i Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI

Bahasa I ndonesi a 2
Unt uk SMK/MAK
Semua Pr ogr am Kej ur uan
Kel as XI
Mokhamad I rman
Tri Wahyu Prastowo
Nurdin
Pusat Per bukuan
Departemen Pendi di kan Nasi onal
Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI i i
Hak Cipta ada Pada Departemen Pendidikan Nasional
Dilindungi Undang-undang
Bahasa Indonesia 2
Untuk SMK/MAK Semua Program Kejuruan
Kelas XI
Penulis : Mokhamad Irman
Tri Wahyu Prastowo
Nurdin

Ukuran Buku : 17,6 x 25 cm
410
IRM IRMAN, Mokhamad
b Bahasa Indonesia 2 : untuk SMK/MAK Semua Program Keahlian
Kelas XI/Mokhamad Irman, Tri Wahyu Prastowo, Nurdin– Jakarta:
Pusat Perbukuan, Departemen Pendidikan Nasional, 2008.
xii, 283 hlm.: ilus.; 25 cm.
Bibliografi: hlm. 278-279
Indeks: hlm. 282
ISBN 979-462-868-9
1. Bahasa Indonesia-Studi dan Pengajaran
I. Judul II. Prastowo, Tri Wahyu III. Nurdin
Diterbitkan oleh Pusat Perbukuan
Departemen Pendidikan Nasional
Tahun 2008
Diperbanyak oleh ...
i i i Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI
Kata Sambutan
Puji syukur kami panjatkan ke hadirat Allah SWT, berkat rahmat dan karunia-Nya,
Pemerintah, dalam hal ini, Departemen Pendidikan Nasional, pada tahun 2008, telah
membeli hak cipta buku teks pelajaran ini dari penulis untuk disebarluaskan kepada
masyarakat melalui website Jaringan Pendidikan Nasional.
Buku teks pelajaran ini telah dinilai oleh Badan Standar Nasional Pendidikan dan telah
ditetapkan sebagai buku teks pelajaran yang memenuhi syarat kelayakan untuk digunakan
dalam proses pembelajaran melalui Peraturan Menteri Pendidikan Nasional Nomor 12
Tahun 2008.
Kami menyampaikan penghargaan yang setinggi-tingginya kepada para penulis yang
telah berkenan mengalihkan hak cipta karyanya kepada Departemen Pendidikan Nasional
untuk digunakan secara luas oleh para pendidik dan peserta didik di seluruh Indonesia.
Buku-buku teks pelajaran yang telah dialihkan hak ciptanya kepada Departemen
Pendidikan Nasional tersebut, dapat diunduh (down load), digandakan, dicetak,
dialihmediakan, atau difotokopi oleh masyarakat. Namun, untuk penggandaan yang
bersifat komersial harga penjualannya harus memenuhi ketentuan yang ditetapkan oleh
Pemerintah. Diharapkan bahwa buku teks pelajaran ini akan lebih mudah diakses sehingga
peserta didik dan pendidik di seluruh Indonesia maupun sekolah Indonesia yang berada di
luar negeri dapat memanfaatkan sumber belajar ini.
Kami berharap, semua pihak dapat mendukung kebijakan ini. Selanjutnya, kepada para
peserta didik kami ucapkan selamat belajar dan manfaatkanlah buku ini sebaik-baiknya.
Kami menyadari bahwa buku ini masih perlu ditingkatkan mutunya. Oleh karena itu, saran
dan kritik sangat kami harapkan.
Jakarta, Juni 2008
Kepala Pusat Perbukuan
Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI i v
PRAKATA
Puji syukur hanya pantas dipersembahkan ke hadirat Allah SWT atas limpahan
nikmat berupa kemudahan dan kelancaran, serta petunjuk-Nya yang diberikan sehingga
penulis dapat menyelesaikan buku Bahasa Indonesia 2 Kelas XI untuk SMK.
Buku ini disusun Sesuai Standar Isi SK dan KD. Penyajian materi disesuaikan dengan
penjabaran yang terdapat pada silabus mata pelajaran Bahasa Indonesia yang mengarah
pada standar kompetensi, yaitu berkomunikasi dengan bahasa Indonesia setara tingkat
madia. Buku Bahasa Indonesia 2 Kelas XI ini berisi materi pelajaran yang terbagi ke dalam
13 bab. Penyusunan dan pemberian judul pada setiap bab disesuaikan dengan urutan pada
silabus seperti pada buku kelas X, agar guru tidak perlu lagi mengamati silabus untuk
mengetahui seberapa jauh kompetensi dasar yang sudah dipelajari. Di samping itu, pada
setiap bab, penulis mencantumkan uraian indikator sesuai silabus, sedangkan pokok-
pokok materi dan tujuan pembelajaran setiap materi diuraikan dalam bentuk paragraf
pada kolom khusus.
Materi pembelajaran bahasa Indonesia pada tingkat madia ini sudah mengarah pada
penerapan cara berkomunikasi baik lisan maupun tulisan pada bentuk-bentuk kerja,
seperti menyimpulkan, menyimak informasi, memahami bentuk perintah atau yang bukan
perintah dalam konteks bekerja, memahami perintah kerja tertulis, berkomunikasi dalam
berbagai situasi dengan menerapkan pola gilir, dalam bernegosiasi, dan berdiskusi. Untuk
mengasah pemahaman dan keterampilan siswa lebih mendalam, penulis menyajikan
tugas akhir pelajaran lebih banyak dilakukan secara berkelompok dan bersifat penerapan
sesuai tuntutan kompetensi yang harus dicapai. Untuk tingkat madia, aspek keterampilan
bahasa lebih ditujukan pada keterampilan berbicara dan menulis yang memang menjadi
tuntutan dalam dunia kerja. Oleh sebab itu, buku ini sangat cocok untuk menjadi buku
panduan dalam permbelajaran bahasa Indonesia bagi siswa SMK tingkat madya.
Pokok-pokok materi diuraikan secara terperinci dengan menggunakan bahasa yang
mudah dicerna demi untuk melatih aspek kognitif siswa dan memotivasi minat membaca
dalam rangka memahami materi pelajaran secara mandiri. Penulis menyertai pula berbagai
contoh yang dapat membantu siswa memahami penjelasan materi. Dengan itu, guru hanya
memberikan penjelasan seperlunya saja pada hal-hal yang kurang dimengerti oleh siswa.
Jika ada istilah atau kata yang kurang dipahami, siswa dapat melihat glosarium yang
terdapat pada halaman belakang buku. Semoga dengan menggunakan buku ini, siswa
dapat mencapai setiap kompetensi dasar yang telah ditentukan dalam silabus dan mahir
dalam berkomunikasi setara tingkat madya.
Akhir kata, penulis menerima saran dan kritik yang membangun untuk kesempurnaan
buku ini. Semoga buku ini bermanfaat bagi kita semua dan bagi siapa saja yang mencintai
bahasa Indonesia sebagai bahasa persatuan. Amin!
Jakarta, Januari 2008
Penulis
v Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI
1. Judul setiap bab merupakan
kompetensi dasar yang sesuai
silabus.
2. Setiap halaman bab diberikan
pokok penjabaran materi pada
bab tersebut berikut tujuan
pembelajaran yang diharapkan
tercapai setelah proses
pembelajaran.
3. Setiap halaman bab disuguhkan
bacaan yang diharapkan berguna
bagi siswa untuk :
ƒ Menambah wawasan penge-
tahuan
ƒ Memberikan Motivasi positif
ƒ Memperkaya pengalaman
batin.
ƒ Melatih Kemampuan Mem-
baca Efektif (KEM)
4. Masing-masing subjudul dalam
setiap bab disajikan sesuai
tahapan indikator atau materi
pembelajaran pada silabus.
Materi diuraikan secara tuntas
dengan diberikan contoh-
contoh yang sesuai.
I . Penyaj i an Buku
Buku i ni di saj i kan dengan peri nci an sebagai beri kut.
Cara Penyaj i an dan Penggunaan Buku
BA B 1
M ENYIM A K UNTUK M ENYIM PULKA N
INFO RM A SI YA NG TIDA K BERSIFAT PERINTA H
DA LA M KO NTEKS BEKERJA
Pada Bab ini, kita akan mempelajari kegiatan menyimak dan membedakan
informasi berbentuk verbal serta nonverbal. Di samping itu, kita juga akan
belajar mengubah informasi verbal ke nonverbal serta membuat simpulan
secara deduktif dan induktif disertai dengan opini atau pendapat. Tujuan
mempelajari bab ini adalah agar kita terampil menyimak informasi lisan
untuk diubah menjadi informasi nonverbal sekaligus dapat menyampaikan
pendapat berbentuk simpulan secara deduktif maupun induktif dari informasi
yang didengarkan.
Wacana
Narkoba, AI DS, dan Ki ta
Saat ini di kawasan Asia, diperkirakan 4,9 juta orang hidup dengan
HIV/AIDS termasuk 440.000 kasus baru pada tahun lalu. Sekitar 300.000
orang meninggal akibat berbagai penyakit terkait AIDS. Asia Tenggara
sendiri memiliki tingkat prevalensi tertinggi di Asia dengan luas wilayah
endemis bervariasi antarnegara.
Ketika epidemi di Kamboja, Myanmar, dan Thailand menunjukkan
penurunan prevalensi HIV, di Indonesia dan Vietnam justru meningkat
pesat. Mayoritas kasus infeksi baru di Indonesia dan Vietnam disebabkan
pemakaian narkotika, psikotropika, dan zat-zat adiktif lainnya (napza),
terutama penggunaan jarum suntik i nj ect i ng dr ug use (IDU), dan hubungan
seks tidak aman.
Dalam sepuluh tahun terakhir, peningkatan kasus HIV di Indonesia
sungguh mencengangkan. Jika tahun 1998 jumlah kumulatif kasus HIV
baru 591 orang, pada September 2007 jumlahnya telah mencapai 5.904
orang. Sejak Januari hingga September 2007 saja, jumlah kasus infeksi baru
HIV mencapai 674 orang.
Kondisi ini seiring dengan laju epidemi AIDS. Jika tahun 1998 jumlah
kumulatif kasus AIDS yang dilaporkan 258 orang, pada September 2007
jumlahnya telah meningkat jadi 10.384 orang dengan prevalensi 4,57 persen.
Cara penularan kasus AIDS melalui IDU 49,5 persen dan hubungan seks
tidak aman 46 persen.
Sejauh ini, epidemi HIV/AIDS telah bergeser dari hubungan seks
tidak aman ke pemakaian napza (populer dengan sebutan narkoba) dengan
jarum suntik. Peningkatan kasus penularan virus itu melalui narkoba suntik
mulai terlihat sejak tahun 1999.
A. Kegi atan Menyi mak dan Memahami I nf ormasi
Nonverbal
Menyimak merupakan salah satu kegiatan berbahasa yang dapat
menambah atau memperluas pengetahuan. Keterampilan menyimak perlu
dilatih secara terus-menerus dan berkesinambungan. Proses pelatihan
menyimak menuntut adanya kesiapan mental dan kesehatan fisik serta
motivasi atau kemauan secara sadar untuk mengikuti seluruh isi simakan.
Pada dasarnya menyimak adalah kegiatan menyerap informasi yang
disampaikan secara lisan dengan tidak sekadar menggunakan indera
pendengaran, tetapi juga berupaya menangkap isi atau pesan serta
memahami makna informasi yang disampaikan. Hasil simakan dapat
diungkapkan kembali dengan bahasa sendiri dengan tidak mengubah
pengertian dasar informasi sumber.
Proses menyimak menuntut motivasi dan perhatian dari pendengar.
Tanpa keinginan dan perhatian, sulit mengharapkan hasil yang memuaskan.
Berdasarkan caranya, menyimak terdiri atas beberapa macam, yakni, seperti
berikut :
Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI vi
5. Tugas kelompok diberikan untuk
dikerjakan secara berkelompok
agar dapat mengolah kompetensi
secara bersama-sama.
6. Tugas mandiri diberikan untuk
mengasah kompetensi secara
individual sesuai materi dan
tujuan pembelajaran.
7. Rangkuman berisi ringkasan
materi dalam setiap bab.
8. Setiap bab diberikan uji
kompetensi dengan model soal
pilihan ganda dan essai, untuk
dapat menguji pemahaman
pembelajaran dalam satu bab.
I I . Petunj uk Penggunaan Buku
A. Untuk siswa
Agar Anda dapat menggunaka buku ini dengan baik dan mencapai
target hasil pembelajaran yang diharapkan, perhatikanlah dan ikutilah
langkah-langkah berikut :
1. Bacalah judul bab dan pahami penjabaran pokok-pokok materi serta
tujuan pembelajaran yang akan dicapai pada setiap bab.
2. Bacalah bacaan dan pahami uraian materi pada setiap subjudul.
3. Amatilah contoh-contoh yang disajikan, jika perlu diskusikan dengan
teman sebangku.
4. Catatlah hal-hal yang belum dipahami untuk ditanyakan kepada
Guru.
5. Jika ada istilah atau kata yang belum Anda pahami, carilah di Glosarium
TUGAS MANDI RI :
Mintalah salah seorang siswa membacakan wacana yang terdapat
di awal bab, sedangkan siswa lainnya menyimak. Setelah menyimak
lakukan hal berikut.
1. Catatlah pokok-pokok informasi.
2. Dari pokok informasi yang dicatat, buatlah informasi berbentuk
nonverbal !
3. Susunlah sebuah simpulannya secara deduktif atau induktif yang
disertakan opini Anda.
RANGKUMAN
A. Kegi atan Menyi mak dan Memahami I nf ormasi Nonverbal
Menyimak adalah kegiatan menyerap informasi yang disampaikan
secara lisan dengan tidak sekedar menggunakan indera pendengaran
tapi juga berupaya menangkap isi atau pesan serta memahami makna
informasi yang disampaikan.
Ada beberapa macam cara menyimak, diantaranya adalah menyimak
intensif, menyimak ekstensif, menyimak diskriminatif, dan menyimak
untuk pemecahan masalah.
Informasi dapat berbentuk verbal dan nonverbal. Informasi verbal
ialah informasi berbentuk uraian atau penjelasan. Informasi nonverbal
ialah informasi berbentuk visual seperti grafik, diagram, tabel, bagan,
peta, denah, dan matriks.
B. Pengal i han I nf ormasi Verbal menj adi Nonverbal
Hal-hal yang perlu diperhatikan untuk mengalihkan informasi
verbal ke informasi nonverbal, yaitu:
1. Perhatikan dengan saksama isi informasi verbal yang ingin diubah.
2. Perhatikan data-data berupa lambang, satuan atau angka-angka serta
perbandingannya untuk menentukan bentuk visual yang efektif,
apakah grafik, tabel, diagram dan yang lainnya.
UJI KOMPETENSI
I . Pi l i hl ah j awaban yang pal i ng tepat dari pernyataan di bawah i ni !
1. Menyusun kesimpulan dengan cara induksi atau deduksi kita lakukan
bila membuat karangan
a. argumentasi
b. persuasi
c. narasi
d. eksposisi
e. deskripsi
2. Lukisan naik turunnya data yang berupa batang atau balok dan dipakai
untuk menekankan adanya perbedaan tingkat atau nilai dari berbagai
aspek disebut
a. grafik lingkaran
b. grafik batangan
c. grafik garis
d. bagan arus
e. bagan pohon
TUGAS KELOMPOK
Bentuklah kelompok terdiri atas 4-5 orang. Anggap saja setiap
kelompok diperintahkan oleh pembina OSIS/kepala sekolah untuk
melaksanakan kegiatan (penentuan jenis kegiatan diserahkan pada
kelompok). Lalu, setiap kelompok melakukan langkah-langkah berikut.
1. Rumuskanlah hal-hal yang akan dilakukan oleh tim kerja!
2. Susunlah agenda atau jadwal kerja panitia!
3. Buatlah struktur kerja berbentuk bagan!
4. Susunlah daĞar pertanyaan untuk konfirmasi!
5. Presentasikanlah di depan kelas semua langkah kerja tersebut!
vi i Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI
atau di kamus.
6. Kerjakanlah tugas-tugas atau perlatihan untuk lebih menggali potensi
Anda sesuai petunjuk tugas. Hasilnya berikan pada Guru, atau ikuti
instruksi yang diberikan Guru.
7. Mintalah saran kepada Guru untuk menambah bahan dan sarana
pembelajaran dalam rangka memudahkan mengerjakan latihan agar
mencapai hasil yang maksimal.
B. Untuk guru
Selain melihat langkah-langkah pembelajaran di dalam silabus, Anda
diharapkan melakukan hal berikut:
1. Membaca uraian pokok-pokok materi pada setiap bab yang akan
diajarkan dan mendalaminya dengan memperkaya contoh-contoh.
Hal ini mungkin dapat dilakukan dengan mempelajari buku sumber
pembelajaran yang dapat dilhat pada kolom akhir silabus.
2. Menyediakan forum tanya jawab kepada siswa.
3. Menyediakan banyak waktu kepada siswa untuk mengerjakan tugas di
kelas dan membahasnya bersama.
4. Guru dapat mengatur penyajian materi pembelajaran dengan
menggabungkan materi pada beberapa bab yang dianggap berhubungan
atau satu pokok bahasan meskipun posisi bab berjauhan, misalnya:

Hal ini dilakukan agar siswa dapat lebih fokus dan memiliki
pemahaman serta penguasaan kompetensi yang komprehensif.

Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI vi i i

TATARAN
MADYA
Menyimak
2.1
Menyimak untuk
menyimpulkan
informasi yang tidak
bersifat perintah
dalam konteks
2.2.
Menyimak untuk
memahami perintah
yang diungkapkan
atau yang tidak
dalam konteks
bekarja
Membaca Berbicara Menulis
2.3
Memahami perintah
kerja tertulis
2.3
Memahami perintah
kerja tertulis
2.4
Membaca untuk
memahami makna
kata, bentuk kata,
ungkapan, dan
kalimat dalam
konteks bekerja
2.5
Menggunakan
secara lisan kalimat
tanya/pertanyaan
dalam konteks
bekerja
2.6.
Membuat parafrasa
lisan dalam konteks
bekerja
2.7.
Menerapkan Pola
Gilir dalam
berkomunikasi
2.7.
Menerapkan Pola
Gilir dalam
berkomunikasi
2.8.
Bercakap-cakap
secara sopan dengan
mitra bicara dalam
konteks bekerja
2.9.
Berdiskusi yang
bermakna dalam
konteks bekerja
2.10.
Bernegosiasi yang
menghasilkan dalam
konteks bekerja
2.11.
Menyampaikan
laporan atau
presentasi lisan
dalam konteks
bekerja
2.12
Menulis wacana
yang bercorak
naratif, deskriptif,
ekspositoris, dan
argumentatif
2.13.
Meringkas teks
tertulis dalam
konteks bekerja
2.14.
Menyimpulkan isi
teks tertulis dalam
konteks bekerja
PETA KOMPETENSI
2.7.
Menerapkan
pola gilir dalam
berkomunikasi
i x Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI
KATA SAMBUTAN ...................................................................................... iii
PRAKATA ................................................................................................ iv
CARA PENYAJIAN DAN PENGGUNAAN BUKU ................................ v
PETA KOMPETENSI .................................................................................... viii
DAFTAR ISI ................................................................................................ ix
BAB I MENYIMAK UNTUK MENYIMPULKAN INFORMASI
YANG TIDAK BERSIFAT PERINTAH DALAM
KONTEKS BEKERJA .............................................................................................. 1
A. Kegiatan Menyimak dan Memahami Informasi Nonverbal .. 4
B. Pengalihan Informasi Verbal menjadi Nonverbal .......... 11
C. Menyampaikan Pendapat melalui Simpulan
Secara Deduktif dan Induktif .............................................. 15
UJI KOMPETENSI ....................................................................... 19
BAB II MENYIMAK UNTUK MEMAHAMI PERINTAH
YANG DIUNGKAPKAN ATAU YANG TIDAK
DALAM KONTEKS BEKERJA. ................................................. 25
A. Pengertian dan Ciri Kalimat Perintah .............................. 28
B Jenis-Jenis Kalimat Perintah ............................................... 28
C. Berbagai Respons terhadap Perintah ................................ 31
UJI KOMPETENSI ....................................................................... 36

BAB III MEMAHAMI PERINTAH KERJA TERTULIS
DALAM KONTEKS BEKERJA ......................................................... 41
A. Mengenal Bentuk Perintah Kerja Tertulis ........................ 43
B. Model-Model Surat Berisi Perintah Kerja ........................ 44
C. Perintah Kerja Berbentuk Manual ..................................... 51
D. Menindak Lanjuti Perintah Kerja Tertulis ...................... 53
UJI KOMPETENSI ....................................................................... 55
BAB IV MEMBACA UNTUK MEMAHAMI MAKNA KATA,
BENTUK KATA UNGKAPAN, DAN KALIMAT
DALAM KONTEKS BEKERJA ................................................... 61
A. Klasifikasi Kata Berdasarkan Kelas Kata ......................... 63
B. Klasifikasi Kata Berdasarkan Bentuk Kata ...................... 68
C. Klasifikasi Kata Berdasarkan Makna Kata ...................... 71
D. Penggunaan Kamus dalam Mencari Bentuk, Kategori,
DAFTAR I SI
Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI x
dan Makna Kata ................................................................... 77
E. Bentukan Kata/Frasa Baru ................................................. 78
F. Pemakaian Kata , Frasa, dan Kalimat yang Kurang Tepat .... 80
UJI KOMPETENSI ....................................................................... 85
BAB V MENGGUNAKAN SECARA LISAN KALIMAT
TANYA/PERTANYAAN DALAM KONTEKS BEKERJA ...... 91
A. Pengertian dan Fungsi Kalimat Tanya ............................... 93
B. Jenis Kalimat Tanya ............................................................. 94
C. Mengutarakan Pendapat dengan Kalimat Tanya
yang Santun .......................................................................... 99
UJI KOMPETENSI ....................................................................... 106
BAB VI MEMBUAT PARAFRASA LISAN DALAM
KONTEKS BEKERJA ................................................................... 111
A. Pengertian Parafrasa ........................................................... 114
B. Cara Membuat Parafrasa ................................................... 114
C. Memparafrasakan Puisi Menjadi Prosa .......................... 116
D. Memparafrasakan Naskah Drama Menjadi
Prosa atau Cerita ................................................................. 118
E. Pola Penyajian Informasi Lisan ......................................... 121
UJI KOMPETENSI ....................................................................... 124
BAB VII MENERAPKAN POLA GILIR DALAM BERKOMUNIKASI ... 129
A. Menggunakan Kata, Bentukan kata, serta Kalimat
yang Santun dalam Berkomunikasi ................................. 131
B. Memahami Pola Gilir dalam Berkomunikasi .................. 132
C. Penerapan Pola Gilir dalam Berbagai Situasi .................. 133
UJI KOMPETENSI ....................................................................... 141
TES SEMESTER GANJIL ............................................................. 146
BAB VIII BERCAKAP-CAKAP SECARA SOPAN DENGAN MITRA
BICARA DALAM KONTEKS BEKERJA ................................. 153
A. Pilihan Kata atau Ungkapan untuk Memulai Percakapan .. 156
B. Salam dan Ungkapan dalam Mengakhiri Percakapan .. 158
C. Penerapan Pola gilir dalam Percakapan secara Aktif ..... 160
D. Mengalihkan Topik Pembicaraan secara Halus .............. 161
E. Menggungkapkan Perbedaan Pendapat secara Halus ..... 162
UJI KOMPETENSI ....................................................................... 164
xi Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI
BAB IX BERDISKUSI YANG BERMAKNA DALAM
KONTEKS BEKERJA ................................................................... 169
A. Diskusi dan Manfaatnya .................................................... 174
B. Tugas dan Peranan Unsur Diskusi .................................... 174
C. Menyampaikan Pendapat dan Gagasan dalam Diskusi .... 176
D. Menyampaikan Tanggapan dan Sanggahan
dalam Diskusi ...................................................................... 176
E. Mengambil Simpulan dalam Diskusi ............................... 177
UJI KOMPETENSI ....................................................................... 179
BAB X BERNEGOSIASI YANG MENGHASILKAN DALAM
KONTEKS BEKERJA ................................................................... 185
A. Pengertian Negosiasi .......................................................... 188
B. Bernegosiasi dalam Menyusun Program Kerja .............. 189
C. Bernegosiasi dengan Santun .............................................. 190
UJI KOMPETENSI ....................................................................... 195
BAB XI MENYAMPAIKAN LAPORAN ATAU PRESENTASI
LISAN DALAM KONTEKS BEKERJA ..................................... 203
A. Pengertian Laporan ............................................................. 206
B. Pola Penyajian Laporan secara Lisan ................................ 208
C. Menyampaikan Rangkuman dan Simpulan Laporan .... 213
UJI KOMPETENSI ....................................................................... 215
BAB XII MEMBUAT WACANA BERCORAK NARATIF,
DESKRIPTIF, EKSPOSITORIS DAN ARGUMENTATIF ........................ 219
A. Pengertian Wacana .............................................................. 222
B. Jenis-Jenis Wacana ............................................................... 224
UJI KOMPETENSI ....................................................................... 241
BAB XIII MERINGKAS TEKS TERTULIS DALAM KONTEKS
BEKERJA ....................................................................................... 249
A. Pengertian Ringkasan ......................................................... 252
B. Cara Membuat Ringkasan .................................................. 252
C. Beberapa Contoh Bentuk Ringkasan ................................ 254
D. Pengertian Simpulan ........................................................... 257
E. Pola Penalaran dalam Mengambil Simpulan .................. 258
UJI KOMPETENSI ....................................................................... 263
TES SEMESTER GENAP ............................................................. 269
DAFTAR PUSTAKA .................................................................... 278
GLOSARIUM ................................................................................ 280
INDEKS ......................................................................................... 282

Bahasa Indonesi a SMK/ MAK Set ar a Ti ngkat Madya Kel as XI xi i
1 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Kompetensi
Dasar
- Menyimak untuk Menyimpulkan Informasi yang Tidak
Bersifat Perintah dalam Konteks Bekerja
Indikator
- Mengubah informasi dari bentuk lisan ke dalam bentuk
nonverbal (bagan/tabel/diagram/grafk/ denah/matriks)
- Menyampaikan pendapat/opini dengan menggunakan
teknik penyampaian simpulan dan pendapat yang
akurat secara deduktif atau induktif
- Menggunakan bahasa Indonesia yang baik dan benar
dalam menyimpulkan sesuatu informasi
Pada Bab ini, kita akan mempelajari kegiatan menyimak dan membedakan
informasi berbentuk verbal serta nonverbal. Di samping itu, kita juga akan
belajar mengubah informasi verbal ke nonverbal serta membuat simpulan
secara deduktif dan induktif disertai dengan opini atau pendapat. Tujuan
mempelajari bab ini adalah agar kita terampil menyimak informasi lisan
untuk diubah menjadi informasi nonverbal sekaligus dapat menyampaikan
pendapat berbentuk simpulan secara deduktif maupun induktif dari informasi
yang didengarkan.
BAB 1
MENYIMAK UNTUK MENYIMPULKAN
INFORMASI YANG TIDAK BERSIFAT PERINTAH
DALAM KONTEKS BEKERJA
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 2
Wacana
Narkoba, Aids, dan Kita
Saat ini di kawasan Asia, diperkirakan 4,9 juta orang hidup dengan
HIV/AIDS termasuk 440.000 kasus baru pada tahun lalu. Sekitar 300.000
orang meninggal akibat berbagai penyakit terkait AIDS. Asia Tenggara
sendiri memiliki tingkat prevalensi tertinggi di Asia dengan luas wilayah
endemis bervariasi antarnegara.
Ketika epidemi di Kamboja, Myanmar, dan Thailand menunjukkan
penurunan prevalensi HIV, di Indonesia dan Vietnam justru meningkat
pesat. Mayoritas kasus infeksi baru di Indonesia dan Vietnam disebabkan
pemakaian narkotika, psikotropika, dan zat-zat adiktif lainnya (napza),
terutama penggunaan jarum suntik injecting drug use (IDU), dan hubungan
seks tidak aman.
Dalam sepuluh tahun terakhir, peningkatan kasus HIV di Indonesia
sungguh mencengangkan. Jika tahun 1998 jumlah kumulatif kasus HIV
baru 591 orang, pada September 2007 jumlahnya telah mencapai 5.904
orang. Sejak Januari hingga September 2007 saja, jumlah kasus infeksi baru
HIV mencapai 674 orang.
Kondisi ini seiring dengan laju epidemi AIDS. Jika tahun 1998 jumlah
kumulatif kasus AIDS yang dilaporkan 258 orang, pada September 2007
jumlahnya telah meningkat jadi 10.384 orang dengan prevalensi 4,57 persen.
Cara penularan kasus AIDS melalui IDU 49,5 persen dan hubungan seks
tidak aman 46 persen.
Sejauh ini, epidemi HIV/AIDS telah bergeser dari hubungan seks
tidak aman ke pemakaian napza (populer dengan sebutan narkoba) dengan
jarum suntik. Peningkatan kasus penularan virus itu melalui narkoba suntik
mulai terlihat sejak tahun 1999.
Departemen Kesehatan menyebutkan, jumlah pengguna narkoba
suntik di Indonesia pada tahun 2006 diperkirakan 190.000 hingga 247.000
orang. Sementara estimasi prevalensi HIV pada pengguna narkoba suntik
mencapai 41,6 persen dan ditemukan di tiap provinsi. Secara nasional, dari
kasus AIDS yang terlaporkan secara kumulatif, 49,5 persen di antaranya
adalah pengguna narkoba suntik.
J 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
Bahkan, di wilayah Provinsi DKI Jakarta, 72 persen dari total jumlah
kumulatif kasus AIDS adalah pengguna narkoba suntik. “Usia pengguna
napza suntik cenderung makin muda sehingga mereka akan terinfeksi
HIV lebih awal dan sulit diangkau,” kata Nafsiah Mboi, Sekretaris Komisi
Nasional Penanggulangan HIV/AIDS.
Para pengguna narkoba suntik di lembaga pemasyarakatan (lapas)
dan rumah tahanan (rutan) juga meningkat pesat serta rata-rata 20 persen
terinfeksi HIV. Akibatnya, angka kematian penghuni lapas atau rutan
pada tahun 2005 meningkat dua kali lipat dibandingkan dengan tahun
sebelumnya. Para pengguna narkoba suntik yang terinfeksi HIV di lapas
atau rutan selama ini kesulitan mengakses pelayanan kesehatan.
Tingginya angka terinfeksi HIV di kalangan pengguna narkoba
terutama disebabkan perilaku mereka amat beresiko. Salah satunya masih
meluasnya praktik berbagi jarum suntik di kalangan IDU. Di Indonesia,
yang populer dikonsumsi adalah narkoba suntikan berupa heroin atau
putau. Konon karena efeknya lebih cepat dan murah dibandingkan dengan
yang nonsuntikan.
Di sisi lain, pengetahuan pentingnya sterilisasi jarum suntik sangat
rendah. Menurut penelitian Budi Utomo, Guru Besar dari Fakultas
Kesehatan Masyarakat Universitas Indonesia (FKM UI), di kalangan remaja
pengguna narkoba suntik umumnya satu jarum suntik dipakai dua sampai
18 orang. Bahkan, 62 persen di antaranya memakai ulang jarum tersebut.
Cara membersihkan jarum, 65 persen memakai air biasa, 31 persen air
panas. Sangat sedikit yang mensterilkan dengan merebus.
Hasil penelitian lain yang dilakukan I Made Setiawan dan timnya
di Bali (1998) menyebutkan, 26,5 persen dari pengguna narkoba suntik itu
memiliki lebih dari satu pasangan seksual aktif, 26,5 persen lainnya pernah
menggunakan jasa pekerja seksual, serta 17,6 persen berhubungan intim
dengan orang asing. Akan tetapi, cuma satu orang yang konsisten memakai
kondom.
Hal ini membuat kelompok pengguna narkoba suntik menempati
posisi amat penting dalam mata rantai penyebaran HIV/AIDS. Menurut
Zubairi Djoerban, Guru Besar dari FKUI RSCM yang bergerak di bidang
penanggulangan HIV/AIDS, mereka rentan tertular akibat praktik berbagi
jarum suntik. Kemudian, mereka berpeluang besar menularkannya ke
kalangan non-pengguna narkoba suntik, istri mereka, anak dan pasangan
seksual mereka.
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 4
Sejauh ini, Pemerintah telah menyusun pedoman penanggulangan
HIV/AIDS akibat pemakaian jarum suntik pada pengguna narkoba suntik
secara bergantian. Pedoman itu mengatur penggunaan jarum suntik sebagai
bagian layanan harm reduction di puskesmas, rumah sakit, dan lapas.
Dalam aturan itu, Departemen Hukum dan Hak Asasi Manusia bertugas
mengurus di lembaga pemasyarakatan, yaitu memisahkan antara pengedar
dan pengguna. Setiap pengguna narkoba di lapas juga wajib diperlakukan
sebagai pasien yang bisa disembuhkan. Apabila terlanjur terinfeksi HIV,
pasien bisa mendapat pengobatan tanpa didiskriminasi.
Realisasinya tentu butuh komitmen kuat dari pemerintah dan pemangku
kepentingan dalam penanggulangan HIV/AIDS di kalangan pengguna
narkoba suntikan. Untuk itu, kita bisa belajar dari negara-negara tetangga
seperti Kamboja, khususnya menyangkut bagaimana upaya pencegahan
yang terfokus dan berkelanjutan dapat menekan perkembangan epidemi
HIV.
(Sumber: Kompas, Sabtu, 24 November 2007,
dengan beberapa perubahan)
A. Kegiatan Menyimak dan Memahami informasi
Nonverbal
Menyimak merupakan salah satu kegiatan berbahasa yang dapat
menambah atau memperluas pengetahuan. Keterampilan menyimak perlu
dilatih secara terus-menerus dan berkesinambungan. Proses pelatihan
menyimak menuntut adanya kesiapan mental dan kesehatan fsik serta
motivasi atau kemauan secara sadar untuk mengikuti seluruh isi simakan.
Pada dasarnya menyimak adalah kegiatan menyerap informasi yang
disampaikan secara lisan dengan tidak sekadar menggunakan indera
pendengaran, tetapi juga berupaya menangkap isi atau pesan serta
memahami makna informasi yang disampaikan. Hasil simakan dapat
diungkapkan kembali dengan bahasa sendiri dengan tidak mengubah
pengertian dasar informasi sumber.
Proses menyimak menuntut motivasi dan perhatian dari pendengar.
Tanpa keinginan dan perhatian, sulit mengharapkan hasil yang memuaskan.
Berdasarkan caranya, menyimak terdiri atas beberapa macam, yakni, seperti
berikut :
5 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
1. Menyimak Intensif
menyimak memahami secara terperinci, teliti, dan mendalami bahan
yang disimak.
2. Menyimak Ekstensif
menyimak memahami secara sepintas dan umum dalam garis-garis
besar atau butir-butir penting tertentu.
3. Menyimak untuk Belajar
melalui kegiatan menyimak, seseorang mempelajari berbagai hal
yang dibutuhkan. Misalnya, para siswa menyimak ceramah guru
bahasa Indonesia, para siswa mendengarkan suara radio, televisi, dan
sebagainya.
4. Menyimak untuk Menghibur
menyimak sesuatu untuk menghibur dirinya. Misalnya, menyimak
pembacaan cerita-cerita lucu, pertunjukan sandiwara, flm, dan
sebagainya.
5. Menyimak untuk Menilai
menyimak mendengarkan, memahami isi simakan, menelaah, mengkaji,
menguji, dan membandingkan dengan pengalaman serta pengetahuan
menyimak.
6. Menyimak Diskriminatif
menyimak untuk membedakan bunyi suara. Dalam belajar bahasa
Inggris, misalnya siswa harus dapat membedakan bunyi (i) dan (i:).
7. Menyimak Pemecahan Masalah
menyimak mengikuti uraian pemecahan masalah secara kreatif dan
analisis yang disampaikan oleh si pembicara. Mungkin juga penyimak
dapat memecahkan masalah yang dihadapinya, secara kreatif dan
analisis setelah yang bersangkutan mendapat informasi dari menyimak
sesuatu.
Untuk dapat mengungkapkan kembali informasi simakan yang diterima
dengan baik dan memadai, kita dapat melakukan langkah-langkah sebagai
berikut.
1. Perhatikan judul wacana yang akan dilisankan.
2. Catatlah kata-kata kunci yang dianggap penting berupa frasa atau
klausa.
3. Catatlah ide-ide pokok setiap paragraf.
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 6
4. Catatlah fakta-fakta atau data berupa angka, persentase, atau
perbandingan.
5. Uraikan kembali dalam bentuk ikhtisar berdasarkan data-data yang
dicatat.
Informasi hasil simakan dapat dikemukakan atau disampaikan dalam
bentuk verbal maupun nonverbal. Informasi verbal berwujud uraian,
ulasan, atau penjelasan dan dapat disampaikan secara lisan maupun tulisan.
Informasi ini dianggap lebih mudah dicerna dan dipahami.
Contoh informasi verbal:
Sulistya mengatakan UN lebih banyak menimbulkan penderitaan
bagi sekolah swasta dan pinggiran. Bagaimana mungkin sekolah
pinggiran yang sarana, prasarana, kualitas SDM, dan pemenuhan standar
pelayanan minimal (SPM)-nya sangat terbatas disamakan dengan sekolah
yang SPM-nya lengkap dan pada umumnya didominasi sekolah negeri
perkotaan. UN yang diselenggarakan setiap tahun hanya akan menambah
persoalan dan pemborosan APBN, jika hasil ujian periode sebelumnya
tidak ditindaklanjuti dengan upaya peningkatan kualitas pembelajaran
pada sekolah yang angka kelulusannya rendah.
Informasi berbentuk nonverbal cenderung bersifat visual, berupa
bentuk atau gambar serta garis-garis yang memiliki ciri-ciri tersendiri dan
cenderung perlu pengamatan lebih khusus. Contohnya: grafk, denah,
bagan, diagram, atau matriks.
Berikut ini pengertian dan contoh bentuk informasi nonverbal.
1. Grafk
Grafk adalah gambaran pasang surutnya suatu keadaan atau data
yang ada dengan garis atau gambar. Grafk dibedakan menjadi tiga macam,
yaitu grafk batang, grafk garis, dan grafk lingkaran.
a. Grafk batang adalah lukisan naik turunnya data berupa batang atau
balok dan dipakai untuk menekankan adanya perbedaan tingkatan
7 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
atau nilai berupa aspek.
Contoh Grafk Batang :
Grafk Pekerjaan Orang Tua Siswa SMK Nurul Islam Tahun 2007 Grafik Pekerjaan Orang Tua Siswa SMK Nurul Islam Tahun 2007
0
50
100
150
1
ABRI
PNS
SWASTA
BURUH
PETANI
LAINNYA
b. Grafk garis adalah lukisan naik turunnya data berupa garis yang
dihubungkan dari titik-titik data secara berurutan.
Grafk ini dipakai untuk menggambarkan perkembangan atau
perubahan dari waktu ke waktu.
Contoh grafk garis:
Grafk Pengunjung Perpustakaan SMK Nurul Islam Tahun 2007 Grafik Pengunjung Perpustakaan SMK Nuris Tahun 2007
0
50
100
150
200
250
300
J
a
n
M
a
r
M
e
i
J
u
l
S
e
p
t
N
o
v
Bulan
J
u
m
l
a
h

