerbit ITB. Filsafat Seni. Jakarta : PT. Presentation Skills. Jakarta: Pustekom Depdikbud. Semiotika Komunikasi. 2004. Susanto.. Semarang: Uneversitas Negeri Semarang. Bandung: Penerbit ITB.

BUKU AJAR PENELITIAN TINDAKAN KELAS .

(d) hampir tidak ada industri yang memiliki divisi pelatihan tenaga kerja secara internal untuk dijadikan wadah pelatihan siswa SMK. Beberapa faktor yang dipandang sebagai penyebab rendahnya kualitas tersebut antara lain: (a) belum banyak industri yang ikut terlibat dalam kegiatan Praktik Kerja Lapangan (PKL).BAB I PENDAHULUAN A. Latar Belakang Dalam menghadapi era perdagangan bebas. (d) kualitas lulusan masih dianggap belum mampu memenuhi persyaratan keterampilan yang dibutuhkan oleh dunia usaha / industri. Perkembangan teknologi yang sangat pesat terutama dalam bidang elektronika berpengaruh pada kebutuhan tenaga kerja terampil. mengingat kualitas pendidikan khususnya SMK saat ini masih menghadapi banyak permasalahan antara lain. (b) lulusan baru dalam taraf siap latih dan bukan siap kerja. dalam bidang pendidikan kini terus dilakukan upaya peningkatan secara sistematis untuk menghasilkan manusia Indonesia yang berkualitas. (c) masih banyak industri yang merasa terganggu dengan kehadiran siswa PKL. (b) keterampilan yang diajarkan sudah tidak sepadan dengan kebutuhan industri. Namun di satu sisi keluhan oleh kalangan industri terhadap rendahnya kualitas lulusan SMK merupakan fakta yang harus segera disikapi dengan tindakan berupa perbaikan berbagai aspek terutama pada aspek manajemen pengelolaan SMK yang di dalamnya termasuk keprofesionalan mengajar yang harus dilaksanakan oleh guru. (a) rendahnya kemampuan lulusan. (g) kurikulum SMK disusun secara sepihak tanpa adanya keterlibatan industri. (c) rendahnya dana pendidikan sehingga terbatasnya peningkatan fasilitas media pembelajaran. (h) peranan pemerintah sebagai mediator antara sekolah dengan industri hampir 1 Penelitian Tindakan Kelas SMK . khususnya tenaga kerja tingkat operator (SMK). (e) tidak adanya sinkronisasi materi pelatihan yang baku antara SMK dengan industri. Upaya ini dilakukan. (f) peran majelis sekolah tidak optimal.

(k) kurangnya pelatihan keterampilan yang diberikan kepada guru pengajar praktik. blok dan portofolio untuk ketiga ranah. ( j ). (4) kurangnya fasilitas dan dana operasional kegiatan praktik. (1) lulusan tidak mampu menghasilkan tamatan yang berkualitas siap pakai. KBK yang berorientasi pada pencapaian kompetensi standard (KS) dan kompetensi dasar (KD). Pemikiran ke arah inovasi sebagai upaya mengeliminasi faktor-faktor penghambat dan penyebab rendahnya kualitas lulusan SMK telah diupayakan oleh pihak pemerintah melalui penerapan kurikulum berbasis kompetensi (KBK). (3) kegiatan pembelajaran praktik hanya mengandalkan kegiatan praktik di bengkel kampus.tidak ada. mengakibatkan rendahnya kualitas praktik yang dicapai mahasiswa. menunjukkan bahwa dalam perencanaan pembelajaran PSG belum sepenuhnya mewujudkan keterkaitan dan kesepadanan. seperti dalam menyampaikan isi pembelajaran. menggunakan strategi dalam bentuk pengajaran gradual dalam pola remedial dan program pengayaan dengan sistem evaluasi berbentuk harian. (l) kualitas dan kuantitas peralatan praktik di SMK masih kurang dan ketinggalan jaman. metoda dan media mengajar serta pelaksanaan evaluasi juga masih banyak kekurangan. adalah suatu kelemahan yang sangat mendasar. nampaknya merupakan sebuah model pembelajaran sebagai langkah untuk menuju ke arah perbaikan kualitas 2 Penelitian Tindakan Kelas SMK . masih banyak masalah yang dihadapi guru. Demikian pula dalam pelaksanaannya. baik pada tujuan maupun isi pembelajaran. khususnya dunia usaha/industri. (i) tidak berfungsinya Unit Produksi (UP) sebagai” replika industri” yang dapat dijadikan institusi pasangan di sekolah. Keterampilan mengajar yang dimiliki guru bersifat statis. Hasil penelitian I Made Sudana (1998) di beberapa SMK Teknologi di Jawa Tengah. (2) dalam tahapan penyelenggaraan pendidikan masih sangat kuat adanya pengertian” pendidikan demi pendidikan” artinya pengajar seakan-akan sudah puas apabila pelaksanaan proses belajar mengajar di kelas sesuai dengan program yang tercantum dalam kurikulum. dan (5) permasalahan yang ada pada pihak masyarakat pengguna tamatan. Menurut Wardiman (1994) ada beberapa permasalahan dalam pendidikan kejuruan antara lain.

serta tujuan yang dinginkan dari penelitian tindakan kelas. 3 Penelitian Tindakan Kelas SMK prinsip-prinsip dalam melakukan . Padahal menurut Bhattacharya dan Mandke (1992) bahwa pengajar seharusnya memahami tentang metodologi pengajaran. faktor pengajar menjadi sangat sentral dalam proses pembelajaran. Salah satu kendala yang sangat mempengaruhi kualitas lulusan secara keseluruhan adalah aspek pembelajaran.dan sebuah statregi antisipatif dalam persaingan mutu tenaga kerja pada era globalisasi. yang mungkin belum banyak dilakukan oleh guru di kelasnya. Namun dalam kenyataan. bagaimana konsep penelitian tindakan kelas. bahwa tujuan penyelenggaraan pendidikan adalah menghasilkan tenaga kerja yang memiliki keahlian profesional dengan tingkat pengetahuan. dalam penyelenggaraannya masih banyak dijumpai kendala. pengertian penelitian tindakan kelas. untuk meningkatkan mutu keterampilan lulusan pendidikan. karakteristik penelitian tindakan kelas. seperti minimumnya kemampuan pemerintah dalam meningkatkan jumlah dan kualitas sumber daya SMK. Deskriptif Penelitian Tindakan Kelas (class room action research) selanjutnya disingkat PTK dalam buku ajar ini membahas tentang . jenis-jenis penelitian tindakan kelas. Perbaikan pada proses pembelajaran oleh guru kini nampaknya menjadi salah satu upaya pilihan yang mesti dilakukan yaitu melalui penelitian tindakan kelas (class room action research). keterampilan dan etos kerja yang sesuai dengan tuntutan lapangan kerja. maka upaya perbaikan terhadap kualitas tenaga pengajar khususnya peningkatan kemampuan yang mencakup pengetahuan dan skill bagi guru-guru SMK sangat mutlak dilakukan agar dapat mengoptimalkan pemanfaatan sumber daya yang ada di sekolah sebagai salah satu solusinya Berdasarkan kondisi di atas. B. Seperti dikemukakan oleh Soewarni (1993) dan Sulaiman (1993). Menyadari keterbatasan ditinjau dari berbagai variabel. karena seorang pengajar dituntut untuk mampu mengelola dan mengevaluasi proses belajar siswanya.

Kemampuan mengidentifikasi permasalahan-permasalahan riil yang dihadapi di kelas 2. Kompetensi dan Indikator a) Kompetensi Setelah menyelesaikan seluruh kegiatan belajar dalam buku ajar ini. E. maka peserta dituntut untuk memahami pengetahuan tentang metodologi penelitian secara umum. Oleh karena itu untuk dapat memahami dan menerapkan petunjuk-petunjuk maupun konsep-konsep yang ada dalam buku ini. kompetensi yang akan dicapai setelah mempelajari buku ajar ini.penelitian tindakan kelas. di samping dari bahan buku ajar ini. penguasaan aplikasi teknik analisis statistik dan juga terutama dalam menginterprestasikan hasil analisis statistik yang dilibatkan nantinya. D. serta paham tentang tata cara menulis karya ilmiah yan diperlukan dalam menyusun proposal penelitian maupun pembuatan laporan akhir peneli-tian. persyaratan yang harus diperhatikan dalam melakukan penelitian tindakan kelas. peserta diharapkan mempunyai kompetensi : 1. peserta diharapkan dapat menginventaris berbagai permasalahan yang ditemukan di lapangan yang selanjutnya dilakukan penajaman-penjaman sehingga peserta tidak akan kesulitan di dalam mengangkat sebuah permasalahan untuk dijadikan sebuah tema penelitian sampai melaporkan hasil akhir penelitian nantinya. langkah-langkah yang dipertimbangkan dalam melakukan penelitian tindakan kelas. Menerapkan teori-teori penelitiaan tindakan kelas yang diberikan dalam pembelajaran ini 4 Penelitian Tindakan Kelas SMK . Petunjuk Belajar Buku ajar ini hanya membahas garis-garis besar cara melakukan penelitian tindakan kelas. C. Prasyarat Untuk memudahkan memahami bagaimana melakukan penelitian tindakan kelas.

Peserta dapat menunjukkan berbagai permasalahan yang ditemukan di kelas 2. Peserta mampu menerapkan teknik analisis statistik yang tepat dalam proposal yang disusun 5. Peserta mampu dalam mengidentifikasi dan menentukan tema penelitian. Melakukan penelitian tindakan kelas berdasarkan permasalahan riil yang ditemukan di kelas b) Indikator Sebagai ukuran keberhasilan dari proses pembelajaran ini dapat diketahui melalui : 1. Peserta memiliki kemapuan menulis proposal penelitian tindakan kelas 4. 3. Peserta mampu melakukan penelitian kelas sesuai dengan kaidah-kaidah yang ada. 5 Penelitian Tindakan Kelas SMK .3. Menyusun proposal penelitian tindakan kelas 4.

tujuan penelitian tindakan kelas. Peserta dapat menjelaskan jenis-jenis penelitian tindakan kelas 3.BAB II KONSEP PENELITIAN TINDAKAN KELAS A. prinsip-prinsip dalam melakukan penelitian tindakan kelas. Memahami karakteristik penelitian tindakan kelas 2). Peserta dapat menjelaskan karakteristik penelitian tindakan kelas 4. Dengan demikian setelah mempelajari materi ini. kompetensi yang akan dicapai setelah mempelajari buku ajar ini. Memahami arti dan makna penelitian tindakan kelas 2. Mengidentifikasi jenis-jenis penelitian tindakan kelas. Indikator Sebagai ukuran keberhasilan dari proses pembelajaran ini dapat diketahui melalui : 1. 3. konsep penelitian tindakan kelas. Kompetensi dan Indikator 1). karakteristik penelitian tindakan kelas. langkahlangkah dalam melakukan penelitian tindakan kelas. peserta akan mendapatkan gambaran yang lebih rinci tentang konsep PTK dan langkah-langkah pelaksanaannya. Peserta dapat memahami prinsip-prinsip dalam melakukan PTK Pengantar Pada bagian ini dibahas tentang pengertian apa yang dimaksud dengan penelitian tindakan kelas. jenis-jenis penelitian tindakan kelas. 6 Penelitian Tindakan Kelas SMK . persyaratan yang harus dipertimbangkan dalam melakukan penelitian tindakan kelas. Kompetensi Setelah mempelajari materi ini peserta diharapkan : 1. Peserta dapat menjelaskan arti dan makna penelitian tindakan kelas 2.

Meningkatkan rasa percaya diri guru 4. melaksanakan. Temuan penelitian tradisional sering sukar diterapkan untuk memperbaiki pembelajaran 3. Fokus penelitian berupa kegiatan pembelajaran 5. Masalah berawal dari guru 2. Guru bertindak sebagai pengajar dan peneliti. Guru mempunyai otonomi untuk menilai kinerjanya 2. Apa manfaat PTK bagi guru? 1. Mengapa guru dianggap paling tepat untuk melakukan PTK ? 1. Interaksi guru-siswa berlangsung secara unik 5. Meningkatkan profesionalitas guru 3. Pola Penelitian Tindakan Kelas Apa itu Penelitian Tindakan Kelas? Penelitian tindakan kelas (PTK) adalah sebuah penelitian yang dilakukan oleh guru di kelasnya sendiri dengan jalan merancang.B. 1. Guru merupakan orang yang paling akrab dengan kelasnya 4. dan merefleksikan tindakan baik secara manidiri maupun kolaboratif dan partisipatif dengan tujuan untuk memperbaiki kinerjanya sebagai guru sehingga hasil belajar siswa dapat meningkat. Membantu guru memperbaiki mutu pembelajaran 2. Tujuannya memperbaiki pembelajaran 3. Keterlibatan guru dalam berbagai kegiatan inovatif yang bersifat pengembangan mempersyaratkan guru untuk mampu melakukan PTK di kelasnya. Metode utama adalah refleksi diri dengan tetap mengikuti kaidahkaidah penelitian 4. Memungkinkan guru secara aktif mengembangkan pengetahuan dan keterampilannya 7 Penelitian Tindakan Kelas SMK . PTK memiliki karakteristik sebagai berikut.

PTK dimulai dengan adanya masalah yang dirasakan sendiri oleh guru dalam pembelajaran.PTK sebagai salah satu metode penelitian terdapat beberapa keterbatasan. Berbagai upaya pembaharuan pemerintah untuk meningkatkan kualitas pendidikan antara lain peningkatan kurikulum melalui isi. Peran guru yang bertindak sebagai pengajar dan sekaligus peneliti sering membuat sangat repot. Penelitian tindakan kelas dapat dilakukan oleh guru sebagai usaha mengejar ketinggalan dunia lain yang sibuk menerapkan berbagai ekpserimen dengan berbagai pendekatan pembelajaran yang dipandang sebagai terobosan untuk meningkatkan kualitas pendidikan. Penelitian tindakan kelas merupakan penelitian guru yang bersifat reflektif. Penelitian tindakan kelas yang dikenal dengan istilah Classroom Action Research banyak dilakukan dosen di perguruan tinggi dan guru sekolah. Masalah tersebut dapat berupa masalah yang berhubungan dengan proses dan hasil belajar siswa yang tidak sesuai dengan harapan guru atau hal-hal lain yang berkaitan dengan perilaku mengajar guru dan perilaku belajar siswa. yang ditindak lanjuti dengan kegiatan nyata melalui penelitian tindakan kelas yang direncanakan dan dapat diukur tingkat keberhasilannya. Tidak mungkin melakukan generalisasi karena sample sangat terbatas 3. 8 Penelitian Tindakan Kelas SMK . pengembangan melalui penelitian pembelajaran seperti penelitian tindakan kelas ( action research). pemerataan pendidikan. antara lain: 1. Artitinya penelitian guru berawal dari masalah-masalah yang di alami guru di dalam proses pembelajaran. yang kemudian di refleksikan sebagai alternatif pernecahan masalah. Akhir-akhir ini di Indonesia berkembang penelitian tindakan kelas kelas. Peningkatan kualitas pendidikan merupakan program pembangunan pemerintah dalam rangka mengatasi keterbelakangan. Validitasnya yang masih sering disangsikan 2.

Siklus penelitian kelas dapat bersifat spiral seperti berkut ini. perencanaan. observasi. sehingga mampu dalam menyelesaikan masalah yang dihadapi. tiga atau lebih. R R R A A A P P P Keterangan : P = Plan A = Action/Observation R = Reflection Jumlah tahapan siklus yang akan dilakukan tergantung dari hasil perlakuan yang diperoleh. Penelitian tindakan kelas dilakukan dalam proses bersiklus yang terdiri empat tahapan.siklus atau perulangan-perulangan tertentu tindakan guru kelas. Jadi bisa satu tahapan. pelaksanaan tindakan.Apabila di dalam melaksanakan kegiatan nyata belum / tidak berhasil mencapai target hasil yang diharapkan atau menemukan masalah baru diperlukan kegiatan berikutnya yang dikenal dengan penelitian siklus sebagai cara pemecahan masalah dengan alternatif lain dan siklus-silkus selanjutnya sampai masalah dapat di atasi dengan tuntas. dan refleksi. 9 Penelitian Tindakan Kelas SMK . Oleh karena itu penelitian tindakan kelas merupakan penelitian yang memiliki siklus . dua .

Bentuk lain dari perencanaan di atas dapat gambarkan sebagai berikut: KONSTRUKTIF Perencanaan REKONSTRUKTIF Tindakan Refleksi Observasi (Wacana antar partisipan) (Praktik Dalam Konteks) 1. serta pemahaman mereka terhadap praktik-praktik itu dan terhadap situasi tempat dilakukan praktikpraktik tersebut. 1988 .5-6 ). ( Kemmis dan Taggart. Definisi Penelitian Tindakan kelas Penelitian tindakan kelas adalah : Intervensi skala kecil terhadap tindakan di dunia nyata dan pemeriksaan yang cermat terhadap pengaruh intervensi tesebut ( Cohen dan Manion 1980 : 174 ).. Bentuk penelitian yang bersifat reflektif dengan melakukan tindakan-tindakan tertentu agar dapat 10 Penelitian Tindakan Kelas SMK . Bentuk penelitian reflektif diri kolektif yang dilakukan pesertapesertanya dalam situasi sosial untuk meningkatkan penalaran dan keadilan praktik pendidikan dan praktik sosial mereka.

1999). 1992). memperdalam. yang dilakukan oleh pelaku tindakan (pendidik). Peneliti diundang memasuki situasi yang telah ada dan kemudian peneliti melakukan diagnosa situasinya. Empat jenis penelitian tindakan kelas itu adalah : 1. ( Stephen Kemmis. Penelitian Tindakan Partisipan. 1997 ). Suatu bentuk kajian yang bersifat reflektif oleh pelaku tindakan yang dilakukan untuk meningkatkan kemantapan rasional dari tindakan mereka dalam melaksanakan tugas. serta memperbaiki kondisi praktik pembelajaran tersebut dilaksanakan (Pelatih Proyek PGSM. Dengan demikian Penelitian Tindakan Kelas adalah merupakan penelitian yang bersifat reflektif. 2.memperbaiki dan atau meningkatkan praktik-praktik pem-belajaran di kelas secara profesional. ( Suyanto. Suatu bentuk penelaahan (incuiry) melalui refleksi diri yang dilakukan oleh peserta kegiatan pendidikan tertentu dalam situasi sosial untuk memperbaiki rasionalisasi dan kebenaran dari: praktik sosial atau kependidikan yang mereka lakukan sendiri. atau dua jenis. ada yang membagi menjadi empat jenis. pemahaman terhadap tindakan-tindakan yang dilakukan itu. Jenis-jenis Penelitian Tindakan Kelas Para ahli peneliti pendidikan membagi Penelitian tindakan kelas berbeda-beda. 2. Dalam bentuknya yang paling jelas penelitian tindakan diagnostik dapat dijelaskan sebagai berikut. pemahaman mereka terhadap praktik tersebut. Penelitian Tindakan Diagnostik yaitu penelitian yang dirancang guna menuntun kearah tindakan. Penelitian jenis ini tumbuh dan berkembang karena dua kelemahan penelitian tindakan jenis pertama a) diagnostik tidak selalu mendorong dilakukannya tindakan b) keterlibatan tim peneliti dalam masyarakat terkait kurang menjamin pelaksanaan tindak- 11 Penelitian Tindakan Kelas SMK . tiga. situasi di tempat praktik itu dilaksanakan.

Gagasan dasar penelitian tindakan jenis ini adalah melakukan sesuatu dan membukukan apa yang dilakukan dan apa yang terjadi. Penelitian tinclakan eksperimental. Artinya masalah yang diteliti adalah masalah-masalah riil yang dialami guru sehari-hari bukan masalah yang direkayasa. Dengan demikian mereka itu tidak hanya dapat menyadari perlunya melaksanakan program tindakan tertentu akan tetapi secara jiwa dan raga akan terlibat dalam program tindakan tersebut. Proses penelitiannya pada pokoknya berkenaan dengan dengan penyimpanan catatan dan pengumpulan pengalaman dalam pekerjaan sehari-hari. Penelitian ini adalah penelitian yang menerapkan berbagai teknik tindakannya dengan efektif. 2. Ciri-Ciri Penelitian Tindakan Kelas a. 3. 3. Penelitian tindakan kelas selalu berorientasi pada pernecahan masalah. Ciri-ciri utama Penelitian tindakan kelas memiliki ciri utama: 1. Hampir selalu ada lebih dari satu cara untuk mencapai sesuatu. 4. Masalahnya adalah menemukan cara mana yang terbaik. pema12 Penelitian Tindakan Kelas SMK . Penelitian tindakan yang hanya menghasilkan suatu pengertian.an yang disarankan. Gagasan sentral penelitian tindakan partisipan ini adalah bahwa orang yang melakukan tindakan harus juga terlibat dalam proses penelitian awal. Penelitian Tindakan Empiris. Penelitian tindakan kelas selalu berfokus pada masalah yang riil yang muncul dari proses pembelajaran atau dunia kerja peneliti yang ada dalam tanggung jawabnya.

Masalah tidak berasal dari luar atau saran orang lain yang mengenal masalah yang terjadi di dalam kelas. bentuk tindakan. orang yang melakukan. Masalah penelitian bukan berasal dari hasil penelitian atau hasil kajian yang diluar penghayatan guru. dan refleksi hasil dari tindakan. b. Peneltian tindakan kelas adalah siklus (Cyclic). 13 Penelitian Tindakan Kelas SMK . permasalahnnya diangkat dari dalam tempat guru mengajar yang benar-benar dihayati oleh guru sebagai masalah yang harus diatasi. aksi dari tindakan. Penelitian tindakan kelas memerlukan berbagai cara koleksi data. 5. Penelitian tindakan kelas bersifat kolaborasi. Penelitian tindakan kelas berorientasi pada peningkatan kualitas. berbagai cara pengumpulan data umumnya digunakan. skenario tindakan seperti pengamatan. alat ukur sebagai kontrol keberhasilan dari tindakan pemecahan masalah. Artinya tindakan pada penelitian ini melalui program yang cermat seperti jadwal rinci. Penelitian tindakan menegaskan pentingnya aksi dari setiap komponen dari sistem organisasi berkembang menjadi lebih baik. Oleh karena itu pada penelitian tindakan kelas guru harus jujur dan peka bahwa benar-benar memiliki masalah dalam proses pembelajaran.Untuk memenuhi prinsip kebenaran itu problem. 4. Ciri-ciri lain dari penelitian tindakan kelas sebagai berikut: Pertama. Kedua.haman dianggap tidak bermanfaat. 3. karena tidak memecahkan masalah. Artinya peneliti dapat bekerja sama dengan orang lain (dosen) dalam melakukan tindakan. penelitian tindakan kelas adalah bersifat kolaboratif. Guru tidak harus sendirian berupaya memperbaiki proses pembelajarannya. 6.

dan dilakukan guru sendiri ( bukan orang lain ) 14 Penelitian Tindakan Kelas SMK . Pada umumnya dosen tidak mempunyai akses langsung. melainkan sebagai sejawat di samping sebagai pendidik calon guru yang seyogyanya memiliki kebutuhan untuk belajar dalam mengakrabi lapangan demi peningkatan mutu kinerjanya sendiri. 4. Penelitian tindakan kelas perlu didasari oleh permasalahan praktis yang dirasakan guru di dalarn kelas. Oleh karena itu ciri kolaboratif ini harus secara konsisten tertampilkan sebagai kerjasama kesejawatan dalam keseluruhan tahapan penyelenggaraan PTK. Artinya penelitian di kelas yang tanpa memberikan suatu tindakan apa-apa dikelas untuk memperbeik proses pennbelajaran bukan penelitian tindakan kelas. Bersifat reflektif (a reflective practice. made public). Penelitian yang dilakukan dikelas belum tentu merupakan penelitian kelas. dosen. Artinya keinginan untuk melakukan penelitian muncul karena adanya adanya permasalahan praktis yang dihayati dalam pelaksanaan tugas sehari-hari oleh guru sebagai pengelola program pembelajaran di kelas atau sebagai jajaran staf pengajar di sebuah sekolah. Usaha kolaboratif antara guru dan dosen (a collaborative effort between school teachers and teacher educators). atau guru lain. penelitian tindakan kelas merupakan jenis penelitian yang mememuculkan adanya tindakan tertentu untuk memperbaiki proses belajar mengajar dikelas. c. maka PTK diselenggarakan secara kolaboratif dengan guru yang kelasnya dijadikan kancah PTK. b. Perbaikan proses pembelajaran dari dalam (an inquiry on practice from within).Guru dapat dibantu pakar pendidikan lain seperti pengawas. Ketiga. Keterlibatan dosen LPTK dalam PTK bukanlah sebagai ahli pendidikan Yang tengah mengemban fungsi pembina guru. Penelitian Tindakan Klas mempunyai karakteristik sebagai berikut: a.

Penelitian tindakan kelas tidak boleh mengganggu kegiatan guru mengajar dikelasnya. dengan metodologi yang tidak terlalu kaku namun tetap menekankan obyektivitas. Metode yang digunakan harus cukup andal (reliable) yang memberi kemudahan guru mengidentifikasikan masalah. Lembar Kegiatan Peserta Guna dapat memahami dan mengaplikasikan isi dari kajian materi ini. Peserta mengidentifikasi persyaratan-persyaratan yang harus diperhatikan bila hendak melakukan PTK D. c. melakukan penelahaan lebih mendalam dengan cara diskusi dan meringkas point-point penting tentang ciri-ciri dan prinsip-prinsip yang harus diperhatikan dalam melakukan PTK. Prinsip-prinsip penelitian tindakan kelas . Penelitian kelas mempunyai prinsip-prinsip antara lain: a.yang tidak mengetahui tentang hal-hal timbul dan yang terjadi di dalam kelas untuk memperbaiki proses pembelajaan secara langsung. Penelitian tindakan kelas tidak harus mandiri tetapi guru dapat berkolaborasi dengan dosen Lernbaga Pendidikan Tenaga Kependidikan maupun dengan teman sejawat sebagai mitra sejawat dalam penelitian ini. merumuskan masalah. Peserta meringkas bahan pelatihan yang telah dijelaskan oleh instruktur 2. Metode pengumpulan data yang digunakan tidak menuntut waktu yang berlebihan yang dapat mengganggu proses pembelajaran. Artinya guru dapat menempuh prosedur yang mudah dilakukan sendiri tanpa meninggalkan tugas sebagai guru yang baik. mengembangkan strategi pembelajaran C. b. 5. Latihan 1. Peserta mendiskusikan makna skema rancangan PTK secara mendalam 3. 15 Penelitian Tindakan Kelas SMK . hipotesis meyakinkan. setiap peserta ditugaskan untuk : 1.

Apa hakekat utama dari penelitian tindakan kelas tersebut ? 3. Penelitian tindakan kelas yang dikenal dengan istilah Classroom Action Research banyak dilakukan dosen di perguruan tinggi dan guru sekolah. Kenapa PTK tidak tepat dilakukan oleh orang lain ? 5. Apa tujuan dan manfaatnya jika dalam penelitian tindakan kelas dilakukan secara kolaboratif dengan pihak lain (dosen LPTK) ? 6. Faedah apa yang dapat dipetik dengan model penelitian yang bersifat siklus dan reflketif ? 8. Rangkuman Penelitian Tindakan Kelas (PTK) bermula dari temuan riil oleh calon peneliti di lapangan (kelasnya). F. Pada dasarnya PTK tidak harus dilakukan oleh guru sendirian. yang semuanya harus dijadikan tuntunan dan pertimbangan oleh guru yang akan melakukan PTK. Penelitian tindakan kelas merupakan penelitian yang bersifat reflektif.2. Jelaskan makna dan fungsi dilakukannya PTK oleh seorang guru ? 4. Prinsip-prinsip apa aja yang harus dipertimbangkan dalam melaksanakan sebuah PTK ? 7. Tes Formatif 1. PTK mempunyai ciri-ciri utama maupun ciri-ciri khusus. Penelitian tindakan kelas merupakan penelitian yang memunculkan tindakan tertentu untuk proses perbaikan pembelajaran. Apa alasannya PTK selalu dirancang dalam bentuk tahapan siklus yang berulang-ulang ? 2. tetapi dapat bekerjasama dengan dosen LPTK sebagai mitra dan sejawat dalam upaya mencari strategi pemecahan masalah yang dihadapi oleh guru di kelasnya. Jelaskan ciri-ciri yang dimiliki oleh PTK ? 16 Penelitian Tindakan Kelas SMK . Setiap peserta ditugaskan mengumpulkan hasil identifikasi masalah ! E.

17 Penelitian Tindakan Kelas SMK .

Peserta memahami prosedur menyusun proposal PTK b. bentuk dan skenario tindakan. Kompetensi dan Indikator 1) Kompetensi yang ingin dicapai dari pembelajaran ini : a. Peserta mampu menyusun proposal PTK b. Penelitian Tindakan Kelas (PTK) memiliki potensi yang sangat besar untuk meningkatkan pembelajaran apabila diimplementasikan dengan baik dan benar. serta prosedur analisis dan interpretasi data penelitian. Peserta memahami cara menyusun laporan hasil penelitian 2) Indikator keberhasilan pengajaran ini: a. Peserta dapat membuat rancangan tindakan pelaksanaan PTK c. Diimplementasikan dengan baik di sini berarti pihak yang terlibat (dosen dan guru) mencoba dengan sadar mengembangkan kemampuan dalam mendeteksi dan memecahkan masalah-masalah pendidikan dan pembelajaran melalui tindakan bermakna yang diperhitungkan dapat memecahkan masalah atau memperbaiki situasi dan kemudian secara cermat mengamati pelaksana-annya untuk mengukur tingkat keberhasilannya. Peserta memahami cara menganalisis data penelitian d. Preserta dapat menggunakan teknik analisis data d. pengembangan instrumen untuk mengukur kebehasilan tindakan.BAB III PROSEDUR PENELITIAN TINDAKAN KELAS A. 18 Penelitian Tindakan Kelas SMK . Diimplementasikan dengan benar berarti sesuai dengan kaidah-kaidah penelitian tindakan. Peserta dapat membuat laporan PTK Pengantar Bagian ini membahas bagaimana implementasi penelitian tindakan kelas untuk peningkatan kualitas pembelajaran yang mencakup diagnosis dan penetapan masalah yang ingin diselesaikan. Peserta memahami rencana tindakan dalam melaksanakan PTK c.

dan perbandingan yang akan mendukung dan melandasi pelaksanaan PTK. strategi. bahkan bersamaan. konsep. 19 Penelitian Tindakan Kelas SMK . Semua hal yang berkaitan dengan hal diatas perlu dikumpulkan dengan sebaik-baiknya. (1) mendeskripsikan dan menemukan masalah PTK dengan berbagai metode atau cara. Selama pelaksanaan tindakan dalam siklus dilakukan pula pengamatan dan refleksi. tujuan dan manfaat yang diharapkan. Langkah-Langkah PTK a. (3) memilih dan merumuskan masalah PTK baik berupa pertanyaan atau pernyataan sesuai dengan masalah dan cara pemecahannya. (2) menentukan cara pemecahan masalah PTK dengan pendekatan. Pada dasarnya sebuah proposal penelitian berisi tentang penjelasan yang diawali dengan pemaparan latar belakang masalah yang ditemukan. yaitu. Melasanakan siklus (rencana tindakan) di dalam kelas. (7) menetapkan cara mengumpulkan data sekaligus menyusun instrumen yang diperlukan untuk menjaring data PTK. (5) memilih dan menyusun persfektif. (4) menetapkan tujuan pelaksanaan PTK sesuai dengan masalah yang ditetapkan.B. b. maka dalam kegiatan ini meliputi beberapa kegiatan pokok. pengamatan maupun refleksi dapat dilakukan secara beiringan. Dalam kegiatan ini diterapkan rencana tindakan yang telah disusun dengan variasi tertentu sesuai dengan kondisi kelas. (6) menyusun siklus-siklus yang berisi rencana-rencana tindakan yang diyakini dapat memecahkan masalah-masalah yang telah dirumuskan. Sebelum melakukan penelitian seorang calon peneliti (guru) dituntut untuk menyusun proposal yang akan dijadikan panduan dalam melaksanakan kegitian penelitian. media. atau kiat tertentu. baik pelaksanaan tindakan. sampai rancangan analisis data yang akan digunakan. Menyusun proposal PTK. Oleh karena itu dalam rangka menyusun sebuah proposal. (8) menetapkan dan menyusun cara-cara analisis data PTK.