P
e
n
g
u
n
j
u
n
g
Series1
c. Grafk lingkaran adalah gambaran naik turunnya data berupa lingkaran
untuk menggambarkan persentase dari nilai total atau seluruhnya.
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 8
Contoh grafk lingkaran:
Persentase Penganut Agama di SMK Kartini
Persentase Penganut Agama di SMK Kartini
Islam 55
Protestan 28
Katolik 14
Hindu 2
Budha 1
28%
14%
2%
55%
1%
Islam
Protestan
Katolik
Hindu
Budha
2. diagram
Diagram adalah (gambaran buram, sketsa) untuk memperlihatkan atau
menerangkan sesuatu. Bentuk-bentuk diagram antara lain adalah diagram
arus (bagan alur), diagram balok, diagram gambar, diagram garis, diagram
lingkaran, diagram cabar, dan diagram pohon.
Contoh diagram:
Total Nilai Transaksi di BEJ (dalam Triliyun)
147.9
128.8
97.5
120.8
125.4
246.2
0
100
200
300
Nilai
Transa
ksi
1 2 3 4 5 6
Tahun
Transaksi Di BEJ (dlm triliyun)
Series
1
3. Tabel
Tabel adalah dafar yang berisi ikhtisar dan sejumlah data informasi,
biasanya berupa kata-kata dan bilangan yang tersusun secara bersistem,
urut ke bawah dalam lajur dan deret tertentu dengan garis pembatas
sehingga dapat dengan mudah disimak.
Nilai
Transaksi
Tahun
9 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
Contoh:
Data Tentang Kesegaran Jasmani Manusia Berdasarkan Usia dan Jenis
Kelamin

Pria Wanita Pria Wanita
12 menit 13 menit 2400 m 2250 m
13 menit 14 menit 2250 m 2090 m
14 menit 15 menit 2090 m 1850 m
18 - 29 tahun
40 - 49 tahun
30 - 49 tahun
Jenis Tes Waktu Tempuh untuk
Jarak 2,5 Km
Jarak yang Ditempuh
Selama 12 menit
Usia
4. Bagan
Bagan adalah gambaran secara analisis atau terurai tentang proses
yang terjadi di alam, teknologi, dan masyarakat manusia. Bagan digunakan
untuk membantu memperjelas proses kerja.
Contoh bagan:
Bagan Budidaya Belut
3. Tabel adalah daftar yang berisi ikhtisar dan sejumlah data informasi, biasanya berupa
kata-kata dan bilangan yang tersusun secara bersistem, urut ke bawah dalam lajur dan
deret tertentu dengan garis pembatas sehingga dapat dengan mudah di simak.
Contoh :
Data Tentang Kesegaran Jasmani Manusia Berdasarkan Usia dan Jenis Kelamin
4. Bagan adalah gambaran secara analisis atau terurai tentang proses yang terjadi di alam,
teknologi dan masyarakat manusia. Bagan digunakan untuk membantu memperjelas
proses kerja yang kurang komunikatif.
Contoh bagan:
Bagan Budidaya Belut
PembuatanȱKolamȱ
PenaburanȱKapurȱ
PenaburanȱRompasȱ
Penggenangan Kolam
PenebaranȱBibit
SeleksiȱBibit
Pemberianȱbibit
Total Nilai Transaksi di BEJ (dalam Triliyun)
147.9
128.8
97.5
120.8
125.4
246.2
0
100
200
300
Nilai
Transa
ksi
1 2 3 4 5 6
Tahun
Transaksi Di BEJ (dlm triliyun)
Series
Pria Wanita Pria Wanita
12 menit 13 menit 2400 m 2250 m
13 menit 14 menit 2250 m 2090 m
14 menit 15 menit 2090 m 1850 m
Waktu Tempuh utk
karak 2,5 Km
Jarak yg ditempuh
slm 12 menit
Usia
18 - 29 tahun
40 - 49 tahun
30 - 49 tahun
Jenis Tes
5. Peta
Peta adalah gambar atau lukisan pada kertas yang menunjukkan letak
tanah, laut, sungai, gunung-gunung, dan sebagainya atau representasi
melalui gambar dari suatu daerah yang menyatakan sifat, batas, sifat
permukaan, dan sebagainya.
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 10
Contoh :
6. denah
Denah adalah gambar yang menunjukkan letak kota, jalan, peta, atau
gambar rancangan bangunan.
Contoh:
11 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
7. Matriks
Matriks adalah tabel yang disusun dalam lajur dan jajaran sehingga
butir-butir uraian yang diisikan dapat dibaca dari atas ke bawah dan dari
kiri ke kanan.
Contoh:

No Nama Kegiatan Juli Agust Sept Okt Nov Des Ket
1 Penyusunan Personil
Bimbingan Konseling
2 Konsultasi Program X
3 Pengadaan Sarana Prasarana X X
4 Layanan Bimb. Konseling X
5 Instrumen Bimbingan X X X X
6 Pengembangan Sistem Prog. X
7 Kerj a sama dengan orang tua X
8 Laporan Bulan Semester X X X X X X
9 Evaluasi X
10 Analisis X
11 Tindak Lanj ut X
Program Kerja Bimbingan Konseling SMK
Mitra Kencana Jakarta
X X X X X X
B. Pengalihan informasi Verbal menjadi Nonverbal
Informasi yang kita simak perlu ditelaah isinya berdasarkan kepen-
tingan atau maksud yang terkandung di dalamnya. Bentuk-bentuk
pengungkapan informasi baik yang verbal maupun nonverbal masing-
masing selalu membutuhkan penyampaian informasi. Adakalanya suatu
informasi lebih tepat disampaikan dengan penyajian verbal karena lebih
memerlukan banyak penjelasan daripada bentuk visual. Namun, ada
informasi yang lebih mudah dicerna karena disajikan dalam bentuk
nonverbal. Tapi pada dasarnya semua itu bergantung pada kebutuhan.
Proses mengubah isi informasi verbal menjadi nonverbal memang agak
sulit. Namun, bila bahan simakan dapat ditelaah, hal itu bukan hal yang
tidak dapat dilakukan. Itulah sebabnya, kita perlu berlatih dengan saksama.
Cara pertama, simaklah isi informasi dengan penuh perhatian. Kedua,
setelah disimak, cobalah perhatikan: Apa isinya, bagaimana uraiannya, dan
dapatkah divisualisasikan.
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 12
Hal-hal yang perlu diperhatikan untuk mengalihkan atau mengubah
informasi verbal ke informasi nonverbal, adalah sebagai berikut.
1. Perhatikan dengan saksama isi informasi verbal yang ingin diubah.
2. Perhatikan data-data berupa lambang, satuan atau angka-angka serta
perbandingannya untuk menentukan bentuk visual yang efektif,
apakah grafk, tabel, diagram dan yang lainnya.
3. Catatlah hal-hal pokok atau inti dari informasi yang disimak.
4. Buatlah bentuk nonverbal yang tepat untuk mengungkapkan informasi
tersebut.
5. Gambar, bagan, atau grafk dibuat dengan baik, benar, tepat, dan
seimbang dengan isi.
6. Tentukan warna, lambang, atau bentuk untuk menggambarkan atau
membedakan data-datanya.
Perhatikan contoh perubahan informasi verbal menjadi informasi
nonverbal di bawah ini!
Contoh I.
Berdasarkan penghitungan suara sementara putaran pertama pemilu
Presiden 2004, Yudhoyono-Yusuf Kalla menempati urutan pertama dengan
perolehan suara sebanyak 35.687.602 atau 33,60% dari total perolehan
suara. Megawati-Hasyim menempati urutan kedua dengan perolehan
jumlah suara sebanyak 27.910.706 atau 26,27% dari total perolehan suara.
Urutan ketiga ditempati oleh Wiranto-Salahuddin dengan perolehan suara
sebanyak 23.583.501 atau 22,20% dari total perolehan suara. Urutan keempat
ditempati Amien Rais-Siswono dengan perolehan jumlah suara sebanyak
15.800.979 atau 14,08% dari total perolehan suara sedangkan duet Hamzah-
Agum menempati urutan terakhir.
Total perolehan suara yang telah terkumpul sampai 19 Juli 2004, pukul
21.00 adalah 106.228.247 orang.
Inti dari informasi verbal di atas, adalah sebagai berikut.
1. Informasi tentang penghitungan suara pemilu Presiden 2004.
2. Penghitungan suara sementara putaran pertama pemilu Presiden
2004 Yudhoyono-Kalla menempati urutan pertama pemilu dengan
perolehan suara sebanyak 35.687.602 atau 33,60%.
3. Megawati-Hasyim menempati urutan kedua dengan perolehan suara
27.910.706 atau 22,20%.
1J 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
4. Wiranto-Salahuddin berada di urutan ketiga dengan perolehan suara
23.583.501 atau 22,20%.
5. Amien-Siswono memperoleh jumlah suara 15.800.979 atau 14,80%.
6. Hamzah-Agum menempati urutan terakhir dengan jumlah perolehan
suara 3.253.014 atau 3,06%.
7. Total perolehan suara yang terkumpul sampai 19 Juli 2004 pukul 21.00
adalah 106.228.247 orang.
Bentuk informasi nonverbalnya berupa diagram seperti berikut.
Berdasarkan Penghitungan suara sementara putaran pertama pemilu Presiden 2004,
Yudhoyono-Yusuf Kala menempati urutan pertama dengan perolehan suara sebanyak
35.687.602 atau 33,60% dari total perolehan suara Megawati-Hasyim menempati urutan
kedua dengan perolehan jumlah suara sebanyak 27.910.706 atau 26,27% dari total perolehan
suara. Urutan ketiga diperoleh oleh Wiranto-Salahuddin dengan perolehan suara sebanyak
23.583.501 atau 22,20% dari total perolehan suara. Urutan keempat diperoleh Amien Rais-
Siswono dengan perolehan jumlah suara sebanyak 15.800.979 atau 14,08% dari total
perolehan suara sedangkan duet Hamzah-Agum menempati urutan terakhir. Urutan ketiga di
peroleh Wiranto-Salahuddin dengan perolehan jumlah suara sebanyak 3.245.459 atau 3,06%
dari total perolehan suara.
Total perolehan suara yang telah terkumpul sampai 19 Juli 2004, pukul 21.00 adalah
106.228.247 orang.
Inti dari informasi verbal di atas :
1. Informasi tentang penghitungan suara pemilu Presiden 2004.
2. Penghitungan suara sementara putaran pertama pemilu Presiden 2004 Yudhoyono-Kala
menempati urutan pertama pemilu dengan perolehan suara sebanyak 35.687.602 atau
33,60%.
3. Megawati-Hasyim menempati urutan kedua dengan perolehan suara 27.910.706 atau
22,20%.
4. Wiranto-Salahuddin berada diurutan ketiga dengan perolehan suara 23.583.501 atau
22,20%.
5. Amien-Siswono memperoleh jumlah suara 15.800.979 atau 14,80%.
6. Hamzah-Agum menempati urutan terakhir dengan jumlah perolehan suara 3.253.014 atau
3,06%.
7. Total perolehan suara yang terkumpul sampai 19 Juli 2004 pukul 21.00 adalah
106.228.247 orang.
Bentuk informasi nonverbalnya berupa diagram, yaitu:
Contoh II perubahan informasi verbal menjadi informasi nonverbal :
Contoh 2:
Perhitungan Suara Sementara Putaran Pertama
P E M I L U P R E S I D E N R I 2 0 0 4
Sampai Pukul 21.00 WIB
Yudhoyono-Yusuf Kalla (4)
35.745.198 (33,58%)
Megawati-Hasyim (2)
27.983.836 (26,29%)
Wiranto-Salahuddin (1)
23.645.484 (22,21%)
Amin Rais-Siswono (3)
15.826.526 (14,87%)
Hamzah-Agum (6)
3.253.014 (3,06%)
Total: 106.454.058 (100%)
Contoh II.
Vika, siswi Kelas 1 SMK, bercita-cita menjadi animator profesional.
Untuk itu, dia memilih sekolah di SMK jurusan Grafka. Selain sekolah dan
magang yang telah ditetapkan sebagai program sekolah, untuk menunjang
cita-citanya tersebut, dia mengikuti kursus komputer dan bahasa Inggris.
“Calon animator profesional” tersebut telah merencanakan setamat
pendidikan nanti, jika kondisi sangat memungkinkan, dia akan melanjutkan
sekolah ke perguruan tinggi. Jurusan yang akan diambilnya adalah desain
grafs. Jika keuangan keluarganya tidak memungkinkannya untuk kuliah,
dia akan kursus desain grafs saja. Akan tetapi, jika kedua keinginannya
tersebut tidak dapat terpenuhi, dia akan mengikuti balai latihan kerja
(BLK) terlebih dahulu sebelum terjun ke dunia kerja. Dengan mengikuti
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 14
BLK, Vika yakin akan mudah mendapat pekerjaan karena peserta pelatihan
di BLK akan disalurkan kerja sesuai dengan bidang keahliannya masing-
masing. Bila ikut pelatihan di BLK pun tidak memungkinkan karena kondisi
keuangan keluarganya, terpaksa dia langsung bekerja di mana saja dalam
bidang apa saja. Tekadnya, yang penting dia dapat menabung untuk dapat
meraih cita-citanya kelak.
Inti dari informasi di atas seperti berikut.
1. Vika bercita-cita menjadi animator profesional.
2. Vika memilih sekolah di SMK jurusan Grafka.
3. Tamat SMK, Vika berencana melanjutkan ke perguruan tinggi jika ada
biaya.
4. Jika biaya tidak memungkinkan, Vika mengikuti latihan balai kerja
(BLK).
Bentuk Informasi Nonverbal yang cocok dari informasi di atas adalah
bagan, yaitu:
15 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
C. Menyampaikan Pendapat melalui simpulan secara
deduktif dan induktif
Penyimpulan secara deduktif ialah cara mengambil simpulan dari
pernyataan yang bersifat umum diikuti oleh uraian atau pernyataan-
pernyataan yang bersifat khusus.
Perhatikan contoh berikut.
1. Negara adalah institusi mapan, tetapi dinamis sehingga mampu mengantisipasi
segala perubahan yang terjadi. Negara mewadahi seluruh kepentingan
masyarakat. Ia menyediakan kerangka umum yang bersifat abstrak
sehingga terbuka untuk ditafsirkan. Sementara pemerintah adalah
pranata kontemporer, sebagai penyelenggara negara dalam jangka
waktu yang ditetapkan oleh konstitusi negara.
2. Hasil perolehan suara sementara dari penyelenggaraan pemilu pemilihan
presiden tahun 2004 cukup signifkan. Peringkat pertama diraih oleh
pasangan Susilo Bambang Yudhoyono dan Jusuf Kalla dengan
persentase suara terbanyak, yaitu 33,60 persen. Peringkat kedua diraih
oleh pasangan Megawati dan Hasyim Muzadi dengan persentase
suara 22,20 persen. Disusul peringkat ketiga yaitu pasangan Wiranto
dan Salahudin. Selanjutnya peringkat keempat ialah pasangan Amin
Rais dan Siswono. Terakhir adalah pasangan Hamzah Haz dan Agum
Gumelar.
Penyimpulan secara induktif ialah cara mengambil simpulan dari
pernyataan-pernyataan atau fakta-fakta yang bersifat khusus menuju ke
suatu simpulan yang bersifat umum.
Perhatikan contoh berikut.
1. Penyair akan membuat sebuah puisi dengan cara menuangkan
imajinasinya, barulah tercermin sebuah puisi. Pengarang novel akan
merangkai ceritanya dengan pengembangan imajinasi. Demikian juga
seniman akan menggoreskan lukisan di dasar kain dengan imajinasinya
ke arah yang sebenarnya. Memang benar imajinasi itu diperlukan yang
mencipta suatu karya.
2. Plagiat ialah pengambilan atau penerjemahan sesuatu hasil begitu saja
dengan tidak menyebutkan pengarang asli melainkan menurunkan
nama sendiri sebagai pengarang. Plagiat tidak diperkenankan dalam
dunia sastra. Banyak karya sastra yang beredar merupakan karya
plagiat. Dalam dunia karya sastra memang terdapat larangan keras untuk
pengarang plagiat.
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 16
Menyampaikan simpulan dapat dilakukan secara lisan maupun tulisan.
Penyampaian harus menggunakan bahasa Indonesia yang baik dan benar.
Simpulan yang disampaikan dapat diperoleh dari informasi lisan maupun
tulisan baik informasi lisan yang bersifat verbal maupun informasi tulisan
yang berbentuk nonverbal. Simpulan dapat disertakan dengan opini atau
pendapat.
Opini adalah pandangan berdasarkan ideologi atau sikap seseorang
dalam memberikan suatu wawasan terhadap objek atau peristiwa. Opini
dapat juga disebut pendapat seseorang. Antonim dari opini adalah fakta.
Fakta bersifat objektif, merupakan kenyataan bersifat konkret dan dapat
dibuktikan kebenarannya.
Perhatikan tabel berikut.
Pendapat/Opini Fakta
1. Pemkab. dan PT. Jasa Marga
berusaha menuntaskan kesepa-
katan pembangunan fsik jalan
tol.
2. Jalan tol Gempol–Pasuruan di-
harapkan mampu mendorong
akselerasi pertumbuhan pereko-
nomian kawasan.
1. Harga tanah yang dibebaskan
ditetapkan Rp 80.000,- hingga
Rp 400.000 per meter persegi.
2. Di Gedung Grahadi Surabaya
dilangsungkan penandatanga-
nan kesepakatan bersama.
Simpulan yang di dalamnya terdapat opini dapat dilihat pada contoh
di bawah ini.
Contoh 1.
Vika bercita-cita menjadi animator profesional. Ia pun masuk ke SMK
Grafka. Di samping itu, ia juga mengikuti kursus komputer dan bahasa
Inggris. Untuk mencapai keinginannya itu, ia berencana setelah lulus
sekolah akan kuliah pada jurusan desain grafs. Jika tak mampu kuliah, ia
berencana kursus desain grafs atau mengikuti balai latihan kerja (BLK). Bila
tak memungkinkan, ia akan bekerja apa saja untuk mengumpulkan uang
biaya kuliah. Sungguh begitu kuatnya keinginan Vika dalam mengapai cita-
citanya sehingga segala kemungkinan jalan yang terbaik akan dia tempuh.
17 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
Contoh 2.
Niat Vika setelah lulus sekolah akan meneruskan kuliah ke jurusan
desain grafs. Jika tak bisa ia mau mencoba kursus desain grafs atau
masuk balai latihan kerja. Namun, jika pun tak bisa, ia kemungkinan akan
bekerja dulu dalam rangka mengumpulkan uang untuk biaya kuliah pada
jurusan yang sama. Saat ini pun ia masuk SMK jurusan Grafka. Semua itu
dilakukan atas dasar dorongan yang kuat untuk mencapai cita-citanya. Ia
bercita-cita menjadi animator profesional.
Contoh pertama ialah simpulan yang diuraikan secara deduktif dengan
penambahan opini atau pendapat di bagian akhir paragraf. Contoh kedua
ialah simpulan yang diuraikan secara induktif dengan penambahan kalimat
opini sebelum kalimat terakhir yang merupakan simpulan umum.
RANGKUMAN
A. Kegiatan Menyimak dan Memahami informasi Nonverbal
Menyimak adalah kegiatan menyerap informasi yang disampaikan
secara lisan dengan tidak sekedar menggunakan indera pendengaran
tapi juga berupaya menangkap isi atau pesan serta memahami makna
informasi yang disampaikan.
Ada beberapa macam cara menyimak, diantaranya adalah menyimak
intensif, menyimak ekstensif, menyimak diskriminatif, dan menyimak
untuk pemecahan masalah.
Informasi dapat berbentuk verbal dan nonverbal. Informasi verbal
ialah informasi berbentuk uraian atau penjelasan. Informasi nonverbal
ialah informasi berbentuk visual seperti grafk, diagram, tabel, bagan,
peta, denah, dan matriks.
B. Pengalihan informasi Verbal menjadi Nonverbal
Hal-hal yang perlu diperhatikan untuk mengalihkan informasi
verbal ke informasi nonverbal, yaitu:
1. Perhatikan dengan saksama isi informasi verbal yang ingin diubah.
2. Perhatikan data-data berupa lambang, satuan atau angka-angka serta
perbandingannya untuk menentukan bentuk visual yang efektif,
apakah grafk, tabel, diagram dan yang lainnya.
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 18
3. Catatlah hal-hal pokok atau inti dari informasi yang disimak.
4. Buatlah bentuk nonverbal yang tepat untuk mengungkapkan
informasi tersebut.
5. Gambar , bagan, atau grafk dibuat dengan baik, benar, tepat, dan
seimbang dengan isi.
6. Tentukan warna-warna, lambang, atau bentuk untuk menggambarkan
atau membedakan data-datanya.
C. Menyampaikan Pendapat melalui simpulan secara deduktif dan
induktif
Penyimpulan secara deduktif yaitu cara mengambil simpulan dari
pernyataan yang bersifat umum diikuti oleh uraian atau pernyataan-
pernyataan yang bersifat khusus.
Penyimpulan secara induktif yaitu cara mengambil simpulan dari
pernyataan-pernyataan atau fakta-fakta yang bersifat khusus menuju ke
suatu simpulan yang bersifat umum.
Simpulan yang disampaikan dapat diperoleh dari informasi lisan
maupun tulisan baik informasi lisan yang bersifat verbal maupun
informasi tulisan yang berbentuk nonverbal. Simpulan dapat disertakan
dengan opini atau pendapat.
TUGAs MANdiRi:
Mintalah salah seorang siswa membacakan wacana yang terdapat
di awal bab, sedangkan siswa lainnya menyimak. Setelah menyimak
lakukan hal berikut.
1. Catatlah pokok-pokok informasi.
2. Dari pokok informasi yang dicatat, buatlah informasi berbentuk
nonverbal !
3. Susunlah sebuah simpulannya secara deduktif atau induktif yang
disertakan opini Anda.
19 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
UJi KOMPETENsi
i. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Menyusun kesimpulan dengan cara induksi atau deduksi kita lakukan
bila membuat karangan
a. argumentasi
b. persuasi
c. narasi
d. eksposisi
e. deskripsi
2. Lukisan naik turunnya data yang berupa batang atau balok dan dipakai
untuk menekankan adanya perbedaan tingkat atau nilai dari berbagai
aspek disebut
a. grafk lingkaran
b. grafk batangan
c. grafk garis
d. bagan arus
e. bagan pohon
3. Informasi nonverbal diperlukan bila data informasi membutuhkan
a. perincian
b. penjelasan
c. visualisasi
d. persentase
e. alasan-alasan
4. Berikut ini yang termasuk perintah kerja tertulis, kecuali
a. memo
b. surat edaran
c. buku manual kerja
d. surat pengumuman
e. surat pengiriman barang
5. Gambaran informasi yang berbentuk garis-garis menaik dan menurun
disebut
a. grafk lingkaran d. diagram
b. denah e. tabel
c. peta
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 20
6. Semua pernyataan di bawah ini benar, kecuali
a. tabel ialah informasi lewat kata dan bilangan yang tersusun
b. tabel ialah informasi tanpa kalimat penjang dan tanda baca
c. membaca tabel memerlukan kecermatan dan kepekaan berpikir
d. tabel dapat merupakan sumber gagasan
e. tabel disusun setiap kita membuat karangan
7. Pernyataan-pernyataan berikut yang merupakan opini adalah
a. Menurut polisi insiden itu tidak menimbulkan korban.
b. Siswa tim PBB yang lalu.
c. Ketika kendaraan mereka melintas, bom yang ditempatkan di
pinggir jalan meledak.
d. Ledakkan itu menimbulkan lubang di jalan dan menghancurkan
jendela di kawasan pemukiman dekat markas pasukan AS.
e. Tentara AS sedang melakukan patroli sekitar pukul 21.30 saat
serangan terjadi.
8. Produksi beras impor dan pengadaan beras!
Pernyataan berikut sesuai dengan tabel tersebut, kecuali

1996 1999 2002 2004
Produksi padi
( juta ton kg )
Produksi Beras
( Juta ton )
Impor Beras
( Juta Ton )
Pengadaan Beras
( Juta Ton )
Produksi
Tahun
33.69
0.17
45.32
54.34
35.28
1.81
33.47
51.49 50.87
33.06
4.5
37.56 35.36
2.14
33.22
51.5
a. Makin tinggi produksi padi makin rendah impor beras.
b. Impor beras tertinggi terjadi pada kondisi beras tinggi.
c. Tingginya produksi beras seiring dengan tingginya pengadaan
beras.
d. Kondisi produksi beras paling tinggi justru pengadaan beras
terendah.
e. Impor pengadaan beras terjadi ketika terjadi pengadaan beras
terendah.
21 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
9. Paragraf yang dimulai dengan pernyataan yang khusus dan diikuti
penjelasan yang bersifat umum disebut
a. deduktif
b. induktif
c. sebab akibat
d. akibat sebab
e. induktif– deduktif
10. Pernyataan yang dimulai dengan pernyataan yang bersifat umum dan
diikuti penjelasan yang bersifat khusus disebut
a. induktif
b. deduktif
c. induktif-deduktif
d. deduktif-induktif
e. sebab akibat
11. Pernyataan di bawah ini yang tidak tepat adalah ....
a. mengungkapkan informasi dapat berbentuk verbal dan nonverbal
b. mendengar adalah bagian dari menyimak
c. mendengarkan sambil berkreatiftas dapat membantu mencapai
hasil yang baik dalam menyimak
d. menyimak adalah kegiatan menyerap informasi yang
didengarkan
e. proses menyimak adalah upaya memahami isi pesan dari informasi
yang didengarkan
12. Di bawah ini merupakan kegunaan tabel dan grafk, kecuali
a. menunjukkan fakta dengan jelas
b. menghemat waktu karena mempercepat komunikasi
c. menyatakan fakta-fakta dalam konteks
d. menyatakan fakta-fakta lebih tersamar
e. menunjukkan fakta-fakta itu lebih mudah
13. Bila ingin menggambarkan data berupa program kerja, biasanya kita
menggunakan
a. denah
b. peta
c. grafk
d. matriks
e. diagram
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 22
14. Gambar atau lukisan pada kertas yang menunjukkan letak tanah, laut,
sungai, gunung disebut
a. peta
b. matriks
c. denah
d. diagram
e. bagan
15. Gambaran buram sketsa istilah lain dari
a. diagram
b. bagan
c. peta
d. denah
e. tabel
16. Menyimak dianggap berhasil bila diukur dari hal berikut, kecuali
a. mengemukakan tanggapan sesuai dengan instruksi yang
disampaikan
b. dapat mengaktualisasikan informasi baik lisan maupun tulisan
c. membuat kesimpulan dengan menguraikan inti pokok informasi
yang disampaikan
d. memahami informasi yang didengarkan
e. dapat mengutarakan kembali informasi yang didengar dengan
makna yang sesuai
17. Menyimak pembacaan puisi, cerpen, termasuk jenis menyimak
a. ekstensif
b. intensif
c. diskriminatif
d. pemecahan masalah
e. apresiatif
18. Menyimak untuk memahami secara terperinci, teliti, dan mendalam
bahan yang disimak adalah jenis menyimak
a. untuk menghibur
b. apresiatif
c. untuk belajar
d. diskriminatif
e. untukmenilai
2J 8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ
19. Karangan/tulisan yang memerlukan analisis dan sintetis dapat ditulis
dalam bentuk
a. eksposisi
b. narasi
c. argumentasi
d. persuasi
e. deskripsi
20. Untuk mengambil kesimpulan dari informasi nonverbal diperlukan
hal-hal berikut, kecuali
a. perhatikan isi informasi
b. perhatikan kata-kata dan angka-angka
c. lihat model dan warna gambarnya
d. artikan hubungan antar–lambang atau angka
e. perhatikan antar–bagian-bagiannya.
ii. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Sebutkan langkah-langkah yang harus dilakukan agar dapat mengung-
kapkan kembali informasi yang disimak!
2. Jelaskan perbedaan informasi berbentuk verbal dan nonverbal!
3. Hak apa saja yang harus dilakukan agar menyimak mencapai hasil
yang baik?
4. Apa yang kamu ketahui tentang grafk?
5. Sebutkan macam-macam grafk!
6. Apa yang kamu ketahui tentang denah? Jelaskan!
7. Jelaskan perbedaan grafk dan peta!
8. Apa yang dimaksud paragraf deduktif?
9. Berikan masing-masing contoh informasi verbal dan nonverbal!
10. Jelaskan hal-hal yang perlu dipertimbangkan untuk mengalihkan
informasi verbal ke nonverbal!
8ahasa ÌndonesIa S|K/|AK Setara TIngkat |adya Kelas XÌ 24
25 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Kompetensi
Dasar
- Menyimak untuk memahami perintah yang diungkap-
kan atau yang tidak dalam konteks bekerja
Indikator
- Merumuskan kembali isi perintah (secara lisan maupun
tulisan)
- Menuliskan kembali isi perintah dalam bentuk
kerangka atau bagan
- Menyebutkan kegiatan yang akan dilakukan
berdasarkan isi perintah secara lisan/tertulis
- Mengonfrmasikan kebenaran rencana kegiatan yang
telah direncanakan dengan rencana pemberi perintah
Pada bab ini, kita akan mempelajari hal-hal yang berkaitan dengan perintah
kerja dari penjelasan mengenai pengertian serta ciri kalimat perintah, jenis-
jenis kalimat perintah, dan berbagai respons terhadap perintah. Tujuan
mempelajari bab ini ialah agar kita dapat memahami berbagai bentuk perintah
yang diungkapkan atau tidak serta dapat merumuskan, mencatat, dan
mengonfrmasikankembaliisiperintahdenganmembuatkerangkakegiatan
dan perencanaan sesuai kebenaran isi perintah kerja yang diberikan.