Guru yang telah berpengalaman melakukan penelitian tindakan kelas mungkin dapat langsung mengatakan permasalahan yang dihadapinya yang mungkin dapat diteliti bersama dan kemudian membahas masalah tersebut dengan dosen. Dosen baru-boleh 20 Penelitian Tindakan Kelas SMK . Menganalisis data Data yang telah dikumpulkan baik data tahap perencanaan. Oleh karena itu. Inilah bentuk laporan PTK. dan kajian konsep atau teoritis. Setelah itu. rumusan masalah. Hasil analisis data ini dipaparkan sebagai hasil PTK. Analisis data ini harus disesuaikan dengan rumusan masalah yang telah ditetapkan. pengamatan. pelaksanaan tindakan. Dalam hal ini dosen perlu meminta izin kepada guru untuk hadir di kelas dan mengamati guru mengajar. Guru tersebut mungkin belum dapat secara langsung mengemukakan permasalahan yang mungkin dapat diteliti bersama dosen. d. Setelah pembelajaran berakhir dosen dapat terlebih dahulu menanyakan kepada guru masalah apa yang dirasakan guru pada saat pembelajaran sebelum mengusulkan salah satu permasalahan yang dipikirkan dosen. perlu dibuat kesimpulan dan rumusan saran. diagnosis masalah hendaknya dilakukan oleh guru untuk dipecahkan. Pada kenyataannya dosen dapat diajak guru untuk berkolaborasi melakukan PTK dan menanyakan masalah-masalah apa yang dihadapi guru yang mungkin dapat diteliti melalui PTK. Diagnosis dan Penetapan Masalah Masalah PTK yang merupakan penelitian guru di sekolah hendaknya berasal dari persoalan-persoalan praktis yang dihadapi guru di kelas. tujuan. maupun refleksi.c. Lain halnya dengan guru yang belum berpengalaman dalam PTK. 1. Paparan hasil PTK ini disatukan dengan deskripsi masalah. Dalam kegiatan ini pertamatama perlu ditulis paparan hasil-hasil PTK. Menulis laporan PTK Kegiatan yang berkaitan penulisan laporan dapat dilakukan bersamaan dengan kegiatan menganalisis data.

atau pelaksanaannya sudah perlu diganti atau dimodifikasi. dan 3) peralatan tertentu. Dari sekian banyak kemungkinan masalah. masalah penelitian yang dipilih hendaknya memenuhi kriteria “dapat diteliti”. dapat “ditindaki”. misalnya 2 minggu atau satu bulan. 2) meningkatkan “konsep diri” siswa dalam belajar. PTK yang dikaitkan dengan pengembangan/penggunaan sumber-sumber belajar dapat dilakukan dalam rangka pengembangan pemanfaatan 1) model atau peraga. 2) sumber-sumber lingkungan. 3) meningkatkan peranan siswa dalam belajar. 2) meningkatkan partisipasi siswa dalam belajar. (b) proses belajar-mengajar. dan orang tua. guru. serta 4) meningkatkan kompetensi guru secara profesional. Dalam kegiatan di kelas. “Dikembangkan berkelanjutan” berarti bahwa setiap waktu tertentu. rumusan masalahnya. dan 4) memperbaiki metode evaluasi. Hanya masalah yang dapat “dikembangkan berkelanjutan” dalam kegiatan harian selama satu semester atau satu tahun yang dapat dipilih menjadi topik. 3) meningkatkan sifat dan kepribadian siswa. 3) menerapkan pendekatan belajar-mengajar inovatif. maupun (d) sebagai wahana peningkatan personal dan profesional. dan 4) mengikutsertakan pihak ketiga dalam proses belajar-mengajar. PTK yang dikaitkan dengan pengelolaan kelas dapat dilakukan dalam rangka: 1) meningkatkan kegiatan belajar-mengajar. guru (bersama dosen) perlu mendiagnosis masalah apa atau masalah mana yang perlu diprioritaskan peme21 Penelitian Tindakan Kelas SMK . (c) pengembangan/penggunaan sumber-sumber belajar. 2) mengembangkan kurikulum.mengajukan permasalahan bila guru tidak dapat mendeteksi adanya masalah di kelasnya (salah satu bentuk penelitian kolaborasi). Jadi. PTK yang dikaitkan dengan proses belajar mengajar dapat dilakukan dalam rangka: 1) menerapkan berbagai metode mengajar. atau hipotesis tindakannya. guru dapat mencermati masalah-masalah apa yang dapat dikembangkan berkelanjutan ini dalam empat bidang yaitu yang berkaitan dengan (a) pengelolaan kelas. Di dalam mendiagnosis masalah untuk PTK ini guru harus ingat bahwa tidak semua topik penelitian dapat diangkat sebagai topik PTK. PTK sebagai wahana peningkatan personal dan profesional dapat dilakukan dalam rangka 1) meningkatkan hubungan antara siswa. dan “ditindaklanjuti”.

Bagaimana memilih strategi pembelajaran yang paling tepat untuk membelajarkan materi? • Bagaimana melaksanakan pembelajaran kooperatif? Striger (2004) memberikan arahan untuk memfokuskan penelitian dengan jelas setelah melakukan refleksi mengenai apa yang terjadi yang memunculkan masalah dan apa isu serta peristiwa yang terkait dengan masalah. Penetapan masalah ini ditandai dengan penentuan permasalahan yang akan diteliti dan perumusan fokus masalahnya.cahannya dalam penelitian yang akan dilakukan itu. Penetapan masalah hendaknya dilakukan bersama (oleh dosen dan guru) setelah menganalisis seluruh pilihan masalah. aktif berpikir)? • Bagaimana menghubungkan materi pembelajaran dengan lingkungan kehidupan siswa sehari-hari agar mereka dapat menggunakan pengetahuan dan pemahamannya mengenai materi itu dalam kehidupan sehari-hari dan tertarik untuk mempelajarinya karena mengetahui manfaatnya? •. 22 Penelitian Tindakan Kelas SMK . dan keinginan guru serta dosen (bersama) untuk memecahkan salah satu atau beberapa di antaranya. minat. Rumusan fokus masalah yang mungkin ditetapkan guru (dan dosen) dapat berupa rumusan sebagai berikut: * Bagaimana membelajarkan siswa materi tertentu agar siswa mau dan mampu belajar? Masalah-masalah lain yang mungkin dihadapi guru dapat berupa : • Bagaimana meningkatkan minat dan motivasi siswa untuk belajar? Yang “ideal” itu dapat meningkatkan antusiasme siswa sehingga mereka sepertinya “tidak sabar” menunggu-nunggu datangnya jam pelajaran yang dibina oleh guru tersebut. Isu atau masalah itu harus dinyatakan dalam bentuk pertanyaan yang dapat diteliti dan diidentifikasi tujuan meneliti masalah tersebut. • Bagaimana mengajak siswa agar di kelas mereka benar-benar aktif belajar (aktif secara mental maupun fisik.

Guru menduga bahwa siswa kurang aktif dalam mengikuti proses belajar. Masalah: Siswa perlu digalakkan untuk aktif dalam kelas. baik secara ”hands on”. Masalah penelitian: Nyatakan isu sebagai suatu masalah yang visible dapat diteliti.Isu atau topik yang ingin diteliti: Definisikan apa isu atau peristiwa yang menimbulkan permasalahan?. aktif secara utuh (sedapat mungkin ”hands on” atau ”minds on”. di kelas. Misalnya dipilih masalah sebagai berikut. Rumusan masalah: Tuliskan masalah dalam bentuk pertanyaan atau yang mempertanyakan. Isu: Siswa kurang aktif di kelas. ”minds on” maupun ”hearts on” ? 23 Penelitian Tindakan Kelas SMK . bahkan juga kalau mungkin ”hearts on”). Fokus masalah: Bagaimana meningkatkan partisipasi siswa dalam kelas? Rumusan masalah PTK yang lengkap biasanya berupa suatu pertanyaan dalam bentuk : ”Masalah apa yang terjadi di kelas. cenderung tidak pernah mengajukan pertanyaan dalam pembelajaran. Guru sering memberi kesempatan kepada siswa untuk bertanya tetapi hampir tidak ada siswa yang bertanya. dan sekolah mana hal itu terjadi?” Contoh fokus masalah (rumusan masalah yang belum dilengkapi dengan tindakan dan lokasi penelitian): Bagaimana peningkatan partisipasi siswa dalam kelas. bagaimana upaya mengatasinya. Tujuan penelitian: Deskripsikan apa yang diharapkan dapat diperoleh dengan meneliti masalah ini. apa tindakan yang dianggap tepat untuk itu.

penggunaan lingkungan sekitar sekolah. Biasanya tujuan penelitian dinyatakan dalam bentuk pointer-pointer. strategi pembelajaran berbasis masalah dan seterusnya). 24 Penelitian Tindakan Kelas SMK . Setelah ditetapkan fokus masalah seperti itu. Lebih jauh dikatakannya dosen dan guru perlu membahas bentuk dan macam tindakan (atau tindakan-tindakan) apa yang kira-kira paling dikehendaki untuk dicoba dan dilaksanakan dalam kelas. ”minds on” maupun ”hearts on”. Bentuk dan macam tindakan ini kemudian dimasukkan dalam judul usulan penelitian yang akan disusun bersama oleh dosen dan guru. gagas pendapat mengenai tindakan apa saja yang dapat memecahkan masalah yang dihadapi akan menghasilkan banyak alternatif tindakan yang dapat dipilih. penggunaan sungai. dosen dan guru berdiskusi mengadakan gagas pendapat mengenai tindakan apa saja yang dapat dipilih untuk memecahkan masalah. baik secara ”hands on”. atau dapat pula dalam bentuk suatu strategi pembelajaran (misalnya strategi pembelajaran kooperatif tipe Jigsaw atau yang lainnya. Bagaimana tindakan tersebut akan dilaksanakan dalam PTK perlu direncanakan dengan cermat. Contoh tujuan (yang belum dilengkapi dengan tindakan dan lokasi penelitian): Meningkatkan partisipasi siswa dalam kelas. Bentuk dan Skenario Tindakan Menurut Herawati Susilo dan Kisyani Laksono (2007). dan seterusnya). Contoh tindakan untuk rumusan masalah di atas: problem possing (memunculkan masalah).Tujuan penelitian: Merupakan jawaban terhadap masalah penelitian. Perencanaan pelaksanaan tindakan ini dituangkan dalam bentuk Rencana Pembelajaran (RP) atau dalam bentuk Skenario Pembelajaran. Tindakan yang dipilih dapat disebutkan sebagai suatu nama tindakan (misalnya penugasan siswa membaca materi pelajaran 10 menit sebelum pembelajaran) atau dalam bentuk penggunaan salah satu bentuk media pembelajaran (misalnya penggunaan peta konsep. 2.

3. 1). 25 Penelitian Tindakan Kelas SMK . dan output (hasil). dst. 3). nilai peserta didik berkisar pada angka 50). mungkin diperlukan pula instrumen pendukung yang mengarah pada pemberdayaan tindakan yang akan dilakukan. Dalam tahap ini banyak format yang dapat digunakan. Pengembangan Instrumen Untuk mengukur keberhasilan tindakan Instrumen yang diperlukan dalam penelitian tindakan kelas (PTK) haruslah sejalan dengan prosedur dan langkah PTK. Instrumen untuk output Adapun instrumen untuk output berkaitan erat dengan evaluasi pencapaian hasil berdasarkan kriteria yang telah ditetapkan. buku teks dalam kondisi awal. Dalam hal ini tes bekal awal dapat menjadi instrumen yang tepat. proses (saat berlangsung). Instrumen untuk input Instrumen untuk input dapat dikembangkan dari hal-hal yang menjadi akar masalah beserta pendukungnya. Dari sisi proses Dari sisi proses (bagan alirnya). misalnya: format peta kelas dalam kondisi awal. 3. Misalnya: akar masalah adalah bekal awal/prestasi tertentu dari peserta didik yang dianggap kurang. Di samping itu. Misalnya: nilai 75 ditetapkan sebagai ambang batas peningkatan (pada saat dilaksanakan tes bekal awal. 2). Instrumen untuk proses Instrumen yang digunakan pada saat proses berlangsung berkaitan erat dengan tindakan yang dipilih untuk dilakukan.a. Instrumen untuk mengukur keberhasilan tindakan dapat dipahami dari dua sisi yaitu sisi proses dan sisi hal yang diamati. Akan tetapi. format yang digunakan hendaknya yang sesuai dengan tindakan yang dipilih. instrumen dalam PTK harus dapat menjangkau masalah yang berkaitan dengan input (kondisi awal).

Sejauh mungkin. Catatan anekdotal mencatat kejadian di dalam kelas secara informal dalam bentuk naratif. Dari sisi hal yang diamati. catatan itu memuat deskripsi rinci dan lugas peristiwa yang terjadi di kelas.maka pencapaian hasil yang belum sampai pada angka 75 perlu untuk dilakukan tindakan lagi (ada siklus berikutnya). Catatan anekdotal memfokuskan pada hal-hal spesifik yang terjadi di dalam kelas atau catatan tentang aktivitas belajar siswa dalam pembelajaran. batas waktu dan rambu-rambu pengamatan jelas. 3.b. yaitu a) pengamat harus mengamati keseluruhan sekuensi peristiwa yang terjadi di kelas. instrumen untuk mengamati kelas (observing classroom). Salah satu bentuk instrumen pengamatan adalah catatan anekdotal (anecdotal record). Catatan anekdotal tidak mempersyaratkan pengamat memperoleh latihan secara khusus. Pengamatan terhadap Guru (Observing Teachers) Pengamatan merupakan alat yang terbukti efektif untuk mempelajari tentang metode dan strategi yang diimplementasikan di kelas. respon siswa terhadap lingkungan kelas. Dari sisi Hal yang Diamati Selain dari sisi proses (bagan alir). dsb. c) hasil pengamatan dicatat lengkap dan hati-hati. b) tujuan. tentang organisasi kelas.1992). 26 Penelitian Tindakan Kelas SMK . Suatu catatan anekdotal yang baik setidaknya memiliki empat ciri. instrumen dapat dikelompokkan menjadi 3 (tiga). misalnya. dan instrumen untuk mengamati perilaku siswa (observing students) (Reed dan Bergermann. yaitu: instrumen untuk mengamati guru (observing teachers). 1). dan d) pengamatan harus dilakukan secara objektif. instrumen dapat pula dipahami dari sisi hal yang diamati.

c) Catatan Anekdotal Pola Pengelompokan Belajar (Anecdotal Record Form for Grouping Patterns). dsb. b) Catatan Anecdotal Interaksi Guru-Siswa (Anecdotal Teacher-Student Interaction Form).Beberapa model catatan anekdotal yang diusulkan oleh Reed dan Bergermann (1992) dan dapat digunakan dalam PTK. g) Catatan Anekdotal Aktivitas Pembelajaran (Anecdotal Record of Pre-. Beberapa model catatan anekdotal kelas yang diusulkan oleh Reed dan Bergermann (1992) dan dapat digunakan dalam PTK. antara lain: a) Format Anekdotal Organisasi Kelas (Form for Anecdotal Record of Classroom Organization). 27 Penelitian Tindakan Kelas SMK . Whilst-. d) Pengamatan Terstruktur (Structured Observation). Di samping itu. pengamatan itu dapat menunjukkan strategi yang digunakan guru dalam menangani kendala dan hambatan pembelajaran yang terjadi di kelas. and Post-Teaching Activities) . Pengamatan terhadap Kelas (Observing Classrooms) Catatan anekdotal dapat dilengkapi sambil melakukan pengamatan terhadap segala kejadian yang terjadi di kelas. h) Catatan Anekdotal Membantu Siswa Berpartisipasi (Checklist for Routine Involving Students). e) Lembar Pengamatan Model Manajemen Kelas (Checklist for Management Model). dan manajemen kelas. tata letaknya. Pengamatan ini sangat bermanfaat karena dapat mengungkapkan praktik-praktik pembelajaran yang menarik di kelas. antara lain: a) Catatan Anekdotal Peristiwa dalam Pembelajaran (Anecdotal Record for Observing Instructional Events). f) Lembar Pengamatan Keterampilan Bertanya (Checklist for Examining Questions). 2). Catatan anekdotal kelas meliputi deskripsi tentang lingkungan fisik kelas.

dalam kurun waktu tertentu. dsb. d) Format Skala Pengkodean Lingkungan Sosial Kelas (Form for Coding Scale of Classroom Social Environment). d) Kartu Profil Siswa (Profile Card of Students). e) Lembar Cek Wawancara Personalia Sekolah (Checklist for School Personnel Interviews). i) Sosiogram. f) Sistem Koding Partisipasi Siswa (Coding System to Observe Student Participation in Lessons). Masing-masing individu siswa dapat diamati secara individual atau berkelompok sebelum. b) Catatan Anekdotal Perilaku Siswa (Anecdotal Record for Observing Students). Pengamatan terhadap perilaku siswa dapat mengungkapkan berbagai hal yang menarik. mulai dari sebelum dilakukan tindakan. saat berlangsung. h) Pedoman Wawancara untuk Refleksi (Interview Guide for Reflection). antara lain: a) Tes Diagnostik (Diagnostic Test) . dan seusai tindakan. c) Observasi Kelas Terstruktur (Structured Observation of Classrooms). Beberapa model pengamatan terhadap perilaku siswa diusulkan oleh Reed dan Bergermann (1992) yang dapat digunakan dalam PTK. c) Format Bayangan (Shadowing Form). g) Inventori Kalimat tak Lengkap (Incomplete Sentence Inventory). f) Lembar Cek Kompetensi (Checklist of Competencies). dan sesudah usai pembelajaran. 3). Pengamatan terhadap Siswa (Observing Students). dsb 28 Penelitian Tindakan Kelas SMK . Perubahan pada setiap individu juga dapat diamati. saat tindakan diimplementasikan.b) Format Peta Kelas (Form for a Classroom Map). e) Carta Deskripsi Profil Siswa (Descriptive Profile Chart).

misalnya perilaku. alat perekam elektronik. jurnal harian. dapat pula dilakukan secara bebas. penggambaran interaksi dalam kelas. Mills. atau pemetaan kelas (cf. catatan lapangan. Pengamatan partisipatif dilakukan oleh orang yang terlibat secara aktif dalam proses pelaksanaan tindakan. siswa. atau untuk melukiskan suatu proses . aktivitas. Wawancara hendaknya dilakukan dengan mempergunakan pedoman wawancara agar semua informasi dapat diperoleh secara lengkap. atau wawasan . observasi aktivitas di kelas. (b) Pedoman Wawancara Untuk memperoleh data dan atau informasi yang lebih rinci dan untuk melengkapi data hasil observasi. 2004: 19). Wawancara digunakan untuk mengungkap data yang berkaitan dengan sikap. kasus istimewa. dan peneliti berperan sebagai mitra. 29 Penelitian Tindakan Kelas SMK . Guru yang berkolaborasi dapat berperan pula sebagai pewawancara terhadap siswanya. Namun harus dapat menjaga agar hasil wawancara memiliki objektivitas yang tinggi. Pengamatan sangat cocok untuk merekam data kualitatif.Adapun instrumen lain selain catatan anekdotal yang dapat digunakan dalam pengumpulan data PTK dapat berwujud: (a) Pedoman Pengamatan. daftar cek). Wawancara hendaknya dapat dilakukan dalam situasi informal. kepala sekolah dan fasilitator yang berkolaborasi. dan proses lainnya. Jika dianggap masih ada informasi yang kurang. wajar. Catatan lapangaan sebagai salah satu wujud dari pengamatan dapat digunakan untuk mencatat data kualitatif. tim peneliti dapat melakukan wawancara kepada guru. Pengamatan ini dapat dilaksanakan dengan pedoman pengamatan (format. Wawancara dapat dilakukan secara bebas atau terstruktur. pendapat.