BAB 2
MENYIMAK UNTUK MEMAHAMI PERINTAH
YANG DIUNGKAPKAN ATAU YANG TIDAK
DALAM KONTEKS BEKERJA.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 26
Wacana
Sukses Memulai Karir bagi Pemula
Di dunia kerja memang berbeda dengan dunia pendidikan. Ketika
memasuki dunia kerja, sesungguhnya Anda baru tiba di dunia nyata tempat
Anda harus memulai hidup baru dan karir profesional Anda. Ibaratnya
Anda sedang berada di persimpangan, perjalanan selanjutnya mungkin
bisa menakutkan, menyenangkan, membingungkan, atau membuat Anda
bertanya-tanya. Bisa juga semua perasaan itu bercampur aduk menjadi
satu.
Saat ini, persaingan antar–perusahaan makin ketat. Persaingan
tenaga kerja untuk mendapatkan pekerjaan pun demikian. Makin
banyaknya tenaga kerja yang berkualitas menuntut Anda untuk secepatnya
menyesuaikan diri dengan tempat kerja baru. Jika tidak, Anda akan
tersingkir dan gagal untuk meniti karier yang diidamkan.
Karena itu, agar Anda bisa bertahan dengan pekerjaan yang akan
digeluti, sebaiknya Anda perlu mengetahui informasi seputar hari-hari
awal meniti karier. Berikut adalah strategi bagaimana Anda harus bersikap
selama 60 hari pertama di tempat kerja baru. Mungkin saja karier Anda
akan melesat dan berada di jalur cepat.
1. 14 Hari Pertama: Pengenalan Rekan-Rekan Kerja.
Untuk berhasil, diperlukan kombinasi antara performa dan kepribadian.
Supaya bisa diterima oleh lingkungan baru, sering-seringlah menghabiskan
waktu dengan rekan-rekan yang dapat memberi tahu kita peraturan-
peraturan informal di dalam perusahaan.
Pertama, dekati mereka-mereka yang akan sering Anda temui (misalnya,
teman satu departemen atau dari departemen lain yang mempunyai
hubungan erat dengan pekerjaan Anda), para pembuat keputusan (misalnya,
pimpinan proyek), dan orang-orang yang berpotensi menjadi mentor Anda.
Jangan ragu-ragu untuk menyediakan waktu makan siang dengan orang-
orang ini. Tujuannya tak lain adalah untuk mengetahui rule-of-the-game
yang berlaku di tempat baru tersebut, misalnya apa saja yang boleh dan
tidak boleh dilakukan. Dengan membangun hubungan, kepercayaan dan
informasi akan datang dengan sendirinya.
27 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
2. 30 hari pertama: Bertemu atasan, tanyakan apakah ada kemajuan
dalam pekerjaan Anda?
Kebanyakan orang yang diterima bekerja di tempat baru mengira
atasan mereka tahu persis apa saja kemajuan yang telah mereka alami.
Tentu saja sikap dan cara berpikir ini fatal karena atasan tidak selamanya
mengikuti perkembangan anak buahnya secara detail. Hal ini diperparah
oleh ketakutan kalau-kalau tugas kita dianggap tidak dikerjakan dengan
benar. Bagaimanapun juga atasan pasti ingin Anda sukses sebab kesuksesan
Anda secara tidak langsung akan berakibat positif pada dirinya. Karena itu,
jangan takut bertemu atasan untuk menanyakan penilaiannya atas kinerja
Anda.
3. 45 hari pertama: Tulis dan pahami deskripsi pekerjaan Anda.
Setelah satu setengah bulan di posisi baru, harusnya Anda sudah
tahu tanggung jawab apa saja yang harus Anda emban. Tulis pertanyaan-
pertanyaan yang terlintas di benak Anda di atas sebuah kertas, berikut
dengan dafar proyek-proyek yang telahAnda tangani. Kemudian, temui
atasan Anda dan diskusikan hal ini dengannya. Hal ini untuk menyamakan
persepsi Anda berdua tentang bagaimana menyelesaikan tugas-tugas di
posisi Anda yang dapat diterima oleh bos Anda.
4. 60 hari pertama: Selesaikan pekerjaan dengan baik.
Memang, Anda harus melakukan pekerjaan yang cukup sulit untuk
membuat orang lain terkesan. Namun, Anda harus berhati-hati. Pilih
proyek pekerjaan yang masuk akal dan bisa diselesaikan dengan tepat
waktu. Sebagai contoh, jangan pilih pekerjaan yang hanya Anda yang
terlibat karena hanya akan memakan waktu lebih lama dan mungkin tidak
akan mendapat dukungan dari atasan Anda. Ambilah proyek-proyek yang
melibatkan orang lain dalam tim Anda.
5. 60 hari kemudian: Penyegaran
Untuk melakukan hal ini, sebenarnya susah-susah gampang. Intinya
adalah berusaha melakukan hal yang sama (dengan semangat yang sama)
sebagaimana Anda bekerja di dua bulan pertama. Kemudian, buat kerangka
kerja berdasarkan landasan yang telah Anda ciptakan di 60 hari pertama
tersebut. Memperluas pergaulan hingga mempunyai banyak teman dari
perusahaan lain juga dapat menunjang usaha Anda. Ingatlah selalu bahwa
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 28
memberikan atau menerima feedback dan menentukan posisi Anda di kantor
adalah proses yang terus berlanjut, jadi jangan cepat puas!
(Sumber:Kompas,18 November 2007)
A. Pengertian dan Ciri Kalimat Perintah
Kalimat perintah adalah kalimat yang berisi perintah kepada orang lain
untuk melakukan sesuatu atau kalimat yang dipakai untuk mendapatkan
tanggapan sesuai dengan kehendak penuturnya.
Ciri-ciri kalimat perintah adalah seperti berikut.
1. Menggunakan partikel –lah.
Contoh:
1. Pergilah dari sini!
2. Cepatlah kamu mandi!
3. Bantulah adikmu!
2. Berpola kalimat inversi (PS).
Contoh :
1. Ambilkan buku itu!
2. Santaplah makanan itu!
3. Menggunakan tanda seru (!) bila digunakan dalam bahasa tulis.
Contoh:
1. Pergilah dari sini!
2. Ayo masuk!
3. Pulanglah!
4. Kalimat perintah jika dilisankan berintonasi menaik di awal dan
berintonasi rendah di akhir.
Contoh:

1. Bawa barang-barang itu kemari!

2. Selesaikan tugasmu!
B. Jenis-Jenis Kalimat Perintah
1. Kalimat Perintah Biasa
Contoh.
29 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
1. Masukkan barang-barang ini ke dalam bagasi mobil!
2. Antarkan surat ini kepada Pak RT sekarang juga!
2. Kalimat Perintah Ajakan
Contoh:
1. Marilah kita gunakan tekstil buatan dalam negeri demi menyukseskan
program pemerintah.
2. Ayolah bersenam pagi setiap hari agar badan kita menjadi sehat.
3. Kalimat Perintah Larangan
Contoh:
1. Jangan membuang sampah di sini.
2. Jangan dekati tempat itu.
4. Kalimat Perintah Permintaan/Larangan
Contoh:
1. Saya berharap Anda hadir di acara itu.
2. Saya minta kerjakan tugasmu tepat waktu.
5. Kalimat Perintah Permohonan
Contoh:
1. Saya mohon kamu bisa datang di acara pesta ulang tahunku.
2. Kami mohon kepada-Mu, ya Tuhan, tunjukkanlah jalan yang lurus
yang Engkau ridhoi.
6. Kalimat Perintah Pembiaran
Contoh:
1. Biarlah aku yang membawa barang itu.
2. Biarkan dia pergi sendiri.
7. Kalimat Perintah Sindiran
Contoh:
1. Maju kalau kamu berani.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 30
2. Ambil saja kado yang kauberikan kalau kau tidak malu
terhadapnya.
8. Kalimat Perintah yang Menuntut Proses atau Langkah Kerja
Contoh:
1. Urutlah dari nomor kecil hingga nomor yang besar.
2. Susunlah sehingga membentuk lingkaran penuh.
9. Kalimat Perintah yang Berbentuk Kalimat Berita
Contoh:
1. Hendaknya Anda bersedia menjadi pengurus kegiatan itu.
2. Terima kasih Anda tidak menolak untuk menjadi pembawa acara
pada malam reuni nanti.
Kalimat perintah beragam jenisnya mulai dari yang kasar sampai yang
halus. Bahkan karena halusnya sering orang tidak menyadari bahwa hal
tersebut berupa perintah.
Kalimat perintah dapat diperhalus dengan menggunakan unsur-unsur
berikut.
1. Menggunakan kata-kata seperti mohon, tolong, sudilah, harap, silakan,
hendaknya,sebaiknya.
Contoh:
1. Mohon kembalikan buku itu di meja saya.
2. Silakan masuk.
3. Tolong buatkan kopi untuk Ayah.
4. Hendaknya kamu pulang sekarang.
5. Harap datang tepat waktu
6. Sebaiknya cepat bawa adikmu ke rumah sakit.
7. Sudilah Anda membantu saya menyelesaikan tugas ini.
2. Menggunakan partikel –lah.
Contoh:
1. Berangkatlah lebih halus daripada berangkat.
31 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
3. Pengubahan ke struktur tanya.
Contoh:
− Apakah tidak ada petugas piket yang menghapus papan tulis?
4. Pengubahan ke struktur berita.
Contoh:
− Panitia sangat gembira jika Bapak/Ibu berkenan hadir pada acara
perpisahan.
C. Berbagai Respons terhadap Perintah
Sejalan dengan bervariasinya kepentingan manusia terhadap
manusia yang lain sebagai wujud dinamika hubungan antar–manusia,
bentuk-bentuk perintah pun sudah menjadi suatu hal yang pasti dan selalu
ditemui. Hanya dalam skala umum perintah yang biasa yang langsung
bisa ditanggapi. Namun, sebenarnya pada lingkungan kalangan tertentu,
bahasa perintah perlu dicermati karena belum tentu dipahami sebagai
perintah biasa, seperti di dunia kerja. Dalam dunia kerja, bentuk-bentuk
perintah umumnya bersifat operasional kerja sehingga perintah tidak serta-
merta bisa secara langsung dilaksanakan. Banyak ragam kalimat perintah
menunjukkan banyaknya bentuk perintah yang diwujudkan melalui simbol
bahasa. Sebagai alat komunikasi, tentu bahasa harus dapat menerjemahkan
segala bentuk keinginan dan pilihan pemakainya, termasuk keinginan
mendapatkan respons dari sebuah perintah yang disampaikan baik secara
lisan maupun tertulis. Oleh karena itu, kita perlu mencermati dan mengenal
bentuk-bentuk perintah agar respons yang dilakukan tidak menyimpang
dari isi perintah.
Langkah yang perlu kita tempuh dalam menanggapi perintah adalah
sebagai berikut.
(1) Membaca kembali isi perintah secara hati-hati, teliti, dan saksama.
(2) Merumuskan/menuliskan kembali isi perintah.
(3) Isi perintah ditulis dalam bentuk kerangka/bagan sehingga mudah
dipahami.
(4) Membuat perencanaan dalam bentuk kerangka/tabel/bagan segala
kegiatan yang akan dilakukan dalam rangka memenuhi perintah.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 32
(5.) Memintakonfrmasikepadapemberiperintahakanketepatanrencana
kegiatan yang telah disusun.
Perhatikan dengan cermat proses menerima perintah kerja di bawah
ini dan respons yang dilakukan.
Dalam rangka memperingati HUT SMK Nusantara 1 Bumiayu,
Pembina OSIS mengumpulkan beberapa pengurus OSIS. Kemudian, beliau
menjelaskan bahwa OSIS akan mengadakan pentas seni dan bazar untuk
merayakan Hari Ulang Tahun ke-20 Sekolah. Beliau melanjutkan:
”Dalam rangka HUT sekolah kita, OSIS akan mengadakan kegiatan
Pentas Seni dan Bazar. Saya minta seluruh pengurus OSIS terlibat me-
nyukseskan acara ini. Berhubung masih ada waktu satu bulan, saya ingin
Ketua OSIS dan pengurus seksi mulai mempersiapkan segala sesuatunya,
seperti membuat kepanitiaan lalu menyusun rencana kerja dan struktur
kerja. Saya berharap seminggu sebelum acara, semuanya sudah siap. Jika
diperlukan, kalian bisa bekerja sama dengan sponsor atau dunia usaha
yang menjadi anggota majelis sekolah kita untuk membantu pendanaan
dan penyediaan barang buat bazar. Segala hal yang masih belum jelas dapat
dikonfrmasikan kepada saya. Mulai saat ini, kita saling berkomunikasi
untuk mempersiapkan segalanya hingga menjelang pelaksanaan acara.
Demikian pertemuan kita, selamat bekerja!
1. Pengurus OSIS mencatat isi instruksi/perintah Pembina OSIS sebagai
berikut.
a. Membuat kepanitiaan kegiatan bazar-amal.
b. Membuat proposal kegiatan.
c. Membuat jadwal kegiatan.
d. Membuat bagan atau struktur kerja.
e. Menghubungi pihak yang terkait dengan kegiatan.
f. Menggalang dana dengan menghubungi sponsor untuk meminta
dukungan.
g. Sosialisasi kegiatan kepada siswa dan komite sekolah.
h. Klarifkasidankonfrmasi.
33 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
2. Ketua OSIS dan sekretaris menyusun jadwal kerja.
No. Nama Kegiatan
Minggu
Keterangan
1 2 3 4
1. Rapat pembentukan panitia
2. Pembuatan proposal
3. Sosialisasi ke seluruh siswa
4. Menghubungi sponsor
5. Pertemuan dengan sponsor
6. Evaluasi
3. Agar proses kerja berjalan lancar, dibuat pula struktur atau prosedur
kerja yang mengatur:
(1) siapa mengerjakan apa,
(2) siapa bekerja sama dengan siapa,
(3) siapa bertanggung jawab terhadap pekerjaan apa dan kepada
siapa, dan
(4) garis hubungan kerja dan wewenang yang jelas.
Semua hal tersebut dapat divisualisasikan dalam bentuk bagan seperti
di bawah ini.
d. Ketua OSIS beserta panitia kegiatan mengkonfirmasikan
Sponsor
Seksi-Seksi
Pembina
OSIS
Ketua Panitia
Siswa
Ketua OSIS
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 34
4. Ketua OSIS beserta panitia kegiatan mengonfrmasikan informasi
perintah kepada pembina OSIS dengan mengajukan beberapa
pertanyaan berkaitan dengan persiapan dan perencanaan yang sudah
dan akan dilakukan agar langkah kerja tidak menyimpang.
Pertanyaanuntukkonfrmasidapatsepertiberikut.
(1) Apakah yang sudah dilakukan sesuai dengan perintah?
(2) Apakah semua rencana sesuai dengan harapan?
(3) Siapa saja yang akan diundang?
(4) Berapa banyak sponsor yang akan dilibatkan?
(5) Biaya yang disiapkan sudah cukup atau kurang?
(6) Acara sesuai dengan tema?
(7) Dan sebagainya.
RANGKUMAN
A. Pengertian dan Ciri Kalimat Perintah
Kalimat perintah adalah kalimat yang berisi perintah kepada
orang lain untuk melakukan sesuatu atau kalimat yang dipakai untuk
mendapatkan tanggapan sesuai dengan kehendak penuturnya.
Ciri-ciri kalimat perintah:
(1) Menggunakan partikel –lah
(2) Berpola kalimat inversi (PS)
(3) Menggunakan tanda seru (!) bila digunakan dalam bahasa tulis
(4) Kalimat perintah jika dilisankan berintonasi menaik di awal dan
berintonasi rendah di akhir
B. Jenis-Jenis Kalimat Perintah
(1) Kalimat perintah biasa
(2) Kalimat perintah ajakan
(3) Kalimat perintah larangan
(4) Kalimat perintah permintaan
(5) Kalimat perintah permohonan
(6) Kalimat perintah pembiaran
(7) Kalimat perintah sindiran
(8) Kalimat perintah yang menuntut proses atau langkah kerja
(9) Kalimat perintah yang berbentuk kalimat berita
35 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Kalimat perintah dapat diperhalus dengan menggunakan unsur-
unsur berikut.
(1) Menggunakan kata-kata seperti mohon,tolong,sudilah,harap,silakan,
hendaknya,sebaiknya.
(2) Menggunakan partikel –lah.
(3) Pengubahan ke struktur tanya.
(4) Pengubahan ke struktur berita.
C. Berbagai Respons Terhadap Perintah
Langkah yang perlu kita tempuh dalam menanggapi perintah:
(1) Membaca kembali isi perintah secara hati-hati, teliti, dan saksama.
(2) Merumuskan/menuliskan kembali isi perintah.
(3) Isi perintah ditulis dalam bentuk kerangka/bagan sehingga mudah
dipahami.
(4) Membuat perencanaan dalam bentuk kerangka/tabel/bagan segala
kegiatan yang akan di lakukan dalam rangka memenuhi perintah.
(5) Meminta konfrmasi kepada pemberi perintah akan ketepatan
rencana kegiatan yang telah disusun.
TUGAS KELOMPOK
Bentuklah kelompok terdiri atas 4-5 orang. Anggap saja setiap
kelompok diperintahkan oleh pembina OSIS/kepala sekolah untuk
melaksanakan kegiatan (penentuan jenis kegiatan diserahkan pada
kelompok). Lalu, setiap kelompok melakukan langkah-langkah berikut.
1. Rumuskanlah hal-hal yang akan dilakukan oleh tim kerja!
2. Susunlah agenda atau jadwal kerja panitia!
3. Buatlah struktur kerja berbentuk bagan!
4. Susunlahdafarpertanyaanuntukkonfrmasi!
5. Presentasikanlah di depan kelas semua langkah kerja tersebut!
Kelompok lain mengomentari.
( Ilustrasi bisa dikembangkan di luar sekolah, misalnya di lingkungan
RT, RW, atau kantor)
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 36
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Jangan mencontek ketika ulangan!
Kalimat di atas merupakan contoh kalimat perintah
a. permintaan
b. larangan
c. perintah biasa
d. permohonan
e. harapan
2. Dengan hormat, kami mohon hadirin tenang!
Perintah lisan pada kalimat di atas merupakan kalimat
a. perintah biasa
b. permohonan larangan
c. ajakan
d. permintaan
e. pemberitahuan
3. Berikut ini merupakan contoh kalimat perintah, kecuali
a. Kerjakan soal ini sebaik-baiknya!
b. Tolong sampaikan kepadanya, bahwa ia boleh datang besok!
c. Siapa yang mengatakan hal itu?
d. Letakkan buku-buku itu di atas meja!
e. Laporkan segera anggaran pengeluaran bulan ini!
4. Kalimat perintah yang berbentuk kalimat berita
a. biarlah dia bersamaku
b. saya harap Anda datang tepat waktu
c. jangan ada yang pergi dari sini
d. hendaknya ada yang mengoordinasi kegiatan ini
e. sebaiknya kami pulang sekarang
5. Berikut ini adalah ciri-ciri kalimat perintah, kecuali
a. intonasi keras (terutama perintah biasa dan larangan)
b. kata kerja yang mendukung isi perintah itu biasanya merupakan
kata dasar
c. memakai intonasi tanya
37 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
d. mempergunakan partikel penghalus -lah.
e. berbentuk perintah
6. Kalimat perintah sindiran
a. Terima kasih Anda tidak menolak.
b. Saya mohon Anda mengoordinasi sumbangan ini.
c. Hendaknya Saudara pikirkan penawaran ini.
d. Pulanglah kamu sekarang.
e. Sudikah Anda mampir ke rumahku?
7. Kalimat perintah berpola kalimat inversi (P-S)
a. Diamlah, jangan berisik!
b. Simpanlah dokumen ini!
c. Makanlah hidangan ini!
d. Harap wakili saya pada rapat besok!
e. Bersihkan tempat ini!
8. Kalimat perintah himbauan di bawah ini adalah
a. Sebaiknya, uang itu dikembalikan.
b. Bantulah aku dalam mengerjakan tugas ini!
c. Lestarikan budaya bersih.
d. Jagalah kelestarian lingkungan kita.
e. Janganlah kauganggu adikmu !
9. Tujuan kalimat perintah adalah
a. untuk mendapatkan respons berupa jawaban
b. untuk mendapatkan informasi
c. mendapatkan respons berupa tindakan
d. menyampaikan keinginan
e. untuk mendapatkan inspirasi
10. Yang termasuk contoh perintah ajakan terdapat pada kalimat
a. Lebih baik kamu berbisnis dalam bidang otomotif.
b. Sebaiknya kita istirahat dahulu.
c. Marilah kita bernyanyi bersama-sama.
d. Kita berhenti di sini saja.
e. Tidurlah, hari sudah malam.
11. Kalimat perintah pembiaran adalah
a. Sudahlah, aku mau pergi.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 38
b. Marilah kita lanjutkan pekerjaan.
c. Biarkan buku itu di mejaku.
d. Saya minta kalian belajar sungguh-sungguh.
e. Pergilah sekarang.
12. Langkah yang dapat ditempuh dalam menanggapi perintah
kecuali
a. merumuskan kembali isi perintah
b. isi perintah dituliskan berbentuk kerangka
c. mengecek kebenaran kegiatan yang akan dilaksanakan, apakah
sesuai perintah
d. membuat perencanaan dalam bentuk karangan
e. membuat perencanaan dalam bentuk kerangka/bagan
13. Ambillah bagian paling bawah hingga atas.
Kalimat di atas merupakan contoh kalimat perintah
a. berbentuk berita
b. yang memutus proses kerja
c. pembiaran
d. ajakan
e. himbauan
14. Kalimat di bawah ini yang merupakan kalimat perintah biasa adalah.
a. Per langkah!
b. Antarkan surat ini ke Pak RT.
c. Ayolah, kita bersenam pagi agar tubuh kita sehat.
d. Sebaiknya Bapak memakai helm demi keselamatan berkendara.
e. Marilah kita gunakan tekstil dalam negeri.
15. Kalimat perintah berikut yang dikategorikan kalimat perintah
halus
a. Sudilah Anda mampir ke rumahku.
b. Sebaiknya telepon ia sekarang.
c. Tidurlah, hari sudah malam.
d. Makanlah hidangan ini.
e. Cepat pergi dari sini!
16. Contoh kalimat perintah ajakan
a. Marilah ketetanggamu kalau kauberani.
b. Kami berharap Anda datang tepat waktu.
39 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
c. Tempat ini bukan untuk membuang sampah.
d. Saya mohon kamu segera melunasi utangmu.
e. Bawa oleh-oleh ini untuk nenekmu.
17. Kalimat perintah dengan nada bersahabat
a. Ambillah kembali kado yang kauberikan kalau kamu tidak mau.
b. Kami mohon Anda bersedia bekerja di sini.
c. Kami sangat berterima kasih bila Anda membuang sampah pada
tempatnya.
d. Anda diminta kesediaannya menjadi pembawa acara pada malam
reuni nanti.
e. Pulanglah kamu sekarang.
18. Kalimat perintah yang berkesan harapan adalah
a. Saya ingin Anda belajar dengan semangat!
b. Hadirin saya minta berdiri!
c. Semuanya saya sarankan kembali ke kelas.
d. Hapuslah papan itu!
e. Katakan dengan sejujurnya!
19. Tabunglah uangmu untuk simpanan hari tua.
Kalimat perintah yang sepadan dengan kalimat di atas ialah
a. Belajarlah hingga akhir hayatmu!
b. Pelajari halaman 10, besok ulangan!
c. Kerjakanlah soal ini sampai selesai!
d. Hendaknya seorang anak berbakti kepada orang tua!
e. Pergilah segera, nenekmu sudah menunggu!
20. Di bawah ini yang bukan perintah berisi nasihat ialah
a. Berhati-hatilah selama dalam perjalanan!
b. Mimpi indahlah dalam tidurmu!
c. Simpanlah baik-baik surat wasiat ini!
d. Jagalah bicaramu di mana saja kauberada.
e. Hendaknya selalu waspada dalam segala suasana.
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Jelaskan pengertian kalimat perintah!
2. Sebutkan ciri-ciri kalimat perintah!
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 40
3. Buatlah dua contoh kalimat berita dan ubahlah menjadi kalimat
perintah!
4. Buatlah contoh kalimat perintah sindiran!
5. Sebutkan langkah-langkah yang ditempuh dalam menanggapi perintah
agar respons yang dilakukan tidak menyimpang dari isi perintah!
6. Buatlah contoh kalimat perintah pembiaran!
7. Buatlah contoh kalimat perintah himbauan!
8. Buatlah contoh kalimat perintah berpola inverse!
9. Buatlah contoh kalimat perintah larangan!
10. Buatlah kalimat perintah dengan nada bersahabat!
41 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Kompetensi
Dasar
- Memahami perintah kerja tertulis
Indikator
- Mengenali informasi yang berkaitan dengan budaya
kerja yang berlaku di tempat kerja
- Merencanakan tindak lanjut perintah berdasarkan
catatan yang dibuat pada waktu membaca informasi
dari perintah kerja tertulis
- Membuat bagan/prosedur kerja berdasarkan perintah
kerja tertulis
- Mengonfrmasikan rencana kegiatan yang akan
dilakukan (secara lisan/tulisan) kepada pemberi
perintah
Bab ini masih membahas perintah kerja, namun lebih khusus kepada perintah
kerja berbentuk surat-surat resmi atau surat dinas, seperti surat edaran,
surat perintah, atau surat tugas, memorandum, disposisi, dan perintah kerja
berbentuk manual. Sebagaimana pelajaran sebelumnya, pada pelajaran ini,
kita diharapkan mampu menindaklanjuti perintah kerja dengan membuat
perencanaan,prosedurkerja,sertadapatmengonfrmasikanisiperintahkerja
kepada pemberi perintah.

BAB 3
MEMAHAMI PERINTAH KERJA TERTULIS
DALAM KONTEKS BEKERJA
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 42
Wacana
Beli Sekarang, Bayar Nanti
Kapan orang mulai berhutang-piutang? Jangan kaget, sekitar 3.000
tahun lalu masyarakat Babilonia dan Mesir telah melakukan praktik utang
atau kredit atas sesuatu yang ingin dimiliki. Pada tahun 1730, Christopher
Thorton adalah orang pertama yang memasang iklan penjualan perabot
rumah yang biasa dibayar pada akhir minggu. Inilah konon iklan pertama
untuk pembelian secara kredit.
Awalnya, kartu kredit adalah penerus berbagai program kredit
pedagang. Kartu kredit pertama kali digunakan pada tahun 1920 di
Amerika Serikat, untuk menjual bahan bakar ke sejumlah pemilik mobil.
Tahun itu pula, di Negeri Paman Sam, ada sebuah toko pecah belah yang
menggunakan sistem “Beli Sekarang, Bayar Nanti”. Cara ini kemudian
banyak ditiru pada tahun 1938, beberapa perusahaan mulai menerima
kartu-kartu lainnya, yang hakikatnya menunda pembayaran.
Konsep pembayaran menggunakan kartu kredit ditemukan pada tahun
1950, yakni dioperasikannya charge card oleh Dinners Club, yang mencatat
biaya yang dikeluarkan pelanggan atas permintaan penerbit kartu. Seluruh
rekening dibayarkan pada setiap datangnya laporan rekening. Langkah ini
diikuti American Express. Inilah “Uang Plastik” pertama.
Setahun kemudian, 1951, Dinners Club melepaskan kartu kredit
pertama kepada 200 orang pelanggannya, yang bisa digunakan pada 27
rumah makan di New York. Pada tahun 1958, Bank of America menciptakan
BankAmericard, produk yang akhirnya berevolusi menjadi sistem Visa.
Mastercard muncul pada tahun 1966 ketika sekelompok bank penerbit
kartu membentuk MasterCharge.
Kartu kredit dikeluarkan setelah ada persetujuan dari penerbit kartu
(biasanya bank umum). Dengannya, nasabah bisa menggunakan transaksi
pembelian sampai batas kredit tertentu. Setiap kali transaksi pembelian,
penggunaan kartu menandatangani resi berupa catatan data kartu dan
jumlah yang dibayarkan. Melalui sistem verifkasi elektronik, yang
memeriksa strip bahan magnetis berisi data, kartu dinyatakan valid dan
pemegang kartu dianggap memiliki cukup kredit untuk menutup biaya
pembelian.
Beberapa cara lain dikembangkan, misal melalui telepon dengan hanya
mengutip nomor kartu kredit yang dicetak embossed (timbul) pada kartu.
43 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Cara ini bisa pula untuk melakukan pembayaran via internet, bahkan lewat
pos. Ini lazim disebut “transaksi tanpa kartu”. Agar aman, beberapa bank
memberi nomor sekali pakai untuk setiap transaksi. Kartu kredit semacam
ini merebak di kalangan menengah negara-negara Barat.
Soal keamanan kartu menjadi kelemahan sistem ini. Penerbit kartu
berusaha keras agar kerugian akibat penipuan dan biaya pencegahan
penipuan diminimalkan. Celakanya, tercipta pasar gelap bagi nomor
kartu kredit curian, yang harus langsung dipakai sebelum diendus pihak
berwajib. Karenanya, dibuat tiga perbaikan keamanan kartu kredit. Pertama,
sistem verifkasi online, yakni nomor indentifkasi pribadi (PIN) diadikan
empat digit. Kedua, kartunya diganti smart card, yang dampak sama tetapi
antipenipuan. Ketiga, untuk transaksi tanpa kartu, ditambahkan kode 3
atau 4 digit di belakang kartu.
Indonesia, yang mengenal kartu kredit sejak 1985, justru jadi fukos
dunia lantaran penipuan kartu kredit via internet yang dilakukan segelintir
anak muda. Pemalsuan kartu kredit pun merebak. Untunglah, pada tanggal
6 Juni 2004 Pengadilan Negeri Gianyar memvonis 2,8 tahun penjara, disusul
Pengadilan Negeri Denpasar pada tanggal 14 September 2004 mengganjar
3 tahun penjara terhadap seorang terdakwa pemalsuan kartu kredit, Benny
Wong.
Kini, hampir 6 juta kartu kredit beredar di seantero Nusantara, dengan
pertumbuhan sebesar 20-30 % per tahun.
(Sumber : Majalah Intisari, Agustus 2005)

A. Mengenal Bentuk Perintah Kerja Tertulis
Banyak bentuk aturan atau petunjuk yang dapat ditemukan dalam
kehidupan kita. Baik di lingkungan rumah tangga, sekolah, masyarakat,
di tempat pekerjaan, maupun dalam kehidupan berbangsa dan bernegara.
Bentuk perintah dapat disampaikan secara lisan ataupun tertulis. Perintah
lisan biasanya menuntut respon/tindakan langsung sehingga muncul
variasi kalimat perintah, sedangkan bentuk perintah tertulis umumnya
bersifat tidak langsung.
Dalam dunia kerja, perintah sudah menjadi bagian keseharian dalam
proses kerja sekaligus menjadi jaminan keberlangsungan kerja yang diwarnai
oleh pola hubungan manusia secara hierarki. Perintah sering menjadi
acuan pekerjaan, bahkan roda penggerak agar manusia selalu melakukan
pekerjaan karena perintah itu sendiri adalah awal tindakan atau pedoman
kerja. Dalam budaya kerja, perintah dapat dimanifestasikan dalam bentuk
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 44
instruksi, petunjuk, dan pedoman. Karena pekerjaan berkaitan dengan
administrasi dan dokumentasi, bentuk petunjuk dan pedoman lebih banyak
diwujudkan secara tertulis dalam bentuk surat.
Berdasarkan jenisnya, bentuk perintah tertulis dapat dibedakan
menjadi:
(1) himbauan/larangan, misalnya himbauan menjadi akseptor RB, larangan
membuang sampah;
(2) petunjuk, misalnya petunjuk penggunaan suatu barang;
(3) Peraturan, misalnya peraturan berlalu lintas, peraturan waktu
berkunjung;
(4) pedoman, misalnya pedoman penulisan karya ilmiah;
(5) undang-undang, misalnya undang-undang tentang penyalahgunaan
narkoba, undang-undang pendidikan.
B. Model-Model Surat Berisi Perintah Kerja
Surat adalah suatu alat atau sarana komunikasi tertulis. Surat dipandang
sebagaialatkomunikasitertulisyangpalingefsien,efektif,ekonomis,dan
praktis. Selain itu, surat juga berfungsi sebagai alat bukti tertulis, alat bukti
historis, alat pengingat, duta organisasi, dan pedoman kerja.
Surat yang berhubungan dengan pekerjaan disebut surat dinas atau
surat resmi. Surat ini umumnya berisi informasi, ketentuan, atau perintah
kerjayangdapatdiadikanpedomanbagikaryawanpadasuatulembaga,
instansi, atau perusahaan. Model surat yang berisi informasi kerja atau
perintah kerja, antara lain surat perintah, surat edaran, memorandum,
pengumuman, dan disposisi.
1. Surat Perintah
Surat perintah adalah surat yang berisi perintah dari pimpinan kepada
bawahan yang berisi petunjuk yang harus dilakukannya. Surat perintah
berlaku sementara dan berakhir setelah tugas yang diperintahkannya selesai
dilaksanakan serta melaporkan hasil pekerjaan tersebut kepada pimpinan.
Surat perintah terdiri atas:
(1) kepala surat
(2) pembukaan
(3) isi surat perintah
d. kaki surat/bagian akhir surat
45 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Contoh surat perintah pada instansi swasta.
HARIAN UMUM PEDOMAN
Jalan Teratai 13
Bekasi
===============================================================
SURAT PERINTAH
Nomor : ...................
Dasar : 1. Dalam rangka peningkatan sumber daya
manusia
2. Surat Pemimpin Redaksi Harian Umum
Pedoman No. 346 P-76/KEP/1994 tanggal
...........................
Pertimbangan : Untuk peningkatan sumber daya manusia dalam
menyongsong era globalissi, untuk hal tersebut
di atas perlu dikeluarkan surat perintah.
MEMERINTAHKAN :
Kepada : Nama : ..............................................
Pangkat : ..............................................
Jabatan : ..............................................
Alamat : ..............................................
Untuk : 1. Terhitung tanggal 12 Juni 1996, di samping
tugas pokok yang telah ada, Saudara diperin-
tahkan untuk melaksanakan kewajiban/peker-
jaan sebagaimana tercantum dalam lampiran
surat perintah ini.
2 Agar pelaksanaannya dialankan dengan se-
baik-baiknya dengan penuh rasa tanggung-
jawab.
Dikeluarkan di : Bekasi
Pada tanggal : 3 Juni 1996
Pemimpin Redaksi
Harian Umum Pedoman
td