(e) Tes dan Asesmen Alternatif Pengambilan data yang berupa informasi mengenai pengetahuan. Keuntungannya bila instrumen dikembangkan pada saat penyusunan usulan adalah peneliti telah mempersiapkan diri lebih dini sehingga peneliti dapat lebih cepat mengimplementasikannya di lapangan. silabus. 1999. Tim PGSM. (d) Pedoman Pengkajian Data dokumen Dokumen yang dikaji dapat berupa: daftar hadir. demikian pula kriteria keberhasilan tindakannya. maka pencapaian hasil yang belum sampai 75% diartikan masih perlu dilakukan tindakan lagi (ada siklus berikutnya). Sumarno. Pengukuran keberhasilan tindakan sedapat mungkin telah ditetapkan caranya sejak awal penelitian. lembar kerja dll. Mills. hasil karya peserta didik. sikap. Instrumen yang dikembangkan pada saat penyusunan usulan penelitian atau dikembangkan setelah usulan penelitian disetujui untuk didanai dan dilaksanakan. nilai peserta didik berkisar pada angka 50). Keberhasilan tindakan ini disebut sebagai indikator keberhasilan tindakan. 2004). 30 Penelitian Tindakan Kelas SMK . hasil karya guru. bakat dan lainnya dapat dilakukan dengan tes atau pengukuran bekal awal atau hasil belajar dengan berbagai prosedur asesmen (cf. Misalnya: pencapaian penguasaan kompetensi sebesar 75% ditetapkan sebagai ambang batas ketuntasan belajar (pada saat dilaksanakan tes awal. Indikator keberhasilan tindakan biasanya ditetapkan berdasarkan suatu ukuran standar yang berlaku. 1997.(c) Angket atau kuesioner Indikator untuk angket atau kuesioner dikembangkan dari permasalahan yang ingin digali. arsip.

b. tindakan untuk perbaikan lebih lanjut yang juga dimonitor dengan teknik penelitian kelas. Jika di dalam desain penelitian tindakan kelas diajukan hipotesis tindakan yang merupakan keyakinan terhadap tindakan yang akan dilakukan. Analisis Data Penelitian. dan apakah perlu dilakukan tindaklanjut 2). Tahap-tahap analisis data penelitian meliputi: a. Pada proses analisis dibahas apa yang diharapkan terjadi. Validasi hipotesis Validasi hipotesis adalah diterima atau ditolaknya suatu hipotesis. interpretasi dengan acuan teori. mengapa terjadi tidak seperti yang diharapkan. perhatian lebih kepada kasus daripada sampel. menumbuhkan praktik. Validasi hipotesis 31 Penelitian Tindakan Kelas SMK . apa penyebabnya atau ternyata sudah terjadi seperti yang diharapkan. maka perlu dilakukan validasi. dengan memutar kembali hasil rekaman proses pembelajaran dengan video tape recorder guru mengamati kegiatan mengajarnya dan membahas masalah-masalah yang menjadi perhatian penelitian. Hal ini berimplikasi bahwa metodologi yang dipakai lebih dapat diterapkan terhadap pemahaman situasi problematik daripada atas dasar prediksi di dalam parameter. Validasi ini dimaksudkan untuk menguji atau memberikan bukti secara empirik apakah pernyataan keyakinan yang dirumuskan dalam bentuk hipotesis tindakan itu benar. Analisis dilakukan dengan menggunakan hasil pengumpulan informasi yang telah dilakukan dalam tahap pengumpulan data. atau jika memang perlu uji statistik). c.4. Prosedur Analisis dan Interpretasi Data Penelitian Dalam PTK. apa yang kemudian terjadi. triangulasi. atau pendapat guru. Misalnya. validasi hipotesis dengan menggunakan teknik yang sesuai (saturasi. 1).

Berikutnya berdasarkan temuan data dilakukan refleksi hasil tindakan siklus 1 yang dijadikan dasar untuk merencanakan tindakan untuk siklus ke 2. recek. jadi data atau informasi yang telah diperoleh divalidasi dengan melakukan cek. Triangulasi. Paparan data itu kemudian diringkas dalam bentuk temuan penelitian yang berisi pokok-pokok hasil observasi dan evaluasi yang disarikan dari paparan data. praktik.tindakan dengan menggunakan tehnik yang sesuai yaitu: saturasi. mempertentangkan persepsi seseorang pelaku dalam situasi tertentu dengan aktor-aktor lain dalam situasi itu. Penyusunan Laporan Penelitian Di Bab Hasil dan Pembahasan Penelitian dalam Laporan PTK pada umumnya peneliti terlebih dulu menyajikan paparan data yang mendeskripsikan secara ringkas apa saja yang dilakukan peneliti sejak pengamatan awal (sebelum penelitian) yaitu kondisi awal guru dan siswa diikuti refleksi awal yang merupakan dasar perencanaan tindakan siklus I. dan nilai yang telah diterima oleh guru dan siswa yang dikenai tindakan. dan cek silang dengan pihak terkait untuk memperoleh kesimpulan yang objektif. Interpretasi Data Penelitian Interpretasi berarti mengartikan hasil penelitian berdasarkan pemahaman yang dimiliki peneliti. 5. norma. atau penilaian dan pendapat guru. apakah tidak ditemukan lagi data tambahan. hasil observasi kegiatan guru. Hal ini dilakukan dengan acuan teori. dilanjutkan dengan paparan mengenai pelaksanaan tindakan. dibandingkan dengan pengalaman. Di sini dapat dibandingkan hasil siklus 1 dengan indikator 32 Penelitian Tindakan Kelas SMK . Saturasi. 3). triangulasi dan jika perlu dengan uji statistik tetapi bukan generalisasi atas hasil PTK. observasi situasi dan kondisi kelas dan hasil observasi kegiatan siswa. Hipotesis tindakan yang telah divalidasi dicocokkan dengan mengacu pada kriteria.

Masalah penelitian yang diusahakan oelh guru seharusnya merupakan masalah yang cukup merisaukannya. serta memper oleh data yang dapat digunakan untuk « menjawab » hipotesis yang dikemukakannya. Jadi prosedur analisis dan interpretasi data penelitian dilaksanakan secara deskriptif kualitatif dengan meringkas data (reduksi data). seyogyanya tidak berdampak mengganggu komitmennya sebagai pengajar. Pekerjaan utama guru adalah mengajar. 6. saturasi dan triangulasi. Prinsip-Prinsip PTK Menurut Hopkins (1993) ada 5 prinsip yang menjadi ciri penelitian tindakan kelas. Paling terbuka untuk diperdebatkan metodologi yang digunakan harus cukup reliabel sehingga memungkinkan guru mengidentifikasi serta merumuskan hipotesis secara cukup meyakinkan. sejauh mungkin harus digunakan prosedur pengupulan data yang dapat ditangani sendiri oleh guru sementara ia tetap aktif berfungsi sebagai guru yang bertugas secara penuh. pelaksanaan. mengembangkan strategi yang dapat diterapkan pada situasi kelasnya. 2). dan bertolak dari tanggung jawab 33 Penelitian Tindakan Kelas SMK . Peneliti dapat membandingkan hasil siklus 2 ini dengan indikator keberhasilan tindakan siklus 2 yang telah ditetapkan berdasarkan hasil refleksi tindakan siklus ke 1. yaitu 1). Ringkasan paparan data dicantumkan dalam bentuk temuan penelitian. observasi dan evaluasi.keberhasilan tindakan siklus 1 yang telah ditetapkan berdasarkan refleksi awal. 4). dan apapun metode PTK yang kebetulan diterapkannya. 3). Paparan data siklus dua juga lengkap mulai perencanaan. Dengan kata lain. termasuk apakah perlu dilanjutkan dengan pelaksanaan tindakan untuk siklus ke 3. Temuan ini menjadi dasar refleksi tindakan siklus ke 2. Metode pengumpulan data yang digunakan tidak menuntut waktu yang berlebihan dari guru sehingga berpeluang mengganggu proses pembelajar-an.

tempat penelitian. misalnya pengembangan media. lama waktu penelitian dan biaya yang dibutuhkan dan sumber pendanaannya yang disyahkan dan disetujui oleh Pimpinan (Kepala Sekolah dan Kepala Dinas) sesuai dengan aturan yang berlaku. Garis-Garis Besar Struktur Proposal PTK Proposal dapat dibuat mulai dari lembaran sampul. Judul Penelitian Judul penelitian hendaknya singkat. Identitas peneliti dan anggota peneliti ( jika ada). materi. jadual kegiatan.profesionalnya. Bidang Kajian Tuliskan bidang kajian yang diteliti. tetapi jelas yang dapat menggambarkan masalah yang akan diteliti. riwayat hidup peneliti. lembaran informasi. dsb. Bidang Kajian. serta tindakan yang akan dilakukan dalam upaya mengatasi masalah dan nilai manfaat. Halaman Pengesahan Bagian ini berisi tentang Judul. (d). Dalam menyelenggarakan PTK. spesifik. Gambarkan dengan jelas bila penelitian tersebut adalah bersifat kolaborasi. 34 Penelitian Tindakan Kelas SMK . (c). Latar Belakang Sampaikan dengan jelas masalah nyata yang terjadi di kelas dan diagnosis dengan cermat oleh guru kelas.Pada lembaran sampul dan informasi menyesuaikan aturan yang berlaku di Dinas Pendidikan setempat. (b). 7. biaya. Pada materi proposal penelitian antara lain berisi : (a). guru sendiri memiliki komitmen terhadap pengatasannya. inovasi isi kurikulum. guru harus selalu bersikap konsisten menaruh kepedulian tinggi terhadap prosedur etika yang berkaitan dengan pekerjaannya. metode mengajar. 5). Masalah yang diteliti atas dasar pengamatan guru yang mendesak untuk segera dipecahkan .

(h). jurnal yang relevan untuk dijadikan pijakan yang mampu menunjukkan ketetapatan tentang tindakan yang akan (j). (f).(e). Tujuan Penelitian Kemukakan dengan singkat engenai tujuan penelitian yang peneliti ingin capai dengan berdasar pada permasalahan yang dihadapi guru. Tunjukkan pula hasil-hasil penelitian lain yang berkaitan. (g). Manfaat Penelitian Uraikan manfaat penelitisn dengan menampakkan potensi penelitian Itu guna perbaikan proses pembelajaran di kelas. Kajian Teori (Kepustakaan) Uraikan dengan jelas teori dan kajian buku-buku pustaka yang menumbuhkan gagasan yang melandasi penelitian yang diajukan. Pemecahan Masalah Uraikan pendekatan konsep yang akan digunakan di dalam memecahkan masalah yang diteliti sesuai kaidah penelitian tindakan kelas. (k). Hipotesis Nyatakan bunyi hipotesis kerja yang dijadikan pijakan di dalam melaksanakan kegiatan penelitian. Hipotesis merupakan dugaan sementara si peneliti akan temuan yang dihasilkan dari penelitian yang akan dilakukan. Metode Penelitian Bagian ini sangat berkaitan dengan hal-hal sebagai berikut : 1) tempat penelitian 2) lama waktu penelitian 3) teknik penentuan subyek penelitian 4) model dan jenis peneltiian 5) teknik dan alat pengambil data 6) teknik analisis yang akan digunakan 35 Penelitian Tindakan Kelas SMK . Rumusan Masalah Rumusan masalah sebaiknya berbentuk kalimat bertanya atau yang mempertanyakan. (i).

data mentah. 36 Penelitian Tindakan Kelas SMK . argumentasi dan saran untuk penyempurnaan tema. Saran hendaknya dinyatakan saran-saran dalam kalimat yang operasional. Peserta yang lain memberikan tanggapan. Latihan 1.(l). (m). Peserta dibagi menjadi kelompok–kelompok kecil untuk mendiskusikan masalah-masalah yang ditemukan di kelas masing-masing 2. instrumen dsb. Tiap-tiap peserta ditugaskan maju di depan kelas untuk memaparkan salah satu hasil dari identifikasi masalah yang akan dijadikan tema PTK 3. Simpulan dan Saran 1) Simpulan Uraikan hasil penelitian yang ditemukan dan simpulan mengarah pada upaya untuk menjawab tujuan penelitian yang telah dikemukakan. Lampiran dapat berupa daftar gambar. Daftar Pustaka Bagian ini memuat sumber acuan dalam kajian teori yang digunakan pada setiap bagian laporan dengan menggunakan sistem penulisan yang runtut dapat dengan menggunakan aturan-aturan tata tulis ilmiah yang ada Daftar Pustaka di susun berdasarkan urutan abjad mulai dari « a » sampai « z » (n). 4. C. Lampiran. 2) Saran Saran yang diberikan pada laporan penelitian berdasar pada temuan penelitian yang dianggap masih perlu dilakukan penelitian lebih lanjut. Setiap peserta diberi tugas menyusun rancangan proposal PTK yang akan dilaksanakan di sekolah masing-masing kelak.

Tahapan penelitian dimulai dari perencanaan. Refleksi merupakan pemaknaan dari hasil tindakan yang dilakukan dalam rangka memecahkan masalah. Dalam penyusunan usulan yang sesungguhnya guru peneliti harus berusaha memenuhi ketentuan. Rangkuman PTK merupakan salah satu upaya untuk meningkatkan kualitas pembelajaran dan keprofesionalan guru maupun dosen. Mentabulasikan seluruh masalah yang telah diidentifikasi 3. guru dan dosen dapat saling berkolaborasi. setiap peserta ditugaskan untuk : 1. Penelitian tindakan sebenarnya dapat dilakukan oleh guru atau dosen sendiri-sendiri atau seperti dalam pelatihan ini. Saran 37 Penelitian Tindakan Kelas SMK . kriteria atau standar yang ditetapkan oleh sponsor atau lembaga pemberi dana. Setiap peserta ditugaskan mengumpulkan hasil satu buah rancangan proposal PTK! E. Dalam pelaksanaannya dosen dan guru perlu melakukan segala langkah penelitian ini secara bersama-sama (kolaboratif) dari awal hingga akhir. pelaksanaan tindakan dan evaluasi refleksi yang dapat diulang sebagai siklus. Menyusun calon proposal PTK berdasarkan tema yang telah ditetapkan 5. Disarankan guru dan dosen dapat secara kolaboratif melakukan tindakan kelas ini untuk peningkatan keprofesionalannya. Proposal usulan penelitian tindakan kelas perlu dibuat sebagai pedoman (tuntunan) dalam melaksanakan penelitian. Lembar Kerja Peserta Guna dapat memahami dan mengaplikasikan isi dari kajian materi ini.D. melakukan penelahaan lebih mendalam dengan cara diskusi dan meringkas point-point penting tentang langkah-langkah dalam menyusun proposal penelitian tindakan kelas 2. Ciri khas penelitian ini ialah adanya masalah pembelajaran dan tindakan untuk memecahkan masalah ini. Mendiskusikan masalah-masalah yang ditemukan dengan anggota kelompok dan memilih satu di antara tema yang ada untuk diangkat sebagai tema PTK 4.

pengalaman. Sebutkan garis besar struktur dari sebuah proposal PTK ! 5. artikel dan sumber-sumber mengenai penelitian tindakan kelas.lainnya ialah banyak membaca laporan penelitian. Melalui pertemuan ilmiah dan majalah ilmiah itu antara para guru bidang studi diharapkan dapat terjadi saling tukar informasi. F. berikan alasan anda ! 3. Keinginan lainnya adalah agar dalam pelaksanaan PTK itu guru tidak hanya sekedar melaksanakan. Akhir kata. dan mampu untuk membelajarkan dirinya sepanjang hayat agar dapat lebih mampu membelajarkan anak didiknya. dan pemikiran untuk peningkatan keprofesionalan guru. saya ingatkan kembali bahwa profesi guru adalah profesi yang memerlukan pengembangan terus-menerus. Sebutkan langkah-langkah pokok dalam menentukan sebuah tema PTK ! 2. Saya pikir kita juga sudah punya organisasi profesi sehingga pertemuan periodik antar guru untuk pengembangan profesi dapat direncanakan dan dilaksanakan secara lebih terjadwal. PTK merupakan salah satu sarana belajar sepanjang hayat yang penting yang perlu dikuasai oleh setiap guru yang mau mengembangkan keprofesionalannya. Apakah semua masalah dalam pembelajaran dapat diteliti dengan dengan PTK. karenanya setiap guru harus selalu siap. Kenapa PTK senantiasa diharuskan bersumber dari guru kelas ? 4. Pertimbangan-pertimbangan apa saja yang harus diperhitungkan dalam PTK? 38 Penelitian Tindakan Kelas SMK . Di hadapan para bapak-ibu guru yang hadir dalam pelatihan kali ini saya sampaikan harapan masa depan saya mengenai PTK ini yaitu agar makin banyak guru yang melaksanakan PTK. Tes Formatif 1. mau. tapi juga mengkomunikasikan hasilnya kepada rekan-rekan guru lain melalui media komunikasi (majalah) yang sudah ada sekarang.