Ir. Ereng Sarindat

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 46
2. Surat Edaran
Surat edaran adalah surat pemberitahuan tertulis yang ditujukan kepada
pejabat/pegawai. Surat edaran ini berisi penjelasan mengenai sesuatu hal,
misalnya kebiakan pimpinan, petunjuk mengenai tata cara pelaksanaan,
atau peraturan perundang-undangan.
Ada dua macam bentuk dan sifat surat edaran, yaitu surat edaran
umum dan surat edaran khusus. Surat edaran umum ditujukan kepada
orang banyak atau umum. Surat edaran khusus ditujukan kepada orang-
atau pejabat tertentu dan seperti surat dinas biasa.
Surat edaran terdiri atas unsur-unsur berikut.
(1) Kepala surat edaran bertuliskan nama perusahaan dan identitasnya.
(2) No, hal, lampiran, tanggal surat, dan alamat tujuan surat.
(3) Perkataan ”Edaran” biasanya ditulis di tengah
(4) Isi surat edaran: Salam pembuka, isi surat, dan penutup surat
(5) Kaki surat: salam penutup serta nama penanggung jawab surat
edaran.
Contoh surat edaran bersifat umum
Contoh surat edaran bersifat umum:
SDȱȱRAGAJAYAȱ
KEC.ȱBOJONGGEDEȬKAB.ȱBOGORȱ
ȱ
ȱ
Nomorȱ :ȱ421/ED/’07ȱ ȱ ȱȱȱȱȱȱȱȱȱȱ ȱȱȱȱȱȱȱȱȱȱ ȱȱȱȱȱȱȱȱȱȱBojonggede,ȱ19ȱDesemberȱ2007ȱ
Lampȱ :ȱȬȱ
Halȱ :ȱPenggantianȱBukuȱLaporanȱPendidikanȱ
ȱ
Yth.ȱBapakȱ/IbuȱorangȱtuaȱmuridȱSDȱRAGAJAYAȱ
diȱtempatȱ
SURATȱEDARANȱ
No.ȱ421/SD/’07ȱ
ȱ
SehubunganȱadanyaȱperubahanȱkurikulumȱSD,ȱdariȱKurikulumȱ2004ȱmenjadiȱ
Kurikulumȱ Tingkatȱ Satuanȱ Pendidikanȱ (KTSP),ȱ bukuȱ laporanȱ hasilȱ belajarȱ siswaȱ
digantiȱuntukȱmenyesuaikanȱkurikulumȱyangȱbaru.ȱDalamȱrangkaȱpengadaanȱbukuȱ
laporanȱ yangȱ baru,ȱ setiapȱ siswaȱ diwajibkanȱ membayarȱ Rp.ȱ 20.000.ȱ Pembayaranȱ
palingȱlambatȱsampaiȱtanggalȱ14ȱJanuariȱ2008.ȱ
ȱ
Demikianlahȱ suratȱ edaranȱ kami,ȱ semogaȱ Bapak/Ibuȱ orangȱ tuaȱ muridȱ dapatȱ
memakluminya.ȱAtasȱperhatiannya,ȱkamiȱucapkanȱterimaȱkasih.ȱ
ȱ
ȱȱȱȱKepalaȱsekolah,ȱ
ȱ
Tembusan:ȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱȱGunturȱSangaji,ȱS.Pd.ȱ
ȬȱPengurusȱKomiteȱSekolahȱ
47 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Contoh surat edaran bersifat khusus :
Contoh surat edaran bersifat khusus :
DEPARTEMEN PENDIDIKAN DAN KEBUDAYAAN
SEKOLAH MENENGAH KEJURUAN
BINA MULYA II MALANG
EDARAN
572/33/05
Hal : Pekan Seni 29 Desember 2004
Yth : Para Guru / Karyawan
SMK Bina Mulya II
Malang
Sesuai dengan surat keputusan No. 21/12/05 tertanggal 27 Oktober 2004 tentang
Pekan Seni, dengan ini kami beri tahukan bahwa dalam rangka persaudaraan antar
SMK kota Malang maka diadakan Pekan Seni berlangsung pada tanggal 3 Januari
sampai dengan 7 Januari 2005.
Sehubungan dengan hal tersebut diatas, dengan ini kamu ajukan agar selama
Pekan Seni, saudara memakai kemeja batik pada waktu dinas, kecuali bagi petugas
keamanan.
Atas perhatian saudara, kami ucapkan terima kasih.
Kepala Sekolah,
Drs. Laksana Muria
3. Surat Pengumuman
Pengumuman berasal dari kata ”umum”, mendapatkonfks pe-an dan
bunyi sengau ng. Kata dasar umum mempunyai arti seluruh atau orang
banyak. Mengumumkan berarti memberitahukan atau memaklumkan.
Pengumuman berarti pemberitahuan kepada orang banyak tentang
sesuatu masalah, agar diketahui dan dilaksanakan oleh orang banyak
yang berkepentingan. Berdasarkan sifat dan asalnya, pengumuman dapat
dibedakan menjadi tiga, yaitu seperti berikut.
(1) Pengumuman lisan, yaitu disampaikan secara oral komunikasi,
penyampaiannya dapat melalui pesawat telepon atau pengeras suara
(sound system).
(2) Pengumuman tertulis, yaitu pengumuman dalam bentuk tulisan, yang
disampaikan melalui telegram, surat kawat, telex, surat kabar, majalah,
papan pengumuman, dan lain-lain.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 48
(3) Pengumuman dari instansi dan surat pengumuman bukan dari
instansi.
Surat pengumuman merupakan surat yang berisi pemberitahuan
tentang masalah yang perlu diketahui oleh siapa saja yang berkepentingan
sesuai dengan pengumuman tersebut.
Surat Pengumuman dapat disebarkan dengan beberapa cara, di
antaranya:
(1) menyebarkannya sebagai surat edaran,
(2) memasangnya di papan-papan pengumuman, dan
(3) memasangnya di koran-koran sebagai iklan.
Contoh surat pengumuman:
PT. Tunjung Mulia
Jalan Diponegoro No. 5, Palembang
PENGUMUMAN
No. 215/033/05
tentang
Kesempatan Kerja bagi Para Lulusan SLTA
PT. Tunjung Mulia membuka kesempatan bagi para lulusan SLTA
untuk diangkat sebagai karyawan/i di perusahaan kami.
Lamaran ditulis di atas kertas bermaterai Rp 6000,- dengan dilampiri
iazah (fotokopi), riwayat hidup, foto 3 x 4 = 3 lembar, SKKB dan surat
keterangan sehat dari dokter.
Pendafarandibukamulaitanggal3Januarisampaidengan7Januari
2005. Pelamar datang sendiri di kantor kami pukul 08.00 – 12.00 WIB.
Demikian pengumuman kami untuk diketahui
Palembang, 1 Januari 2005
Direktur PT. Tunjung Mulia
Drs. Ir. Anggi Surendra
4. Memo atau Memorandum
Memorandum biasa digunakan untuk surat-menyurat secara intern
49 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
dalam lingkungan kantor. Memo dibuat oleh atasan kepada bawahan atau
antara pejabat yang setaraf. Isi memo singkat, sederhana, dan mudah agar
cepat dipahami. Memo umumnya berisi peringatan, arahan, penerangan,
perintah, pertanyaan, dan lain sebagainya.
Penulisan memo dapat ditik atau ditulis tangan. Isi memo umumnya
tidak lebih dari 10 baris. Bagian-bagian memorandum meliputi sebagai
berikut:
a. Ciri Bentuk
Terdiri atas dua bagian, yaitu kepala memo dan isi memo. Kepala
memo berisi:
(1) pihak yang dituju
(2) pengirim memo
(3) perihal memo
(4) tanggal pengirim memo
(5) paraf dan nama pengirim
b. Ciri Isi
Isi memo disampaikan dengan bahasa singkat. Penulisan memo harus
langsung menyampaikan pesan atau perintah dengan kalimat pendek
dan tegas. Karena peredarannya yang terbatas, memo biasanya tidak
mencantumkan identitas kantor.
Bacalah contoh memo berikut ini dan perhatikan ciri-cirinya!
Contoh 1
Memo
Kepada : Manajer Pemasaran
Dari : Kasubag. Pengiriman Buku
Perihal : Pengiriman Buku
Segera kirimkan buku Teori karya Prof. Dr. Hamid Abdul Hadi untuk
Bapak Dr. Budi Santoso, Kepala Perpustakaan Kota Bogor, sebanyak 80
eksemplar.
Jakarta, 22 Maret 2005
(paraf)
Ajun Ginanjar
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 50
Contoh 2
PT. Angkasa Raya
Jalan Pancanaka No. 3
(1)--------------------------- Jakarta – Selatan
(2) 30 Desember 2004
(3) Memo
(4) Kepada : Bagian Personalia
(5) Dari : Direktur PT Angkasa
(6) Hal : Pengadaan Pegawai
(7) Sesuai dengan perkembangan di perusahaan terutama pada
bidang sales, saya meminta Saudara mempersiapkan
sarana dan perencanaan guna penerimaan karyawan baru.
(penjelasan terlampir)
Ttd
(8) Dandang Kusuma, S.E.
Keterangan:
(1) kop surat memo
(2) tanggal surat memo
(3) judul memo
(4) alamat memo
(5) pengirim memo
(6) perihal pokok memo
(7) isi memo
(8) tanda tangan dan nama terang pengirim memo
5. Disposisi
Lembaran disposisi adalah lembaran kertas yang disediakan oleh
agendaris untuk diisi oleh pimpinan tentang tindak lanjut surat yang
masuk. Dengan kata lain, disposisi adalah catatan berupa saran /tanggapan/
instruksi setelah surat dibaca oleh pimpinan.
Sebagai contoh, suatu intitusi menerima surat penawaran barang oleh
bagian administrasi. Surat itu diagendakan, lalu diberi lembar disposisi.
Selanjutnya, pimpinan membuat disposisi. Isi disposisi bisa merupakan
51 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
perintah untuk menolak penawaran tersebut atau memerintahkan staf yang
bersangkutan untuk membalas surat yang isinya memesan barang-barang
tersebut.
Disposisi dibedakan menjadi dua macam:
(1) disposisi langsung, yaitu disposisi yang langsung ditulis pada lembaran
surat, dan
(2) disposisi tidak langsung, yaitu disposisi yang dituliskan pada lembaran
tersendiri (lembaran disposisi).
Contoh disposisi :
Contoh disposisi :
Rahasia Penting Rutin
No. Agenda : 102/SP/2007………Tgl. Penyelesaian
Tanggal : 30 Maret 2007
Perihal : Penawaran Bahan Kain
Tanggal : 30 Maret 2007
Asal : PT. Darma Tekstil
Instansi/Informasi: Diteruskan kepada:
- Harap dipelajari 1. Bagian gudang
- Tanyakan bagian pengadaan barang 2. Biro Umum
- Jika perlu, segera pesan 3. Bag. Keuangan
4.
Jakarta, 30 Maret 2007
Pimpinan,
ttd
Imam Ahmad, S.E.
9
C. Perintah Kerja Berbentuk Manual
Petunjuk penggunaan yang disebut juga manual kerja merupakan
perintah bagaimana melakukan pekerjaan atau perbuatan terhadap suatu
objek atau alat. Petunjuk penggunaan umumnya disediakan oleh produsen
barang untuk memberi petunjuk penggunaan barang yang bersangkutan.
Oleh sebab itu, petunjuk penggunaan (manual kerja) biasanya menggunakan
bahasa lugas dan mudah dipahami.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 52
Petunjuk penggunaan dibuat agar pengguna barang/alat dapat
menggunakan barang tersebut dengan baik dan bermanfaat sesuai dengan
cara kerja dan kegunaan barang tersebut. Barang-barang elektronik, seperti
kulkas, televisi, telepon, mesin cuci, VCD/DVD, atau komputer perlu buku
petunjuk.
Berikut contoh buku petunjuk cara kerja pesawat telepon. Perhatikanlah
dengan saksama!

IMAGE TOUCH PANEL PHONE LCD
KEISTIMEWAAN
1. Tombol tidak perlu ditekan, cukup disentuh.
2. Dilengkapi dengan layar LCD yang dapat menampilkan:
a. penunjuk waktu/jam/24 jam
b. kalender otomatis yang berlaku sepanjang masa
c. Caller id (menampilkan nomor yang masuk)
3. Bisa menyimpan nomor telepon secara otomatis pada saat melakukan
telepon keluar maupun telepon masuk.
4. Bisa me-redial nomor-nomor internasional.
5. Ada fasilitas handsfree tanpa harus mengangkat gagang telepon.
6. Bisa mengunci menggunakan password (dengan nomor pin)
CARA PAKAI / CARA KERJA:
1. Untuk set tahun/bulan/tanggal dan waktu/jam, tekan SET/SAVE
hingga keluar set/date, lalu tekan set/save. Untuk konfrmasi, bisa
menggunakan tombol up dan down. Setelah selesai, tekan tombol
delete (exit) dan kembali ke menu semula.
2. Untuk mengoperasikan kalkulator, tekan AC dan untuk keluar, tekan
delete.
3. Untuk melihat telepon masuk atau keluar tekan dialed lalu tekan
down
4. Untuk menggunakan handsfree, tekan tombol handsfree.
5. Untuk menyimpan nomor telepon yang masuk, tekan dialed, lalu pilih
nomor telepon dengan up atau down, lalu tekan set/save. Untuk menghapus,
tampilkan nomor telepon, tekan delete. Untuk melihat nomor telepon
yang masuk, tekan Vip. Untuk memilihnya, tekan up atau down.
53 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
6. Untuk mengatur kejelasan layar LCD, tekan set save lalu tekan
tombol up/down hingga keluar set 6 lcd, tekan set atau save. Tekan
tombol up atau down untuk mengatur tingkat 1 sampai dengan 5,
setelah itu tekan set save. Dan untuk keluar, tekan delete.
D. Menindak Lanjuti Perintah Kerja Tertulis
Pada bab dua, kita telah mempelajari bagaimana menindaklanjuti
perintah kerja secara lisan, misalnya instruksi dari Pembina OSIS tentang
rencana menyelenggarakan Pentas Seni dalam rangka peringatan HUT
sekolah. Ketua OSIS dan pengurusnya segera melakukan langkah-
langkah seperti membentuk panitia, merencanakan kegiatan, merumuskan
agenda kerja, struktur kerja, dan menyusun beberapa pertanyaan untuk
konfrmasi.
Dalam dunia kerja, seorang pemimpin tentu sering memberikan
perintah kerja, baik secara lisan maupun tertulis. Setiap karyawan ,baik
sebagai atasan maupun bawahan, harus mampu memahami serta menyikapi
dengan baik peraturan atau budaya kerja yang ada pada perusahaan tempat
dia bekerja. Setiap menerima perintah kerja secara tertulis dalam bentuk
surat atau instruksi kedinasan lainnya yang berkaitan dengan pekerjaan,
kita harus dapat menindaklanjutinya.
Hal-hal yang perlu dilakukan saat menerima perintah kerja tertulis,
ialah seperti berikut.
(1) Membaca perintah kerja secara teliti, hati-hati, dan saksama.
(2) Membuat catatan informasi penting dari perintah kerja tersebut.
(3) Membuat rencana tindak lanjut berdasarkan perintah
(4) Merancang bagan atau prosedur kerja yang diperintahkan.
(5) Memintakonfrmasikepadapemberiperintahakanketepatanrencana
kerja.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 54
RANGKUMAN
A. Mengenal Bentuk Perintah Kerja Tertulis
Bentuk perintah tertulis dapat dibedakan menjadi beberapa
jenis, yaitu himbauan/larangan, petunjuk, peraturan, pedoman, dan
undang-undang.
B. Model-Model Surat Berisi Perintah Kerja
Surat adalah suatu alat atau sarana komunikasi tertulis. Surat yang
berhubungan dengan pekerjaan disebut surat dinas atau surat resmi.
Model surat yang berisi informasi kerja atau perintah kerja, antara lain:
1. Surat Perintah
2. Surat edaran, yang terdiri atas surat edaran umum dan surat edaran
khusus.
3. Surat Pengumuman yang dapat dibedakan menjadi tiga, yaitu:
(1) Pengumuman lisan
(2) Pengumuman tertulis
(3) Pengumuman dari instansi dan surat pengumuman bukan dari
instansi.
4. Memo atau Memorandum
5. Disposisi yang dibedakan menjadi disposisi langsung dan disposisi
tidak langsung.
C. Perintah Kerja Berbentuk Manual
Petunjuk penggunaan yang disebut juga manual kerja merupakan
perintah bagaimana melakukan pekerjaan atau perbuatan terhadap suatu
objek atau alat. Petunjuk penggunaan umumnya disediakan oleh produsen
barang untuk memberi petunjuk penggunaan barang yang bersangkutan,
seperti barang-barang elektronik TV, kulkas, VCD, atau HP.
D. Menindak lanjuti Perintah Kerja Tertulis
Setiap menerima perintah kerja secara tertulis dalam bentuk surat
atau instruksi kedinasan lainnya yang berkaitan dengan pekerjaan,
kita harus dapat menindaklanjutinya. Tindak lanjut tersebut mulai dari
membacaperintahkerjasecaratelitisampaidenganmemintakonfrmasi
kepada pemberi perintah akan ketepatan rencana kerja.
55 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
TUGAS MANDIRI:
Untuk lebih mengenal dan memahami bentuk perintah kerja tertulis,
kerjakanlah tugas berikut.
1. Carilah minimal tiga bentuk perintah kerja secara tertulis yang
lainnya!
2. Jelaskan perbedaan bentuk perintah kerja secara tetulis dari segi
struktur dan penggunaan bahasa!
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Bila kita akan menyampaikan perintah kerja tertulis secara ringkas,
sebaiknya membuat
a. faktur d. memorandum
b. disposisi e. surat perintah
c. buku manual kerja
2. Formulir penyusunan bahasa dalam memorandum dianjurkan
a. bahasa yang panjang dan terurai
b. bahasa yang singkat, jelas, dan tepat
c. bahasa Indonesia yang baik dan benar
d. kalimat yang ambigu
e. bahasa yang kontaminatif
3. Nama jelas penanda tangan surat ditulis
a. nama diberi garis bawah
b. menggunakan tanda kurung buka dan tanda kurung tutup
c. tidak diapit oleh tanda kurung buka dan tanda kurung tutup dan
tidak digarisbawahi
d. dengan menggunakan huruf kapital seluruhnya
e. diapit oleh tanda kurung buka dan tanda kurung tutup dan
digarisbawahi.
4. Berikut ini termasuk ke dalam perintah kerja tertulis, kecuali
a. memorandum
b. surat pengumuman
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 56
c. surat edaran
d. buku manual kerja
e. surat pengiriman barang
5. Pemberitahuan pemerintah kepada rakyat Indonesia tentang pelak-
sanaan pemilu, disebut surat
a. surat edaran
b. iklan
c. spanduk
d. kaki surat
e. perihal surat
6. Bagian surat edaran yang dinamakan kaki surat/bagian akhir terdiri
atas
a. nama jabatan, tanda tangan pejabat, nama pejabat, cap dinas, dan
tembusan
b. tulisan edaran, pendahuluan, isi, dan penutup
c. tanda tangan, nama terang, tembusan, dan cap dinas
d. pembukaan, isi, dan penutup
e. tembusan, lampiran, dan tanda tangan pejabat
7. Penjelasan di bawah ini berhubungan dengan memo, kecuali
a. bentuk komunikasi yang berisi saran, arahan, dan penerangan
b. surat pernyataan dalam hubungan diplomasi
c. memo dibuat oleh atasan dan jajaran yang berada di bawahnya
dalam satu organisasi
d. alat bukti historis
e. nota atau peringatan tidak resmi
8. Yang bukan fungsi surat resmi
a. alat komunikasi
b. alat bukti tertulis
c. alat pengingat
d. permohonan kerja
e. surat pernyataan dalam hubungan diplomasi
9. Penutup surat perintah yang tepat adalah
a. Harap dilaksanakan dengan sebaik-baiknya.
b. Atas perhatian Saudara, kami ucapkan terima kasih.
c. Kehadiran Saudara sangat kami harapkan dan terima kasih.
57 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
d. Atas perhatian dan kerja sama Bapak, kami ucapkan terima kasih.
e. Berhubung pentingnya acara, kehadiran Saudara tidak boleh
diwakilkan.
10. Di bawah ini yang bukan salam pembuka adalah
a. Saudara... yang terhormat
b. Bapak yang terhormat
c. Assalamu’alaikum warahmatullahi wabarakatuh
d. Dengan hormat
e. Wassalam
11. Surat pemberitahuan tertulis yang ditujukan kepada pejabat/pegawai
yang berisi suatu penjelasan disebut
a. surat edaran umum
b. surat edaran khusus
c. surat edaran dari suatu instansi
d. pengumuman
e. surat sirkuler
12. Lembaran kertas yang disediakan oleh agendaris untuk diisi pimpinan
tentang tindak lanjut. Surat yang dimaksud disebut
a. distorsi d. diskualifkasi
b. disposisi e. memorandum
c. dispensi
13. Rangkaian bagian surat perintah adalah
a. tempat kedudukan, nama yang diberi perintah, dan tanda tangan
b. tempat kedudukan, keterangan yang diberi perintah, tanda tangan,
dan nama jelas
c. tempat, tanggal, nomor surat, dan tanda tangan
d. tempat dan tanggal, nomor surat, dan tanda tangan
e. tempat dan tanggal, jawaban pemberi perintah, nama yang diberi
perintah, dan tanda tangan.
14. Bagian-bagian surat perintah ialah
a. nomor, judul, dan konsideran
b. bagian, kepala, bagian isi, dan bagian kaki
c. dasar, pertimbangan, dan isi perintah
d. judul, badan surat, dan kaki surat
e. nama, alamat, dan nomor urut surat perintah
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 58
15. Mengetahui informasi lisan tentang kurs rupiah, bisa melalui
a. tabloid d. berita televisi
b. surat kabar e. majalah mingguan
c. berita ekonomi