(1987). Makalah Seminar Nasional.E. V. Dikmenum. Ernie. (1994). Laporan Penelitian BBI. Bahan Pelatihan Dosen LPTK dan Guru Sekolah Menengah. Bahan Pelatihan Penelitian Tindakan. Wardiman. 1999. Jakarta: Depdikbud. Forum Komunikasi FPK se Indonesia. Stringer. (1993). (1998). R. A. Dikti. Connecticut: The Dushkin Publishing Group. “Konsep Pelaksanaan Sistem Magang pada Sekolah Menengah Kejuruan”. I Made. “Mekanisme Pelaksanaan Sistem Pemagangan dan Pendidikan Kejuruan”. Kebijakan dan Program Pengembangan Pendidikan kejuruan di Indonesia. 1999. 126-131. Dikti. Tim PGSM. (1993). K. Action Research: A Guide for the Teacher Researcher New Jersey: Prentice Hall. Sudana. Action Research in Education. D.(2007). Depdikbud. Columbus: Pearson. Reed. VV (1992). 2004. Makalah Seminar Nasional Sistem Pemagangan dalam Pendidikan Kejuruan dan Penyiapan Tenaga Kerja. Jakarta: DP3M. Designing Interface Teaching Learning for Technical Education. Penelitian Tindakan Kelas. S. & Bergermann. 2003. Jurnal Ekonomi Pembangunan UNM. 18 Desember di Surabaya Suwarni. S. Developing Instructional Instruction.DAFTAR PUSTAKA Bhattacharya. Malang.M. Jakarta: Proyek PGSM. E.. 18 Desember di Surabaya. A Guide to Observation and Participation: In the Classroom. 18 Desember di Surabaya.F & Beach. Herawati Susilo dan Kisyani Laksono. Sulaiman. B. Tangal 28 Nopember Sistem Pemagangan dalam Penididikan Kejuruan dan Penyiapan Tenaga Kerja. 8 (2). California: David’s lake Publishers. Inc. 1992. Mills. Menvi Prentice Hall. Geoffrey. Mager. Penelitian Tindakan Kelas.K & Mandke. Dirjen Dikdasmen. J. 39 Penelitian Tindakan Kelas SMK . Mekanisme Kerjasama SMK dan Dunia kerja/Industri di Jawa Tengah dalam menghasilkan sinkronisasi Kurikulum dan GBPP alternative. The International Journal of Engineering education. Makalah Seminar Nasional Sistem Pemagangan dalam Pendidikan Kejuruan dan Penyiapan Tenaga Kerja. Depdikbud.

Teknik Analisis Data E. Tujuan Penelitian 5. Judul Penelitian B. STRUKTUR PROPOSAL Halaman Judul Halaman Pengesahan A. Pendahuluan 1. Latar Belakang 2. Manfaat Penelitian C. Variabel Penelitian 4. Lampiran 40 Penelitian Tindakan Kelas SMK . Teknik Pengumpulan Data 5. Pendekatan Penelitian 3. Simpulan dan Saran F. Daftar Pustaka G. Permasalahan Penelitian 3. Tempat dan Waktu Penelitian 2.Lampiran 1. Rumusan Masalah 4. Metode Penelitian 1. Kajian Pustaka D.

Sekolah 3. : :. Ketua Peneliti a. Lama Pelatihan : 7. Jabatan Fungsional e. Jabatan Struktural f. :. Jumlah Anggota Panitia Nama Anggota 4. Ketua. 20. Nama Lengkap dan Gelar b. :. ( ) ( ) 41 Penelitian Tindakan Kelas SMK . : :. Kerjasama dengan Institusi lain: a. Alamat : c... Biaya yang diperlukan : Rp. Telp. a. Kategori : 2. Mengetahui: Kepala Dinas Pendidikan ………. Golongan/Pangkat/NIP d. Jenis Kelamin c. Lokasi Pelatihan :.( ……………………………) Semarang. Fax / e-mail : 6. :.. Bidang Ilmu : : c. Nama Instansi : b. Judul b. : 5.Lampiran 2 Contoh Halaman Pengesahan HALAMAN PENGESAHAN PROPOSAL PENELITIAN TINDAKAN KELAS 1.

Lampiran 3 Contoh Sampul Laporan Hasil Penelitian

LAPORAN HASIL PENELITIAN TINDAKAN KELAS

JUDUL PENELITIAN

OLEH ......................................................

DIREKTORAT JENDRAL Peningkatan Mutu Tenaga Pendidik dan Tenaga Kependidikan DEPARTEMEN PENDIDIKAN NASIONAL

(NAMA SEKOLAH) Kabupaten/Kota . ................................... Propinsi .................................................. Tahun

42 Penelitian Tindakan Kelas SMK

Lampiran 4. PENYUSUNAN LAPORAN PENELITIAN

Bagian awal berisi: Halaman Judul Halaman Persetujuan Sari Kata Pengantar Daftar Isi Daftar Tabel Daftar Gambar Daftar Lampiran Bagian Isi BAB I : PENDAHULUAN A. Latar Belakang Penelitian B. Rumusan Masalah C. Tujuan Penelitian D. Manfaat Penelitian BAB II : KAJIAN PUSTAKA Bab III : METODE PENELITIAN 1. Tempat dan Waktu Penelitian 2. Pendekatan Penelitian 3. Variabel Penelitian 4. Teknik Pengumpulan Data 5. Teknik Analisis Data BAB IV BAB V : HASIL DAN PEMBAHASAN : SIMPULAN DAN SARAN A. Simpulan B. Saran C. Kelemahan Penelitian LAMPIRAN 43 Penelitian Tindakan Kelas SMK

BUKU AJAR

PENGEMBANGAN PROFESIONALITAS GURU

Penulisan Karya Ilmiah

9-3

BAB I. PENDAHULUAN A. Deskripsi
Buku Ajar mengenai “Penulisan Karya Tulis Ilmiah” ini meliputi materi pembelajaran tentang penulisan artikel ilmiah, jenis dan struktur artikel ilmiah, artikel hasil pemikiran, artikel hasil penelitian, format tulisan, serta praktik penulisan artikel ilmiah. Secara garis besar, buku ajar ini mengantarkan peserta PLPG untuk memahami materi-materi tersebut di atas, namun demikian peserta juga diminta untuk menyusun draft penulisan artikel ilmiah di bidang kompetensi masingmasing. Hal ini mempunyai tujuan agar setelah pelaksanaan matapelajaran ini peserta PLPG mempunyai kemampuan dalam menyusun artikel ilmiah yang siap dimasukkan ke dalam jurnal ilmiah yang tidak maupun terakreditasi. Buku ajar “Penulisan Karya Tulis Ilmiah” ini mempunyai standar kompetensi dasar (1) mengenal penulisan artikel ilmiah; (2) mengenal perbedaan penulisan artikel ilmiah yang konseptual dan yang non konseptual; (3) mengenal format penulisan artikel ilmiah; dan (4) menyusun draft artikel ilmiah. Buku ajar ini mempunyai hubungan dengan buku ajar yang terutama adalah penelitian tindakan kelas. Karena standar kompetensi penelitian tindakan kelas adalah (1) mengenal metode penelitian tindakan kelas; (2) mengenal format laporan penelitian tindakan kelas, (3) menyusun draft proposal penelitian tindakan kelas. Jelas bahwa kompetensi dasar kedua mata pelajaran ini akan bersngkut paut, pada saat peserta PLPG berkeinginan untuk menuliskan hasil penelitian tindakan kelas ke dalam jurnal penelitian pendidikan.

9-4 Penulisan Karya Ilmiah

B. Petunjuk Pembelajaran
Peserta PLPG harus selalu aktif mengikuti proses pembelajaran di kelas. Peserta PLPG aktif berdiskusi dengan pelatih, menanyakan hal-hal yang belum dipahami, selanjutnya mendiskusikan dengan teman lainnya. Di samping itu, peserta pelatihan mencermati contoh-contoh yang telah disajikan oleh pelatih dan yang tersaji di dalam buku ajar ini. Kemudian peserta PLPG harus belajar menyusun suatu draft artikel ilmiah yang selaras dengan format yang tersaji di dalam buku ajar ini. Hasil draft itu selanjutnya digunakan untuk memenuhi tugas mata pelajaran ini, serta dimintakan pendapat dari pelatih. Saran-saran dari pelatih yang belum dipahami perlu

ditanyakan kembali kepada pelatih jika perlu meminta perbandingan dengan artikel yang telah termuat di dalam jurnal.

C. Kompetensi dan Indikator
1. Peserta mempunyai kemampuan dalam memahami kriteria penulisan artikel ilmiah; 2. Peserta mempunyai kemampuan dalam memahami jenis dan struktur artikel ilmiah; 3. Peserta mempunyai kemampuan dalam memahami artikel

penulisan hasil pemikiran konseptual; 4. .Peserta mempunyai kemampuan dalam memahami artikel

penulisan hasil penelitian; 5. Peserta mempunyai kemampuan dalam memahami format

penulisan enumeratif; 6. Peserta mempunyai kemampuan dalam memahami format

penulisan esai; 7. Peserta mempunyai kemampuan dan keterampilan dalam

menyusun draft artikel ilmiah.

BAB II. KEGIATAN BELAJAR I JENIS DAN STRUKTUR ARTIKEL ILMIAH
A. KOMPETENSI DAN INDIKATOR Karya ilmiah tentu sudah merupakan bacaan yang sangat akrab dengan peserta PLPG. Sebagai guru, bapak dan ibu sudah sering membaca berbagai artikel, baik yang bersifat populer, ilmiah populer maupun yang memang benar-benar merupakan karya ilmiah. Berbekal pengalaman bapak dan ibu dalam memahami artikel ilmiah, bapak dan ibu akan mengkaji bentuk, sifat dan struktur karya tulis ilmiah. Berkaitan uraian di atas, maka setelah menyelesaikan kegiatan berlajar pertama ini, bapak dan ibu diharapkan mempunyai

kemampuan dalam: 1. Menjelaskan sifat artikel ilmiah; 2. Menjelaskan sikap ilmiah; 3. Menjelaskan bentuk, struktur dan sifat-sifat artikel ilmiah 4. Menjelaskan perbedaan artikel hasil pemikian konseptual dengan hasil penelitian

B. URAIAN MATERI Sesuai dengan namanya, artikel ilmiah yang dimuat dalam jurnal diharapkan memenuhi kriteria sebagai sebuah karya ilmiah. Kriteria ini adalah cerminan sifat karya ilmiah yang berupa norma dan nilai yang berakar pada tradisi ilmiah yang diterima secara luas dan diikuti secara sungguh-sungguh oleh para ilmuwan. Oleh karena itu, penerbitan ilmiah secara inherent harus menampilkan sifat-sifat dan ciri-ciri khas karya ilmiah tersebut yang mungkin tidak selalu harus dipenuhi di dalam jenis penerbitan yang lain. Pertama, penerbitan ilmiah bersifat objektif, artinya isi penerbitan ilmiah hanya dapat dikembangkan dari fenomena yang memang exist, walaupun kriteria

9-2 Penulisan Karya Ilmiah

eksistensi fenomena yang menjadi fokus bahasannya dapat berbeda antara satu bidang ilmu dengan bidang ilmu yang lain. Selain objektif, sifat lain karya ilmiah adalah rasional. Rasional menurut Karl Popper adalah tradisi berpikir kritis para ilmuwan. Oleh karena itu, penerbitan ilmiah juga membawa ciri khas ini yang sekaligus berfungsi sebagai wahana penyampaian kritik timbal-balik yang berkaitan dengan masalah yang dipersoalkan. Lain daripada itu, karena jurnal merupakan sarana komunikasi yang berada di garis depan dalam pengembangan IPTEKS, ia juga mengemban sifat pembaharu dan up-to-date atau tidak ketinggalan jaman. Selanjutnya, dalam menulis artikel ilmiah penulis hendaknya juga tidak mengabaikan komponen sikap ilmiah yang lain seperti menahan diri (reserved), hati-hati dan tidak over-claiming, jujur, lugas, dan tidak menyertakan motif-motif pribadi atau kepentingan-

kepantingan tertentu dalam menyampaikan pendapatnya. Semua sikap di atas, dilengkapi dengan keterbukaan dalam menyebutkan sumber bahan yang menjadi rujukannya, juga dipandang sebagai upaya penulis untuk memenuhi etika penulisan ilmiah. Artikel ilmiah mempunyai bentuk, struktur, dan sifat-sifat tertentu. Oleh karena itu, penulisannya harus mengikuti pola, teknik, dan kaidah-kaidah tertentu juga. Pola dan teknik penulisan artikel ilmiah ini relatif konsisten diikuti oleh penerbitan ilmiah pada umumnya yang biasa dikenal sebagai jurnal atau majalah ilmiah. Walaupun demikian, setiap majalah ilmiah biasanya memiliki gaya selingkung yang berusaha dipertahankan konsistensinya sebagai penciri dan kriteria kualitas teknik dan penampilan majalah yang bersangkutan. Gaya selingkung itu secara rinci mungkin berbeda antara satu majalah ilmiah dan majalah ilmiah yang lain, tetapi biasanya semuanya masih mengikuti semua pedoman yang berlaku secara umum. Sementara itu kaidah-kaidah penulisan artikel ilmiah diharapkan diikuti oleh para penulis artikel sebagaimana sikap ilmiah diharapkan diikuti oleh para

Penulisan Karya Ilmiah

9-3

ilmuwan atau kode etik profesi oleh para profesional dalam bidangnya masing-masing. Dalam perspektif tertentu pemenuhan kaidah-kaidah penulisan artikel ilmiah ini dapat dipandang sebagai etika yang harus dipenuhi oleh para penulis artikel. Sesuai dengan tujuan penerbitannya, majalah ilmiah pada umumnya memuat salah satu dari hal-hal berikut: (1) kumpulan atau akumulasi pengetahuan baru, (2) pengamatan empirik, dan (3) gagasan atau usulan baru (Pringgoadisurjo, 1993). Dalam praktik halhal tersebut akan diwujudkan atau dimuat di dalam salah satu dari dua bentuk artikel, yaitu artikel hasil pemikiran atau artikel non penelitian dan artikel hasil penelitian. Ada beberapa jurnal yang hanya memuat artikel hasil penelitian, misalnya Journal of Research in Science Teaching yang terbit di Amerika Serikat dan Jurnal Penelitian Kependidikan terbitan Lembaga Penelitian Unversitas Negeri Malang. Akan tetapi sebagian jurnal biasanya memuat kedua jenis artikel: hasil pemikiran dan hasil penelitian. Selain itu, seringkali majalah ilmiah juga memuat resensi buku dan obituari. Pemuatan artikel hasil penelitian, artikel hasi pemikiran, resensi dan obituari ini sejalan dengan rekomendasi Direktorat Pembinaan Penelitian dan Pengabdian

Kepada Masyarakat, Direktorat Jendral Pendidikan Tinggi (2000). Di dalam tulisan ini pembahasan akan dibatasi pada struktur dan anatomi dua jenis artikel saja yaitu artikel hasil pemikiran dan artikel hasil penelitian.

C. LEMBAR KEGIATAN 1. Alat dan Bahan a. Alat tulis; b. Laptop c. LCD proyektor; d. Buku teks tentang teknik menulis karya ilmiah.

9-4 Penulisan Karya Ilmiah

2. Langkah Kegiatan No. 1. Persiapan Sebelum pembelajaran dimulai, Fasilitator perlu melakukan persiapan yaitu mempersiapkan semua peralatan dan bahan yang diperlukan dalam pembelajaran 5 menit Mempersiapkan alat dan bahan Kegiatan Waktu Metode

2.

Kegiatan Awal/Pendahuluan 2.1 Berdoa bersama untuk mengawali pembelajaran; 2.2 Presensi peserta pelatihan, jika ada yang tidak masuk karena sakit misalnya, maka peserta diajak berdoa kembali agar teman yang sakit dapat segera sembuh dan berkumpul untuk bersekolah kembali; 2.3 Fasilitator menyampaikan tujuan pembelajaran yang akan dikembangkan; 2.4 Selanjutnya fasilitator menyajikan bentuk, struktur dan sifat karya tulis ilmiah. 5 menit Curah pendapat, ceramah pemecahan masalah

3.

Kegiatan Inti 3.1 Fasilitator memberikan ceramah tentang pengertian sifat artikel ilmiah; 35 menit Metode pemberian tugas dan

Penulisan Karya Ilmiah

9-5

3.2 Fasilitator memberikan ceramah tentang sikap ilmiah; 3.3 Fasilitator memberikan ceramah tentang bentuk dan struktur artikel ilmiah 3.4 Fasilitator berdiskusi dengan peserta pelatihan; 3.5 Sharing dalam kelas mengenai sikap ilmiah, sifat, bentuk, dan struktur artikel ilmiah; 3.6 Fasilitator menekankan kembali kesimpulan yang tepat. 4. Kegiatan Akhir 4.1 Fasilitator bersama-sama dengan peserta mengadakan refleksi terhadap proses pembelajaran hari itu, tentang beberapa hal yang perlu mendapat perhatian dari sikap ilmiah, sifat, bentuk, dan struktur artikel ilmiah; 4.2 Fasilitator memberi kesempatan peserta untuk mengungkapkan pengalaman setelah dilakukan sharing; 4.3 Berdoa bersama-sama sebagai menutup pelatihan 10 menit

pendampingan

Refleksi

D. dan kaidah-kaidah tertentu juga. Dalam perspektif tertentu pemenuhan kaidah-kaidah penulisan artikel ilmiah ini dapat dipandang sebagai etika yang harus dipenuhi oleh para penulis artikel. yang selanjutnya mempunyai kecenderungan positif jika dihadapkan pada kasus plagiariasme misalnya. teknik. Peserta PLPG mempunyai kemampuan dalam menjelaskan kembali secara terurai mengenai karakter sikap ilmiah. Peserta PLPG mempunyai kemampuan dalam menjelaskan kembali secara terurai mengenai bentuk. Walaupun demikian. dan sifat-sifat tertentu. Sementara itu kaidah-kaidah penulisan artikel ilmiah diharapkan diikuti oleh para penulis artikel sebagaimana sikap ilmiah diharapkan diikuti oleh para ilmuwan atau kode etik profesi oleh para profesional dalam bidangnya masing-masing. setiap majalah ilmiah biasanya memiliki gaya selingkung yang berusaha dipertahankan konsistensinya sebagai penciri dan kriteria kualitas teknik dan penampilan majalah yang bersangkutan. b. tetapi biasanya semuanya masih mengikuti semua pedoman yang berlaku secara umum. Hasil a. penulisannya harus mengikuti pola. Gaya selingkung itu secara rinci mungkin berbeda antara satu majalah ilmiah dan majalah ilmiah yang lain. struktur. dan struktur karya tulis ilmiah. RANGKUMAN Artikel ilmiah mempunyai bentuk. c. Pola dan teknik penulisan artikel ilmiah ini relatif konsisten diikuti oleh penerbitan ilmiah pada umumnya yang biasa dikenal sebagai jurnal atau majalah ilmiah. Peserta PLPG mempunyai kemampuan dalam menjelaskan kembali secara terurai mengenai sifat artikel ilmiah.9-6 Penulisan Karya Ilmiah 3. Oleh karena itu. .

pemulung d. panjang tulisan c. pendahuluan. fakta atau kenyataan b. kecuali a. Aspek-aspek yang menentukan karakteristik karya tulis. penggunaan bahasa 2.Penulisan Karya Ilmiah 9-7 F. Dalam karya tulis ilmiah. penutup 3. kecuali a. Bagian penutup suatu karya tulis ilmia. simpulan umum c. kecuali a. argumentasi . abstrak. pendidikan b. dari yang paling sederhana sampai dengan yang paling kompleks. inti (pokok pembahasan). abstrak. simpulan dan saran 4. kebudayaan c. Struktur sajian suatu karya tulis ilmiah pada umumnya terdiri dari a. bagian inti. struktur sajian d. simpulan c. simpulan d. bagian inti. dan tidak memihak. Substansi suatu karya tulis ilmiah dapat mencakup berbagai hal. pendahuluan. Tes Obyektif Pilihlah salah satu jawaban yang paling tepat 1. Sikap ini sesuai dengan hakikat karya tulis ilmiah yang merupakan kajian berdasarkan pada. sikap penulis b. bagian inti. Berikut ini adalah contoh-contoh subatansi karya tulis ilmiah. TES FORMATIF 1. obyektif. rekomendasi penulis d. pada umumnya menyajikan tentang a. abstrak. rangkuman dan tindak lanjut b. pendahuluan. informatika 5. penulis bersikap netral. dan penutup b.

pengaruh obat bius yang menghebohkan 10 . yang manakah yang paling sesuai untuk judul karya tulis ilmiah? a. daftar pustaka b. Untuk membedakan karya tulis ilmiah dan karya tulis bukan ilmiah. lampiran 8. baku c. Di antara judul berikut. daftar tabel d. disajikan secara sistematis 9. senjata makan tuan b. data empirik/hasil penelitian 6. personal 7. Salah satu aspek yang dapat digunakan sebagai pembeda adalah a. namun pada umumnya semua karya tulis ilmiah mempunayi komponen a. impersonal d. panjang tulisan . kumbang cantik pengisap madu c. Keobyektifan penulis karya tulis ilmiahdicerminkan dalam gaya bahasa yang bersifat a. Berikut ini adalah ciri-ciri suatu karya tulis ilmiah. memaparkan bidang ilmu tertentu b. seseorang dapat mengkaji berbagai aspek tulisan. merupakan deskripsi suatu kejadian c. menggunakan gaya bahasa resmi d. sistematika tulisan b.9-8 Penulisan Karya Ilmiah c. pengaruh gizi pada pertumbuhan anak d. abstrak c. kecuali a. resmi b. Komponen suatu karya tulis ilmiah bervariasi sesuai dengan jenis karya tulis ilmiah dan tujuan penulisannya. teori yang diakui kebenarannya d.

struktur sajian suatu karya tulis ilmiah terdiri dari bagian awal. coba bapak dan ibu simpulkan bagaimana caranya mengenal karakteristik karya tulis ilmiah. coba simpulkan karakteristik karya tulis ilmiah! 3. Jelaskan mengapa bapak dan ibu menyimpulkan seperti itu? 2. Tes Uraian 1. Berdasarkan uraian itu. pengarang 2. dan bagian penutup. inti. Setelah membaca uraian di atas. Coba jelaskan deskripsi masing-masing bagian dan apa bedanya dengan struktur sajian karya non ilmiah? . ragam bahasa yang digunakan d.Penulisan Karya Ilmiah 9-9 c. Sebutkan aspek-aspek yang dapat menggambarkan karakteristik suatu karya tulis ilmiahdan berikan penjelasan singkat untuk setiap aspek. Secara umum.

6. Pembahasan mengenai materi ini akan bermanfaat pada saat bapak dan ibu menulis artikel konseptual. Menjelaskan penulisan pembahasan karya tulis yang bersifat konseptual maupun atas dasar hasil penelitian 7. KOMPETENSI DAN INDIKATOR Pada kegiatan belajar yang kedua ini akan dibahas bagaimana menentukan kelayakan ide untuk dituangkan ke dalam tulisan serta struktur tulisan konseptual. Menjelaskan pembuatan judul karya tulis yang bersifat konseptual maupun atas dasar hasil penelitian. Menjelaskan penulisan metode karya tulis yang bersifat konseptual maupun atas dasar hasil penelitian.BAB III. maka setelah menyelesaikan kegiatan berlajar kedua ini. bapak dan ibu diharapkan mempunyai kemampuan dalam: 1. Menjelaskan abstrak dan kata kunci karya tulis yang bersifat konseptual maupun atas dasar hasil penelitian. 8. 5. KEGIATAN BELAJAR II ARTIKEL HASIL PEMIKIRAN DAN HASIL PENELITIAN A. Berkaitan uraian di atas. Di samping itu akan dibahas juga teknik menulis karya tulis ilmiah atas dasar hasil penelitian. Menjelaskan penulisan daftar pustaka karya tulis yang bersifat konseptual maupun atas dasar hasil penelitian . Menjelaskan penulisan simpulan dan saran karya tulis yang bersifat konseptual maupun atas dasar hasil penelitian. 2. 3. Menjelaskan penulisan pendahuluan karya tulis yang bersifat konseptual maupun atas dasar hasil penelitian 4. Menjelaskan penulisan hasil penelitian karya tulis yang bersifat konseptual maupun atas dasar hasil penelitian.

pendahuluan. Sumber-sumber yang dianjurkan untuk dirujuk dalam rangka menghasilkan artikel hasil pemikiran adalah juga artikel-artikel hasil pemikiran yang relevan. yaitu judul. dan daftar rujukan. penutup. nama penulis. bagian inti atau pembahasan. dan setelah disusun dalam bentuk judul harus memiliki daya tarik yang kuat bagi calon pembaca. Atikel Hasil Pemikiran Artikel hasil pemikiran adalah hasil pemikiran penulis atas suatu permasalahan. Dalam upaya untuk menghasilkan artikel jenis ini penulis terlebih dahulu mengkaji sumber-sumber yang relevan dengan permasalahannya. a. yang dikembangkan dari analisis terhadap pikiran-pikiran mengenai masalah yang sama yang telah dipublikasikan sebelumnya. Judul dapat ditulis dalam bentuk kalimat berita atau kalimat tanya. tetapi adalah hasil pemikiran analitis dan kritis penulisnya. Artikel hasil pemikiran biasanya terdiri dari beberapa unsur pokok. di samping teori-teori yang dapat digali dari buku-buku teks. jika memang ada. Pilihan kata-kata harus tepat. Uraian singkat tentang unsur-unsur tersebut disampaikan di bawah ini. mengandung unsur-unsur utama masalah. artikel hasil pemikiran bukanlah sekadar kolase atu tempelan cuplikan dari sejumlah artikel. URAIAN MATERI 1. yang dituangkan dalam bentuk tulisan. jelas. Judul Judul artikel hasil pemikiran hendaknya mencerminkan dengan tepat masalah yang dibahas. apalagi pemindahan tulisan dari sejumlah sumber.Penulisan Karya Ilmiah 9-11 B. hasil-hasil penelitian terdahulu. Jadi. dan pikiran baru penulis tentang hal yang dikaji. baik yang sejalan maupun yang bertentangan dengan apa yang dipikirkannya. abstrak dan kata kunci. Bagian paling vital dari artikel hasil pemikiran adalah pendapat atau pendirian penulis tentang hal yang dibahas. Salah satu ciri penting judul artikel hasil pemikiran adalah .

Nama Penulis Untuk menghindari bias terhadap senioritas dan wibawa atau inferioritas penulis. Nama lembaga tempat penulis bekerja sebagai catatan kaki di halaman pertama. dan analitik. No. (dan kawan-kawan). 33. IX No. dalam arti merangsang pembaca untuk membaca artikel yang bersangkutan. b. analisis. Membangun Teori melalui Pendekatan Kualitatif (Forum Penelitian Kependidikan Tahun 7. Jika penulis lebih dari dua orang. nama penulis artikel ditulis tanpa disertai gelar akademik atau gelar profesional yang lain. dan lakukan evaluasi terhadap judul-judul tersebut untuk melihat apakah kriteria yang disebutkan di atas terpenuhi. Jika dikehendaki gelar kebangsawanan atau keagamaan boleh disertakan.2. argumentative. argumentasi.9-12 Penulisan Karya Ilmiah bersifat ”provokatif”. Hal ini penting karena artikel hasil pemkiran pada dasarnya bertujuan untuk membuka wacana diskusi. Nama penulis lain ditulis dalam catatan kaki atau dalam catatan akhir jika tempat pada catatan kaki atau di dalam catatan akhir jika tempat pada catatan kaki tidak mencukupi. Perhatikan judul-judul artikel di bawah ini. hanya nama penulis utama saja yang dicantumkan disertai tambahan dkk.1) Interpreting Student’s and Teacher’s Discourse in Science Classes: An Underestimated Problem? (Journal of Research in Science Teaching Vol. dan sintesis pendapat-pendapat para ahli atau pemerhati bidang tertentu. 1) Repelita IV: A Cautious Development Plan for Steady Growth (Kaleidoscope International Vol. . No.) Di dalam contoh-contoh judul di atas seharusnya tercermin ciriciri yang diharapkan ditunjukan oleh artikel hasil pemikiran seperti provokatif.

bukan komentar atau pengantar penulis. while their tendencies. frequencies. kata-kata kunci hendaknya diambil dari tresaurus bidang ilmu terkait. Perhatikan contoh abstrak dan kata-kata kunci berikut ini. Dengan membaca abstrak diharapkan (calon) pembaca segera memperoleh gambaran umum dari masalah yang dibahas di dalam artikel. Key words: qualitative study. In fact these two approaches serve different purposes. quantitative study. Panjang abstrak biasanya sekitar 50-75 kata yang disusun dalam satu paragraf. Abstrak dan Kata Kunci Abstrak artikel hasil pemikiran adalah ringkasan dari artikel yang dituangkan secara padat. can be investigated through qualitative study. for example. Format lebih sempit dari teks utama (margin kanan dan margin kiri menjorok masuk beberapa ketukan). A qualitative study takes several stage in generating theories. yaitu istilah-istilah yang mewakili ide-ide atau konsep-konsep dasar yang terkait dengan ranah permasalahan yang dibahas dalam artikel. Business transaction pattern and market characteristic. theory development . and other related quantitative values can be more appropriately investigated through quantitative study.Penulisan Karya Ilmiah 9-13 c. Ciri-ciri umum artikel hasil pemikiran seperti kritis dan provokatif hendaknya juga sudah terlihat di dalam abstrak ini. Jika dapat diperoleh. These two approaches are more often inappropriately considered as two different schools of thought than as two different tools. tetapi juga dari tubuh artikel walaupun ide-ide atau konsep-konsep yang diwakili tidak secara eksplisit dinyatakan atau dipaparkan di dalam judul atau tubuh artikel. Abstract: Theory Generation through Qualitative Study. A qualitative study is often contrasted with its quantitative counterpart. sehingga (calon) pembaca tertarik untuk meneruskan pembacaannya. diketik dengan spasi tunggal. Perlu diperhatikan bahwa kata-kata kunci tidak hanya dapat dipetik dari judul artikel. Abstrak hendaknya juga disertai dengan 3-5 kata kunci.

Catatan sejarah pendidikan di negara-negara maju dan dikelompokkelompok masyarakat yang telah berkembang kegiatan pendidikan menunjukan bahwa keadaan dunia pendidikan mereka sekarang ini telah dicapai dengan partisipasi masyarakat yang sangat signifikan di dalam berbagai bentuk.”dst. Sementara itu penulis-penulis lain lebih memfokus pada faktor-faktor ekonomi. Bagian pendahuluan ini hendaknya diakhiri dengan rumusan singkat (1-2 kalimat) tentang hal-hal pokok yang akan dibahas dan tujuan pembahasan. Pendahuluan Bagian ini menguraikan hal-hal yang dapat menarik perhatian pembaca dan memberikan acuan (konteks) bagi permasalahan yang akan dibahas. Partisipasi masyarakat merupakan unsur yang paling penting sekali bagi keberhasilan program pendidikan. misalnya dengan menonjolkan hal-hal yang kontroversial atau belum tuntas dalam pembahasan permasalahan yang terkait dengan artikel-artikel atau naskah-naskah lain yang telah dipublikasikan terdahulu. dengan analisis ini kekurangan analisis terdahulu dapat dikurangi dan dapat disusun penjelasan baru yang lebih komprehensif. Terdapat perbedaan pendapat di kalangan para ahli yang berkaitan dengan menurunnya partisipasi masyarakat dalam pengembangan pendidikan.9-14 Penulisan Karya Ilmiah d... . Perhatikan tiga segmen bagian pendahuluan dalam contoh di bawah ini. Diharapkan.. Dalam artikel-artikel ini akan dibahas kemungkinankemungkinan menurunnya partisipasi masyarakat tersebut berdasarkan analisis ekonomi pendidikan. Dari kajian terhadap berbagai tulisan dan hasil penelitian disebutkan di muka terlihat masih terdapat beberapa hal yang belum jelas benar atau setidak-tidaknya masih menimbulkan keraguan mengenai sebab-sebab menurunnya mutu partisipasi masyarakat dalam pengembangan pendidikan. Sebagian ahli berpendapat bahwa sistem politik yang kurang demokratis dan budaya masyarakat paternalistik telah menyebabkan rendahnya partisipasi. Di Amerika Serikat dalam tingkat pendidikan tinggi dikenal apa yang disebut “Land-Grant Universities..

tergantung kepada kecukupan kebutuhan penulis untuk menyampaikan pikiran-pikirannya. perlu dijaga agar tampilan bagian ini tidak terlalu panjang dan menjadi bersifat enumeratif seperti diktat. Bagian Inti Isi bagian ini sangat bervariasi. sejauh mungkin juga berciri komparatif dan menjauhi sikap tertutup dan instruktif. yang membuka kesempatan bagi penulis untuk menampilkan wacana penurunan partisipasi masyarakat dalam pengembangan pendidikan dari sudut pandang yang lan. analisis. Perhatikan contoh-contoh petikan bagian inti artikel berikut ini. Banyaknya subbagian juga tidak ditentukan. Hence. analitik. dan kritis dengan sistematika yang runtut dan logis. 1996:54). Walaupun demikian. e. dan pendirian atau sikap penulis mengenai masalah yang dibicarakan. Di antara sifat-sifat artikel terpenting yang seharusnya ditampilkan di dalam bagian ini adalah kupasan yang argumentatif. keputusan. lazimnya berisi kupasan. Penggunaan subbagian dan sub-subbagian yang terlalu banyak juga akan menyebabkan artikel tampil seperti diktat. Tinjauan dari berbagai sudut pandang telah menghasilkan kesimpulan yang beragam. komparasi. .Penulisan Karya Ilmiah 9-15 Di dalam petikan bagian pendahuluan di atas dapat dilihat alur argumentasi yang diikuti penulis untuk menunjukan masih adanya perbedaan pandangan tentang menurunnya partisipasi masyarakat di dalam pengembangan pendidikan. argumentasi. Science earns its place on the curriculum because there is cultural commitment to the value of the knowledge and the practices by which this body of ideas has been derived. any consideration of the theoretical implementation must start by attempting to resolve the aims and intentions of this cultural practice…(Dari Osborne.

secara ringkas. in the post modern society simulation structure and control social affairs. where production was the cornerstone. 1997:5) Di dalam contoh-contoh bagian inti artikel hasil pemikiran di atas dapat dilihat dengan jelas bagian yang paling vital dari jenis artikel ini yaitu posisi atau pendirian penulis. but…dan seterusnya. walaupun kesadaran akan perlunya perubahanperubahan tertentu sudah secara luas dirasakan. but because we are constructing truth within a shifting.’ (Dari Ropers-Huilman. 1996:2) John Hassard (1993) suggested that. We. any consideration of the theoretical base of science and its practical implementation must start by…. adalah suatu keharusan jika…. kalangan pendidikan sendiri tidak dengan cepat mengantisipasi. (2) Dalam situasi yang dicontohkan di atas perubahan atau penyesuaian paradigma dan praktek-praktek pendidikan. Banyak juga penulis yang berusaha menampilkan segala apa yang telah dibahas di bagian terdahulu. Sebagian penulis menyertakan saran-saran atau pendirian alternatif. not because we are “falsyfaying” data. ‘Unlike modern industrial society. f. Hesrh dan McKibbin (1983:3) menyatakan bahwa sebenarnya banyak pihak telah menyadari perlunya inovasi…(Dari Ibnu. or ‘lying’ about…. are producing simulation whitin discorses.9-16 Penulisan Karya Ilmiah Dalam situasi yang dicontohkan di atas perubahan atau penyesuaian paradigma dan praktik-praktik pendidikan adalah suatu keharusan jika dunia pendidikan Indonesia tidak ingin tertinggal dan kehilangan perannya sebagai wahana untuk menyiapkan generasi masa datang ironisnya. at witnesses. but always limited discourse. Jika memang dianggap tepat bagian terakhir ini dapat dilihat pada berbagai . (3)…We are fabricating words not because …. mengembangkan dan mengambil inisiatif inovasi yang diperlukan. Penutup atau Simpulan Penutup biasanya diisi dengan simpulan atau penegasan pendirian penulis atas masalah yang dibahas pada bagian sebelumnya. or “lying” about what we have learned. We are fabricating words. seperti terlihat di dalam kalimatkalimat: (1) Hence.

with rhetoric and argument as a central feature. awareness. science and technology have ascended to ascended to a position of cultural dominance. Namun demikian kemampuan politik saja tidak cukup tanpa disertai keberanian politik. for good or for ill. menurut Dr. argumentation has a central role play in science and learning about science. studying the role of . Perhatiakan contoh-contoh berikut. as has been discussed in this article. (b) rasionalitas ekonomi yang diwujudkan dengan perencanaan ekonomi oleh negara. For in the light of our emerging understanding of science as social practice. and competence in managing student participation in discussion and argument. Pada saat ini nampak sudah ada political will dari pemerintah kita terhadap kegiatan ekonomi berskala menengah dan kecil. Given that. yaitu: (a) etika sosial yang tersimpul dalam nilai-nilai Pancasila. to continue with current approaches to the teaching of science would be to misrepresent science and its nature. Hal tersebut terjadi sebagai reaksi atas permasalahan konglomerasi di Indonesia. Walaupun mungkin terdapat beberapa perbedaan gaya penyampaian. sehingga tingkat kesejahteraan seluruh msyarakat dapat ditingkatkan.Penulisan Karya Ilmiah 9-17 artikel jurnal. misi bagian akhir ini pada dasarnya sama: mengakhir diskusi dengan suatu pendirian atau menyodorkan beberapa alternatif penyelesaian. but also improving teachers’ knowledge. then its current omission is a problem that needs to be seriously addressed. M. 1994:330-331) if. dan (c) organisasi ekonomi yang mendasarkan azas bersama/koperasi. then it seems crucial that any intervention should pay attention not only to ways of enhancing the argument skills of young people. (Dari Supriyanto. Hatta dalam konsep Demokrasi Ekonomi berlandaskan pada tiga hal. Perlu diupayakan hubungan kemitraan yang baik antara pelaku ekonomi dalam sistem perekonomian Indonesia. Semangat untuk berpihak pada pengembangan usaha berskala menengah dan kecil perlu terus digalakkan. Isu tentang pelaksanaan Demokrasi Ekonomi dalam sistem perekonomian Indonesia menjadi menarik dan ramai pada era tahun 90-an. Konsep pemikiran tentang Demokrasi Ekonomi pada prinsipnya adalah khas Indonesia. If his pattern is to change.

and the public and its relationship with science. tergantung gaya selingkung yang dianut. Walaupun demikian. laporan penelitian harus disusun kembali agar memenuhi tata tampilan karangan sebagaimana yang dianjurkan oleh dewan penyunting jurnal yang bersangkutan dan tidak melampaui batas panjang karangan. Newton & Osborne. misalnya. termasuk kategori jurnal yang semata-mata memuat hasil penelitian. . Artikel Hasil Penelitian Artikel hasil penelitian sering merupakan bagian yang paling dominan dari sebuah jurnal. Jurnal Penelitian Kependidikan yang diterbitkan oleh Lembaga Penelitian Universitas Negeri Malang. 2000:309) g. Tata aturan penulisan daftar rujukan bervariasi. Jadi. dan Journal of Research in Science Teaching. tetapi merupakan hasil kerja penulisan baru. semua rujukan yang telah disebutkan dalam tubuh artikel harus tercatat di dalam daftar rujukan.9-18 Penulisan Karya Ilmiah argument in science offers a means of prying open the black box that is science. Such an effort would seem well advisedboth for science and its relationship with the public. tetapi dalam format artikel yang jauh lebih kompak dan ringkas daripada laporan teknis aslinya. Daftar Rujukan Bahan rujukan yang dimasukan dalam daftar rujukan hanya yang benar-benar dirujuk di dalam tubuh artikel. harus senantiasa diperhatikan bahwa tata aturan ini secara konsisten diikuti dalam setiap nomor penelitian. (Dari Driver. artikel hasil penelitian bukan sekadar bentuk ringkas atau ”pengkerdilan” dari laporan teknis. Berbagai jurnal bahkan 100% berisi artikel jenis ini. 2. Sebaliknya. yang dipersiapkan dan dilakukan sedemikian rupa sehingga tetap menampilkan secara lengkap semua aspek penting penelitian. Sebelum ditampilkan sebagai artikel dalam jurnal.

1). Undergraduate Science Students’ Images of the Nature of Science (Research presented at the American Educational Research Association Annual Conference.Penulisan Karya Ilmiah 9-19 Bagian-bagian artikel hasil penelitian yang dimuat dalam jurnal adalah judul. metode. Variabel-variabel penelitian dan hubungan antar variabel serta informasi lain yang dianggap penting hendaknya terlihat dalam judul artikel. Issue 1). dan daftar rujukan. Walaupun demikian. harus dijaga agar judul artikel tidak menjadi terlalu panjang. Jika dibandingkan judul-judul di atas. Effect of Knowledge and Persuasion on High-School Students’ Attitudes towards Nuclear Power Plants (Journal of Research in Science Teaching Vol. Sebagaimana judul penelitian. Chicago. 24-28 March 1997). a. pembahasan. Judul Judul artikel hasil penelitian diharapkan dapat dengan tepat memberikan gambaran mengenai penelitian yang telah dilakukan.32. Pengaruh Metode Demonstrasi Ber-OHP terhadap Hasil Belajar Membuat Pakaian Siswa SMKK Negeri Malang (Forum Penelitian Kependidikan Tahun 7. terutama dengan terlihatnya variabel-variabel utama yang diteliti seperti yang diperlihatkan pada judul yang pertama dan ketiga. Berikut adalah beberapa contoh. judul artikel umumnya terdiri dari 5-15 kata. akan sgera tampak perbedaannya dengan judul artikel hasil pemikiran. abstrak dan kata kunci. . No. hasil penelitian. bagian pendahuluan. kesimpulan dan saran. nama penulis.

teaching readiness. metode yang digunakan. Sixty nine point five percent of the teachers got more than 65 arithmetic. Kabupaten Malang were given a test in mathematic which was devided in to two part. Tekanan terutama diberikan kepada hasil penelitian. Nama Penulis Pedoman penulisan nama penulis untuk artikel hasil pemikiran juga berlaku untuk penulisan artikel hasil penelitian.5% gained scores of more than 65 scores in both geometry and arithmetics. and 69. Masalah yang diteliti ini sering tercermin dalam variable-variabel penelitian dan hubungan antara variable-variabel tersebut. Contoh abstrak: Abstract: The aim of this study was to asses the readiness of elementary school teachers in mathematic teaching. Those who obtained scores of less than 65 were classified as not in adequate readiness in teaching. The result of the study indicated that 78. c. Panjang abstrak lebih kurang sama dengan panjang artikel hasil pemikiran dan juga dilengkapi dengan kata-kata kunci (3-5 buah). dan hasil penelitian. tidak ada keharusan kata-kata kunci diambil dari variabelvariabel penelitian atau dari kata-kata yang tercantum di dalam judul artikel.8% of the teachers obtained scores of more than 65 in geometry. Walaupun demikian. . arithmatics and geometry. A minimum mastery score of 65 was set for those who would be classified as in adequate readiness as mathematics teachers. from the point of view of the teacher mastery of the subject. Key words: mathematic teaching. Abstrak dan Kata Kunci Dalam artikel hasil penelitian abstrak secara ringkas memuat uraian mengenai masalah dan tujuan penelitian. Kata-kata kunci menggambarkan ranah masalah yang diteliti. Forty two elementary school teachers from Kecamatan Jabung.9-20 Penulisan Karya Ilmiah b. subject mastery.

Penyajian bagian pendahuluan dilakukan secara naratif. Subjek penelitian dipilih secara random dari seluruh siswa kelas 3 kemudian . Pemisahan dilakukan dengan penggantian paragraf. Analisis dengan menggunakan pendekatan. Peneliti terjun langsung ke dalam keidupan masyarakat desa. dan tidak perlu pemecahan (fisik) dari satu subbagin ke subbagian lain. ikut serta melakukan berbagai aktivitas sosial sambil mengumpulkan data yang dapat diamati langsung di lapangan atau yang diperoleh dari informan kunci. e.. Kadang-kadang juga dimuat harapan akan hasil dan manfaat penelitian. Materi pokok bagian ini adalah rancangan atau desain penelitian. Pencatatan dilakukan tidak langsung tetapi ditunda sampai peneliti dapat ”mengasingkan diri” dari anggota masyarakat sasaran. Rancangan eksperimen pretest-posttest control group design digunakan dalam penelitian ini. teknik pengumpulan data dan pengembangan instrumen. dan teknik analisis data. Bagian ini terutama berisi paparan tentang permasalaha penelitian. dan rangkuman kajian teoretik yang berkaitan dengan masalah yang diteliti. wawasan. Subsubbagian di atas umumnya (atau sebaiknya) disampaikan dalam format esei dan sesedikit mungkin menggunakan format enumeratif. tujuan penelitian.. Metode Bagian ini menguraikan bagaimana penelitian dilakukan. misalnya: Penelitian ini dilakukan dengan menggunakan pendekatan kualitatif dengan rancangan observasi partisipatori. Pendahuluan Banyak jurnal tidak mencantumkan subjudul untuk pendahuluan. sasaran atau target penelitian (populasi dan sampel).Penulisan Karya Ilmiah 9-21 d. Informasi yang diberikan dari informan kunci diuji dengan membandingkannya dengan pendapat nara sumber yang lain. dan rencana penulis dalam kaitan dengan upaya pemecahan masalah.

Jumlah ranah Lain-lain 3 suku 1994 7 5 2 1995 7 3 12 1996 13 14 1 1997 6 6 5 Jumlah 32 28 20 80 46 . f. Pengujian hipotesis dan penggunaan statistik tidak termasuk yang disajikan. Grafik dan tabel harus dibahas dalam tubuh artikel tetapi tidak dengan cara pembahasan yang rinci satu per satu. Literacy Teori & Pengaj.. Data diambil dengan menggunakan tes yang telah dikembangkan dan divalidasi oleh Lembaga Pengembangan Tes Nasional. Tabel 1 Distribusi Jumlah Tulisan dari Tiga Suku Ranah Pendidikan Sains yang Dimuat dalam Berbagai Jurnal antara Januari 1994-Juli 1997 Suku ranah Konsep Sci. tepatnya hasil analisis data. dalam kurun waktu satu sampai empat tahun dapat dilihat dalam Tabel 1. Hasil yang disajikan adalah hasil bersih. Penyajian hasil yang cukup panjang dapat dibagi dalam beberapa subbagian Contoh: Jumlah tulisan dari tiga suku ranah utama yang dimuat di dalam berbagai jurnal. Hasil Penelitian Bagian ini memuat hasil penelitian. Analisis data dilakukan dengan.9-22 Penulisan Karya Ilmiah secara random pula ditempatkan ke dalam kelompok percobaan dan kelompok control. Penyampaian hasil penelitian dapat dibantu dengan penggunaan tabel dan grafik (atau bentuk/format komunikasi yang lain)..

Simpulan dan Saran Simpulan menyajikan ringkasan dari uraian mengenai hasil penelitian dan pembahasan. Dari kedua hal ini dikembangkan pokokpokok pikiran (baru) yang merupakan esensi dari temuan penelitian. ..Penulisan Karya Ilmiah 9-23 Dari Tabel 1 di atas terlihat bahwa frekuensi pemunculan artikel dari tiga suku ranah tersebut di atas jauh melebihi suku-suku ranah yang lain. g. mengintepretasikan temuan. Hal ini sesuai dengan teori selektive cases dari Lincoln (1987:13) yang menyatakan bahwa. Contoh: Dari temuan penelitian yang diuraikan dalam artikel ini dapat dilihat bahwa berbagai hal yang berkaitan dengan masalah kenakalan remaja yang selama ini diyakini kebenarannya menjadi goyah. pengembangan teori baru. yaitu 80:46. hal ini menunjukan bahwa. mengaitkan temuan penelitian dengan struktur pengetahuan yang telah mapan.dst.. Saran dapat mengacu kepada tindakan praktis. Saran hendaknya dikembangkan berdasarkan temuan penelitian... Penulis artikel dalam bagian ini menjawab pertanyaanpertanyaan penelitian dan menunjukan bagaimana temuan-temuan tersebut diperoleh. h. Pembahasan Bagian ini merupakan bagian terpenting dari artikel hasil penelitian. dan penelitian lanjutan. Gejala-gejala kenakalan remaja tertentu hanya muncul apabila kondisi lingkungan sosial setempat mendukung akan terjadinya bentuk-bentuk kenalan terkait. Kebenaran dari berbagai hal tersebut ternyata tidak berlaku secara universal tetapi kondisional. dan memunculkan ”teori-teori” baru atau modifikasi teori yang telah ada.

Penutup Perbedaan dasar antara artilkel hasil pemikiran dan artikel hasil penelitian terletak pada bahan dasar yang kemudian dikembangkan dan dituangkan ke dalam artikel. Daftar Rujukan Daftar rujukan ditulis dengan menggunakan pedoman umum yang juga berlaku bagi penulis artikel nonpenelitian. Perbedaan isi kedua jenis artikel memerlukan struktur dan sistematika penulisan yang berbeda untuk menjamin kelancaran dan keparipurnaan komunikasi. dikembangkan dari laporan teknis penelitian dengan tujuan utama untuk memperluas penyebarannya dan secara akumulatif dengan hasil penelitian peneliti-peneliti lain dalam memperkaya khasanah pengetahuan tentang masalah yang diteliti. Walaupun demikian. rasional. kaidah-kaidah komunikasi ilmiah yang lain seperti objektif. 3. dapat gaya selingkung masing-masing jurnal terakomodasikan dengan baik di dalam struktur dan sistematika penulisan yang disepakati. up to date. adalah tercapainya maksud penulisan artikel tersebut. dipandang tidak perlu dikembangkan sehingga aturan-aturan yang terlalu mengikat dan baku. dan tidak arogan hendaknya juga diusahakan sekuat tenaga untuk dapat dipenuhi oleh penulis.9-24 Penulisan Karya Ilmiah i. Bahan dasar artikel hasil pemikiran adalah hasil kajian atau analisis penulis atas suatu masalah. Artikel hasil penelitian. dilain pihak. Selain itu. Satu hal yang harus diupayakan oleh penulis. jujur. Bagian terpenting dari artikel jenis ini adalah pendirian penulis tentang masalah yang dibahas dan diharapkan memicu wahana baru mengenai masalah tersebut. yaitu komunikasi yang efektif dan efisien tetapi tetap mempunyai daya tarik yang cukup tinggi. kritis. baik untuk artikel hasil pemikiran ataupun artikel hasil penelitian. .

Persiapan Sebelum pembelajaran dimulai.Penulisan Karya Ilmiah 9-25 C. 2. Fasilitator perlu melakukan persiapan yaitu mempersiapkan semua peralatan dan bahan yang diperlukan dalam pembelajaran 5 menit Mempersiapkan alat dan bahan Waktu Metode 2. Kegiatan 1. Alat dan Bahan a. 2. LCD proyektor. 2. Alat tulis. LEMBAR KEGIATAN 1. jika ada yang tidak masuk karena sakit misalnya. maka peserta diajak berdoa kembali agar teman yang sakit dapat segera sembuh dan berkumpul untuk bersekolah kembali. 5 menit Curah pendapat. d.1 Berdoa bersama untuk mengawali pembelajaran. b. Buku teks tentang teknik menulis karya ilmiah. Langkah Kegiatan No.2 Presensi peserta pelatihan. ceramah pemecahan masalah .3 Fasilitator menyampaikan tujuan pembelajaran yang akan dikembangkan. Kegiatan Awal/Pendahuluan 2. Laptop c.

2 Fasilitator memberikan ceramah tentang penulisan karya tulis ilmiah hasil penelitian. 3.4 Selanjutnya fasilitator menyajikan artikel ilmiah dalam bentuk hasil pemikiran konseptual dan hasil penelitian. 3. 3.5 Sharing dalam kelas mengenai karya tulis ilmiah hasil penelitian 3.1 Fasilitator memberikan ceramah tentang pengertian penulisan karya tulis ilmiah hasil pemikiran konseptual 3.3 Fasilitator berdiskusi dengan peserta pelatihan.6 Fasilitator menekankan kembali kesimpulan yang tepat.9-26 Penulisan Karya Ilmiah 2. 3. Kegiatan Akhir Fasilitator bersama-sama dengan peserta mengadakan refleksi terhadap proses pembelajaran hari itu. Fasilitator memberi kesempatan peserta untuk mengungkapkan 10 menit Refleksi 35 menit Metode pemberian tugas dan pendampingan . tentang beberapa hal yang perlu mendapat perhatian.4 Sharing dalam kelas mengenai karya tulis ilmiah hasil pemikiran konseptual. 4. Kegiatan Inti 3.

D. dilain pihak. Peserta PLPG mempunyai kemampuan dalam menjelaskan kembali secara terurai mengenai penulisan karya tulis ilmiah hasil pemikiran. Hasil a.Penulisan Karya Ilmiah 9-27 pengalaman setelah dilakukan sharing. Bahan dasar artikel hasil pemikiran adalah hasil kajian atau analisis penulis atas suatu masalah. dipandang tidak perlu dikembangkan sehingga aturan-aturan yang terlalu mengikat dan jurnal baku. Berdoa bersama-sama sebagai menutup pelatihan 3. dikembangkan dari laporan teknis penelitian dengan tujuan utama untuk memperluas penyebarannya dan secara akumulatif dengan hasil penelitian peneliti-peneliti lain dalam memperkaya khasanah pengetahuan tentang masalah yang diteliti. Artikel hasil penelitian. Perbedaan isi kedua jenis artikel memerlukan struktur dan sistematika penulisan yang berbeda untuk menjamin kelancaran dan keparipurnaan komunikasi. Peserta PLPG mempunyai kemampuan dalam menjelaskan kembali secara terurai mengenai penulisan karya tulis ilmiah hasil penelitian. Walaupun demikian. RANGKUMAN Perbedaan dasar antara artilkel hasil pemikiran dan artikel hasil penelitian terletak pada bahan dasar yang kemudian dikembangkan dan dituangkan ke dalam artikel. dapat gaya selingkung masing-masing . b. Bagian terpenting dari artikel jenis ini adalah pendirian penulis tentang masalah yang dibahas dan diharapkan memicu wahana baru mengenai masalah tersebut.

judul. abstrak. pendahuluan. persamaan persepsi para ahli di bidang yang sama 3. Artikel dapat dikelompokkan menjadi a. rasional. Dari sudut ide. kesiapan ide untuk didiskusikan d. kelayakan ide untuk dipublikasikan b. up to date. data. dan tidak arogan hendaknya juga diusahakan sekuat tenaga untuk dapat dipenuhi oleh penulis. Tes Obyektif Pilihlah salah satu jawaban yang paling tepat 1. kaidah-kaidah komunikasi ilmiah yang lain seperti objektif. artikel hasil telaahan dan artikel teoritis d. dan referensi b. pembahasan. Tulisan analisis konseptual terdiri dari a. salah satu dari empat faktor yang harus diperhatikan untuk menghasilkan tulisan ilmiah yang berkualitas tinggi adalah a. Satu hal yang harus diupayakan oleh penulis. diskusi. TES FORMATIF 1.9-28 Penulisan Karya Ilmiah terakomodasikan dengan baik di dalam struktur dan sistematika penulisan yang disepakati. yaitu komunikasi yang efektif dan efisien tetapi tetap mempunyai daya tarik yang cukup tinggi. artikel laporan dan artikel rujukan b. artikel hasil laporan dan artikel hasil telaahan 2. artikel konseptual dan artikel teoritis c. judul pendahuluan. Selain itu. judul. diskusi. wacana tentang ide yang sedang berkembang c. F. baik untuk artikel hasil pemikiran ataupun artikel hasil penelitian. jujur. abstrak. kesimpulan referensi . adalah tercapainya maksud penulisan artikel tersebut. kritis. referensi c.

Apa kesimpulan yang dapat ditarik? d. abstrak b. memecah satu penelitian menjadi beberapa artikel d. Salah satu dari tiga pertanyaan yang harus dijawab di bagian pendahuluan adalah berikut ini a. melaporkan korelasi yang dibahas dalam penelitian 8. Dalam suatu artikel konseptual. menulis masalah yang sudah pernah dibahas c. diperlukan dalam pengembangan tulisan 6. Referensi memuat semua rujukan yang a. Salah satu hal yang harus dihindari pada saat menulis hasil penelitian adalah a. pendahuluan. pernah dibaca penulis b. mengapa konsep itu dibahas? c. menjelaskan partisipan b. Apa tindak lanjut yang perlu dilakukan? 7. temuan.Penulisan Karya Ilmiah 9-29 d. bagaimana teori/konsep yang ditawarkan dapat berkontribusi dalam peta pengetahuan dimuat pada bagian a. panjang tulisan b. referensi 5. judul. apa inti teori/konsep yang dibahas? b. dimuat dalam badan tulisan d. nada tulisan c. perlu dibaca pembaca c. pendahuluan c. pembahasan. gaya tulisan . diskusi d. referensi 4. Pemilihan penggunaan kata dan kalimat yang tidak provokatif dalam laporan atau artikel merupakan salah satu contoh upaya untuk menjaga kualitasdari aspek a.

metode c. Rekomendasi untuk judul adalah a. Dalam suatu laporan atau artikel hasil penelitian. Sebut dan jelaskan perbedaan karya tulis ilmiah hasil pemikian dan hasil penelitian! 3.9-30 Penulisan Karya Ilmiah d. Tes Uraian 1. 15-30 kata 10. pendahuluan b. bahasa tulisan 9. Carilah salah satu artikel hasil penelitian. diskusi 2. 10-12 kata c. 12-15 kata d. kontribusi penelitian dapat dilihat di bagian a. telaah unsur-unsur yang terdapat pada artikel itu! . Jelaskan mengapa abstrak merupakan bagian terpenting dalam laporan dan artikel penelitian 2. 8-10 kata b. hasil d.

B. mengenal format penulisan enumeratif. Pada kegiatan belajar yang ketiga ini berisi mengenai latihan peserta PLPG dalam menulis karya tulis ilmiah baik yang bersifat hasil pemikiran maupun hasil penelitian. 2. Penggunaan format esai dalam penulisan artikel jurnal bertujuan untuk menjaga kelancaran pembacaan dan menjamin keutuhan ide yang ingin disampaikan. Pada kesempatan ini akan dicontohkan beberapa petunjuk bagi penulis ilmu pendidikan. membuat karya tulis ilmiah baik yang bersifat hasil pemikiran maupun hasil penelitian. Mengenai Format Tulisan Semua bagian artikel yang dibicarakan di atas ditulis dalam format esai. URAIAN MATERI 1. mengenal format penulisan esay. dan secara aktif berdialog dengan penulis. Bandingkan dua format petikan berikut: . indikator kegiatan belajar ketiga ini adalah: 1. 3. KOMPETENSI DAN INDIKATOR Pada kegiatan belajar kedua telah disajikan bagaimana teknik menulis karya tulis ilmiah yang bersifat hasil pemikiran dan hasil penelitian. KEGIATAN BELAJAR III PRAKTIK PENULISAN KARYA TULIS ILMIAH A. Dengan demikian peserta PLPG diharapkan mempunyai keterampilan dalam menyusun karya tulis ilmiah yang dapat dikirimkan kepada pengelola jurnal penelitian pendidikan (JIP).BAB IV. Oleh karena itu. Dengan digunakannya format esai diharapkan pembaca memperoleh kesan seolah-olah berkomunikasi langsung.

Artikel yang dimuat meliputi hasil penelitian dan kajian analitiskritis setara dengan hasil penelitian di bidang filsafat kependidikan. dan seterusnya. terutama apabila penggunaan format enumeratif tersebut benar-benar fungsional dan tidak tepat apabila diganti dengan format esei seperti dalam menyatakan urutan dan jadwal. dan diserahkan dalam bentuk cetakan (print out) komputer sebanyak 2 eksemplar beserta disketnya. teori kependidikan. Format Esei Setiap record ISSN dilaporkan kepada internasional Serial Data System yang berkedudukan di Paris. (3)…. WordPerfect atau MicroSoft Word. Di dalam hal-hal tertentu format enumeratif boleh digunakan. c.. Naskah diketik spasi ganda pada kertas kuarto sepanjang maksimal 20 halaman. dan (c) PDII-LIPI untuk wilayah Indonesia. (2)….9-32 Penulisan Karya Ilmiah Format Enumeratif Sesuai dengan lingkup penyebaran jurnal yang bersangkutan maka record ISSN dilaporkan kepada pihak-pihak berikut: (a) International Serials Data System di Paris untuk jurnal internasional (b) Regional Center for South East Asia bagi wilayah Asia Tenggara. b. Untuk kawasan Asia Tenggara dilaporkan melalui Regional Center for South East Asia dan untuk wilayah Indonesia dilaporkan kepada PDII-LIPI. Jika format esai masih dapat digunakan “penandaan” sejumlah elemen dapat dilakukan dengan format esei bernomor. Artikel ditulis dalam bahasa Indonesia atau Inggris dengan format . 2. seperti (1)…. Petunjuk bagi Penulis Ilmu Pendidikan a. dan praktik kependidikan. Berkas (file) pada naskah pada disket dibuat dengan program olah kata WordStar.

1997. daftar rujukan (berisi pustaka yang dirujuk saja). dan hasil penelitian. Rata dengan Tepi Kiri) Peringkat 3 (Huruf Besar Kecil. Anderson.W. RATA DENGAN TEPI KIRI) Peringkat 2 (Huruf Besar Kecil. & Dickson. Rata dengan tepi Kiri) d. nama penulis (tanpa gelar akademik). e. kecuali bagian pendahuluan yang disajikan tanpa judul bagian. dan Praktik Kependidikan. dan tidak menggunakan angka/nomor bagian. kata-kata kunci. metode.Penulisan Karya Ilmiah 9-33 esai.E. Miring. abstrak (maksimum 100 kata) yang berisi tujuan. Problems and Prospects for the Decades Ahead: Competency based Teacher Education. hlm. . pendahuluan (tanpa sub judul) yang berisi latar belakang dan tujuan atau ruang lingkup tulisan. kata-kata kunci. 1993. metode. 127-137. PERINGKAT 1 (HURUF BESAR SEMUA.D. dan tujuan penelitian. nama penulis (tanpa gelar akademik). Tahun 24. Pandangan Aliran Humanistik tentang Filsafat Pendidikan Orang Dewasa. sedikit tinjauan pustaka. Hanurawan. Sistematika artikel setara hasil penelitian: judul. D. V. Ilmu Pendidikan: Jurnal Filsafat. abstrak (maksimum 100 kata). pembahasan. C. penutup atau kesimpulan. Teori. hasil. f. Peringkat judul bagian dinyatakan dengan jenis huruf yang berbeda (semua judul bagian dicetak tebal atau tebal miring). Nomor 2. F. pendahuluan (tanpa sub judul) yang berisi latar belakang. Sistematika artikel hasil penelitian: judul.. Juli 1997. bahasan utama (dibagi ke dalam subjudul-subjudul). kesimpulan dan saran. daftar rujukan (berisi pustaka yang dirujuk saja). Vault. Berkeley: McCutchan Publishing Co. disertai judul (heading). masing-masing bagian. Daftar Rujukan disusun dengan mengikuti tata cara seperti contoh berikut dan diurutkan secara alfabetis dan kronologis.

Laptop c. Makalah. h. Makalah disajikan dalam Lokakarya Penelitian Tingkat Dasar bagi Dosen PTN dan PTS di malang Angkataan XIV. Penulisan Laporan Penelitian untuk Jurnal. N. Artikel berbahasa Inggris menggunakan ragam baku. Artikel berbahasa Indonesia mengikuti aturan tentang penggunaan tanda baca dan ejaan yang dimuat dalam Pedoman Umum Ejaan bahasa Indonesia yang Disempurnakan (Depdikbud. Kamera digital . Buku teks tentang teknik menulis karya ilmiah e. Artikel yang sudah dalam bentuk cetak-coba tidak dapat ditarik kembali oleh penulis. g. Sebagai imbalannya. Alat dan Bahan a. 200).000. Artikel dan Laporan Penelitian (Universitas Negeri Malang. penulis menerima nomor bukti pemuatan sebanyak 2 (dua) eksemplar dan cetak lepas sebanyak 5 (lima) eksemplar yang akan diberikan jika kontribusi biaya cetak telah dibayar lunas. Malang. tabel. 12 Juli. rujukan. Tata cara penyajian kutipan. d. 1991. b. Alat tulis. C. i. Penulis yang artikelnya dimuat wajib memberi kontribusi biaya cetak minimal sebesar Rp. LCD proyektor.00 (dua ratus ribu rupiah) perjudul. 200. Disertasi.9-34 Penulisan Karya Ilmiah Huda. Pemeriksaan dan penyuntingan cetak-coba dilakukan oleh penyunting dan/atau melibatkan penulis. Pusat Penelitian IKIP MALANG. dan gambar mengikuti ketentuan dalam Pedoman Penulisan Karya Ilmiah: Skripsi. Tesis. LEMBAR KEGIATAN 1. 1987).

ceramah pemecahan masalah 3. Kegiatan 1. Langkah Kegiatan No. Fasilitator perlu melakukan persiapan yaitu mempersiapkan semua peralatan dan bahan yang diperlukan dalam pembelajaran 5 menit Mempersiapkan alat dan bahan Waktu Metode 2.4 Selanjutnya fasilitator menyajikan petunjuk bagi penulis ilmu pendidikan Curah pendapat. Kegiatan Inti Fasilitator memberikan ceramah tentang format penulisan karya tulis ilmiah.1 Berdoa bersama untuk mengawali 5 menit pembelajaran. 2.2 Presensi peserta pelatihan. Persiapan Sebelum pembelajaran dimulai. Kegiatan Awal/Pendahuluan 2. 2.3 Fasilitator menyampaikan tujuan pembelajaran yang akan dikembangkan.Penulisan Karya Ilmiah 9-35 2. maka peserta diajak berdoa kembali agar teman yang sakit dapat segera sembuh dan berkumpul untuk bersekolah kembali. Fasilitator memberikan 130 menit Metode pemberian tugas dan pendampingan . jika ada yang tidak masuk karena sakit misalnya. 2.

Kegiatan Akhir 4. tentang beberapa hal yang perlu mendapat perhatian.9-36 Penulisan Karya Ilmiah ceramah tentang salah satu contoh petunjuk bagi penulis ilmu pendidikan . Peserta PLPG mempunyai kemampuan dalam dalam menyusun karya tulis ilmiah dalam bentuk hasil pemikiran. . Hasil a. 4. Sharing dalam kelas mengenai karya tulis ilmiah hasil penelitian.1 Fasilitator bersama-sama dengan peserta mengadakan refleksi terhadap proses pembelajaran hari itu. Fasilitator berdiskusi dengan peserta pelatihan.2 Fasilitator memberi kesempatan peserta untuk mengungkapkan pengalaman setelah dilakukan sharing. Sharing dalam kelas mengenai karya tulis ilmiah hasil pemikiran konseptual. Fasilitator memberikan tugas menyusun karya tulis ilmiah baik dalam bentu pemikiran maupun hasil penelitian. 4.3 Berdoa bersama-sama sebagai menutup pelatihan 10 menit Refleksi 3. 4.

Artikel (hasil penelitian) memuat: Judul Nama Penulis Abstrak dalam bahasa Indonesia dan bahasa Inggris Kata-kata kunci Pendahuluan (tanpa sub judul. memuat latar belakang masalah dan sedikit tinjauan pustaka. Artikel (setara hasil penelitian) memuat: Judul Nama Penulis Abstrak dalam bahasa Indonesia dan bahasa Inggris Kata-kata kunci Pendahuluan (tanpa subjudul) Subjudul Subjudul Subjudul Penutup (atau Kesimpulan dan Saran) Daftar Rujukan (berisi pustaka yang dirujuk dalam uraian saja) sesuai dengan kebutuhan . D. dan masalah/tujuan penelitian) Metode Hasil Pembahasan Kesimpulan dan Saran Daftar Rujukan (berisi pustaka yang dirujuk dalam uaraian saja) 2.Penulisan Karya Ilmiah 9-37 b. RANGKUMAN 1. Peserta PLPG mempunyai kemampuan dalam dalam menyusun karya tulis ilmiah dalam bentuk hasil penelitian.

Tugas ini sifatnya individual. Tugas dapat ditulis menggunakan komputer atau tulis tangan. Fasilitator memberikan bimbingan dan pendampingan pada saat peserta PLPG menyusun karya tulis ilmiah. Ruangan bebas.9-38 Penulisan Karya Ilmiah E. . TES FORMATIF Peserta PLPG ditugasi menyusun karya tulis ilmiah dengan cara memilih salah satunya yaitu hasil pemikiran konseptual atau hasil penelitian. tidak harus terkekang di dalam kelas.

a 7. b 4. d . b 2. c 2. a 8. c 8.Penulisan Karya Ilmiah 9-39 KUNCI JAWABAN TES FORMATIF Kegiatan Belajar 1 1. a Kegiatan Belajar 2 1. b 10. b 9. b 7. c 5. a 3. c 5. c 6. a 3. d 4. b 9. b 6. c 10.

dan Kantor Menristek: Jakarta. G. Direktorat Profesi Pendidik. Depdiknas: Jakarta. Penerbit Universitas Terbuka: Jakarta.A.K. Ditbinlitabmas Dikti. Penerbit Universitas Negeri Malang (UM Press): Malang. Sistematika Penulisan Laporan KTI Online. dan Waseso. Instrumen Evaluasi untuk Akreditasi Berkala Ilmiah. LIPI. 2000. 2008.G. I. A. 2001. .M. Teknik Menulis Karya Ilmiah.DAFTAR PUSTAKA Ditbinlitabmas Ditjen Dikti Depdikbud. Saukah. Wardani. Ikapindo. Menulis Artikel untuk Jurnal Ilmiah. 2007.

Sign up to vote on this title
UsefulNot useful