16. Bentuk perintah kerja tertulis umumnya bersifat tidak langsung. Bentuk
perintah tertulis antara lain, kecuali
a. undang-undang d. petunjuk
b. himbauan/larangan e. ajakan
c. peraturan

17. Bagiansuratedaranyangmerupakandafarpenerimasuratselainyang
dialamatkan adalah
a. alamat dalam
b. pembuka surat
c. tembusan
d. alamat
e. tanggal surat

18. Buku petunjuk cara melakukan sesuatu berkaitan dengan penggunaan
benda atau alat disebut
a. buku petunjuk
b. buku pedoman
c. buku manual kerja
d. buku keterangan
e. primbon
19.
DEPARTEMEN AGAMA
KANTOR WILAYAH PROVINSI DAERAH ISTIMEWA YOGYAKARTA
SURAT EDARAN
Nomor : WI / I / KS.02 / 01 / 2006
Untuk menindaklanjuti Peraturan Menteri Agama Republik Indonesia
Nomor 1 tahun 2005 tanggal 12 Desember 2005 perihal Tata Persuratan Dinas di
Lingkungan Departemen Agama RI, dengan ini kami beri tahukan bahwa salah
satu materi dalam rangka penyempurnaan tata persuratan dinas adalah tentang
cap dinas pokok. Pokok penyempurnaan itu sebagai berikut.
……………………..
Berdasarkan penggalan surat di atas, alamat surat ditujukan
kepada
59 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
a. Kepala Dinas Pendidikan Pemuda dan Olahraga se-Daerah
Istimewa Yogyakarta
b. Kepala Kantor Departemen Agama Kodya/Kabupaten se–Daerah
Istimewa Yogyakarta
c. Kepala Kantor/Menteri Agama RI
d. Kepala Kantor Wilayah Provinsi
e. Kepala Kantor Departemen Agama se–Indonesia
20. Kalimat-kalimat di bawah ini yang dapat digunakan dalam surat
perintah adalah
a. Demikianlah surat ini dikemukakan agar mendapat perhatian.
b. Kami mengharapkan surat ini mendapat perhatian Saudara.
c. Agarpelaksanaannyadialankansebaik-baiknya.
d. Selanjutnya perintah ini agar dilaksanakan dengan penuh tanggung
jawab.
e. Perintah ini harus dilaksanakan dengan penuh tanggung jawab.
Memo
Kepada : Manajer Pemasaran
Dari : Kasubag Pengiriman Buku
Perihal : Pengiriman Buku
Segera kirimkan buku Teori Karya Prof. Dr. Hamid Abdul Hadi untuk
Bapak Dr. Budi Santoso, Kepala Perpustakaan Kota Bogor, sebanyak 80
eksemplar.
Jakarta, 22 Maret 2005
( paraf )
Ajun Ginanjar
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 60
II. Bila Anda telah mencermati contoh memo di atas, jawablah perta-
nyaan di bawah ini!
1. Ditujukan kepada siapa memo di atas?
2. Siapa pengirim memo tersebut?
3. Apa isi perintah kerja tertulis pada memo di atas?
4. Apakah pesan yang disampaikan memo itu singkat dan jelas?
5. Berdasarkan pengamatanmu unsur-unsur apakah yang menjadi ciri
khas memo?
6. Sebutkan kekurangan dari memo di atas! Jelaskan!
7. Apa yang dimaksud dengan disposisi?
8. Sebutkan macam-macam pengumuman!
9. Apa perbedaan surat edaran dan surat perintah?
10. Buatlah perintah kerja berbentuk manual!
61 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Kompetensi
Dasar
- Membaca untuk memahami makna kata, bentuk kata,
ungkapan, dan kalimat dalam konteks bekerja
Indikator
- Mengelompokkan kata, bentuk kata, ungkapan, dan
kalimat berdasarkan kelas kata dan makna kata
- Mendafarkata-katayangberpotensimemilikisinonim
dan antonim dalam teks bacaan
- Mengidentifkasikata(termasukbentukkatabaru),frasa,
kalimat yang dipersoalkan kebenaran/ketepatannya
(diterima/ditolak)berdasarkanparadigmaatauanalogi
- Mengidentifkasi kata, frasa, kalimat, atau bentuk
kata baru yang perlu dipersoalkan kebenarannya/
ketepatannya(diterima/ditolak)berdasarkankankaidah
atau kelaziman
Pada kelas X, kita sudah belajar tentang kelas kata. Pada bab ini, kita akan
mempelajari kembali kelas kata dalam kaitannya dengan keterampilan
membaca. Selain itu, kita juga akan mempelajari kata berdasarkan
bentukan kata, makna kata, serta mengindentifkasi kata/frasa baru. Setelah
mempelajaribabini,kitaharusmampumendafarkandanmengelompokkan
kata berdasarkan kelas kata dan makna kata. Kita juga harus mampu
mengindentifkasipenggunaankata,frasa,ungkapan,dankalimatyangbaru
yang tidak benar atau tidak lazim sesuai kaidah bahasa Indonesia.

BAB 4
MEMBACA UNTUK MEMAHAMI MAKNA KATA,
BENTUK KATA UNGKAPAN, DAN KALIMAT
DALAM KONTEKS BEKERJA
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 62
Wacana
Kebiasaan Lama Kurangi Sampah Plastik
Kebiasaan lama tak selalu jelek. Bahkan ada yang ramah lingkungan.
Sewaktu kecil, sampai awal tahun 1980-an, kita masih terbiasa melihat
nenek atau ibu-ibu tetangga ke pasar tradisional membawa tas sendiri
yang terbuat dari anyaman pandan atau tas kain. Sejalan merebaknya
pasar swalayan yang menyediakan tas belanja plastik sebagai layanan bagi
pelanggan sekaligus promosi, kebiasaan itu menghilang. Ritual belanja
memang jadi lebih praktis, namun menimbulkan masalah lain: gunungan
sampah!
Padahal, tahukah Anda, plastik itu terbuat dari minyak bumi yang
jumlahnya makin hari makin terbatas? Jadi “Bring your own bag.” Ini
kampanye dari toko pernik interior IKEA di Singapura. Sejak Hari Bumi
22 April 2007, mereka tak lagi menyediakan tas belanja plastik. Para
pelanggan diberi pilihan membawa tas belanja sendiri, beli tas belanja dari
belacudenganrancangancantiksehargaSin$1,2(setaraRp12.000),atau
membeli tas plastik seharga 5 atau 10 sen dolar Singapura, bergantung
pada ukurannya. Jadi, kampanye pengurangan penggunaan plastik bukan
hanya untuk mengurangi gunungan sampah, tapi juga menghemat BBM.
Di pertigaan Rawa Belong, Jakarta Barat, tiap sore hingga malam bisa
kita temui warung tenda “Bubur Ayam Lumayan Bang Tatang.” Bubur nasi
kental dengan tumpukan suwiran ayam ini laris manis. Tak kalah laris, cara
Bang Tatang menyiapkan bubur bagi pelanggannya yang antre sampai ke
luar tenda. One man show, ia menjejerkan 20 mangkuk kosong sekaligus,
dengan gerakan cepat, dalam tempo 5 menit, semuanya sudah terhidang di
hadapan pelanggan.
“Bawa tempat sendiri, saya tak menyediakan plastik, repot dan lama
melayaninya!” katanya dengan nada ketus tiap kali pelanggannya pesan
untuk dibawa pulang. Sombong! Begitulah komentar pembeli yang baru
pertama kali berkunjung. Tapi bila dipikir-pikir, “kesombongan” Bang
Tatang adalah perilaku baik yang ramah lingkungan.
Dulu, bila ingin membeli bakso, soto, atau es kelapa muda di pojok
jalan, banyak di antara kita yang membawa mangkuk sendiri. Sekarang,
pemandangan semacam itu nyaris tak pernah ada. Yang umum justru
banyakyangmemanfaatkankantongplastik.Idealnya,kitaharusmembawa
rantang susun sendiri bila membeli makanan untuk dibawa pulang dari
63 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
restoran. Tindakan ini untuk mengurangi sampah styrofoam dan plastik.
Bukankah sekarang, wadah makanan banyak yang dirancang cantik?
Diamintakbakalbikinmalu.
Kampanye penggunaan tas bukan plastik sendiri sebenarnya sudah
cukup lama ada di Indonesia. Pusat perkulakan Makro, misalnya, saat
mulai beroperasi di Indonesia tak menyediakan tas belanja. Pelanggan
dipersilakan mengangkut belanjaan dalam kemasan karton aslinya,
sedangkan perusahaan tata rias The Body Shop sempat mengadakan
kampanye Reuse Reduce Recycle dengan memberikan potongan harga bagi
pelanggannya, yang mengisi ulang produk dengan membawa wadah lama.
Namun, kurangnya peminat membuat The Body Shop mengubah strategi.
Tak lagi menerima wadah lama, tapi mengganti bahan wadah dengan
materi yang lebih cepat terurai di alam.
Untuk mengurangi gunung sampah plastik dan menghemat BBM,
kembalilah pada kebiasaan lama, membawa wadah sendiri untuk jajanan
dan belanjaan kita.
(Sumber:Intisari,Juli2007)
A. KlasifkasiKataBerdasarkanKelasKata
Untuk mendayagunakan bahasa secara maksimal, diperlukan kesadaran
akan pentingnya pengayaan kosakat. Kesadaran itulah yang memotivasi
kita untuk lebih rajin membaca. Membaca merupakan kegiatan berbahasa
yangsecaraaktifmenyerapinformasiataupesanyangdisampaikanmelalui
media tulis, seperti buku, majalah, dan surat kabar. Aktivitas membaca
tidaksajadilakukanuntukmenyerapinformasiataupesanyangdiuraikan
di dalam bacaan, tetapi membaca dapat juga dilakukan dengan tujuan
menelaah unsur-unsur kebahasaan yang terkandung di dalamnya.
Dalam sebuah bacaan, terkandung banyak unsur bahasa yang berkaitan
dengan makna kata dan ruang lingkupnya. Juga penggunaan gaya bahasa
yang berhubungan dengan ungkapan dan bentuk-bentuk pemakaiannya.
Pada bab ini, kita akan membahas dan menelaah unsur-unsur kebahasaan
di dalam bacaan berkaitan dengan kata, bentuk kata, ungkapan, serta
kalimat berdasarkan kelas kata dan makna kata.
Kata merupakan unsur yang sangat penting dalam membangun suatu
kalimat. Tanpa kata, tidak mungkin ada kalimat. Setiap kata mempunyai
fungsi dan peranan yang berbeda sesuai dengan kelas kata atau jenis
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 64
katanya. Di kelas X, kita sudah mempelajari kelas kata dan pada bab ini akan
dibahas kembali tentang kelas kata dan hubungannya dengan kalimat.
Secara umum kelas kata terdiri atas 5 macam, yaitu:
(1) katakerja(verba)
(2) katasifat(adjektif)
(3) kataketerangan(adverbia)
(4) katabenda(nomina),kataganti(pronomina),katabilangan(numeralia)
(5) katatugas
1. Kata Kerja (Verba)
Kata kerja ialah kata yang menyatakan perbuatan atau tindakan. Kata
kerjabiasanyaberfungsisebagaipredikat.Suatukatadapatdigolongkanke
dalam kelas kata kerja apabila memenuhi persyaratan berikut.
(1) Dapatdiikutiolehgabungankata(frasa)dengan + kata sifat.
Contoh:
pergi (Pergi dengangembira.)
tidur (Tidur dengannyenyak.)
jalan (Jalan dengansantai.)
(2) Dapatdiberiaspekwaktu,sepertiakan, sedang, dan telah.
Contoh:
(akan)mandi
(sedang)tidur
(telah) pergi
(3) Dapatdiingkaridengankatatidak.
Contoh:
(tidak)makan
(tidak)lihat
(tidak)pulang
(4) Berawalanme- dan ber-
Contoh:
melatih
melihat
merakit
berdiskusi
65 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
berpikir
berusaha
2. KataSifat(Adjektiva)
Kata sifat ialah kata yang dipakai untuk mengungkapkan sifat atau
keadaan sesuatu, misalnya keadaan orang, binatang, benda. Kata sifat
berfungsisebagaipredikat.
Suatu kata dapat digolongkan ke dalam kelas kata sifat apabila
memenuhi persyaratan berikut.
(1) Dapat diawali dengan kata sangat, paling dan diakhiri dengan kata
sekali.
Contoh:
indah (sangatindah/indah sekali)
baik (sangatbaik/baik sekali)
tinggi (sangattinggi/tinggi sekali)
(2) Dapatdiberiawalanse- dan ter-.
Contoh:
luas (seluas/terluas)
bodoh (sebodoh/terbodoh)
mudah (semudah/termudah)
buruk (seburuk/terburuk)
baik (sebaik/terbaik)
(3) Dapatdiingkaridengankata tidak.
Contoh:
murah (tidakmurah)
sulit (tidaksulit)
pahit (tidakpahit)
3. KataKeterangan(Adverbia)
Kata keterangan atau adverbia adalah kata yang memberi keterangan
padaverba,adjektiva,nominapredikatif,ataukalimat.
Berikut adalah macam-macam adverbia.
(1) Adverbiadasarbebas,misalnya:alangkah, agak, akan, amat, nian, niscaya,
tidak, paling, pernah, pula, saja, saling.
(2) Adverbiaturunanterbagiatas3bentukberikut.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 66
(a) Adverbia reduplikasi, misalnya ; agak-agak, lagi-lagi, lebih-lebih,
paling-paling.
(b) Adverbiagabungan,misalnya:belum boleh, belum pernah, atau tidak
mungkin.
(c) Adverbia yang berasal dari berbagai kelas, misalnya: terlampau,
agaknya, harusnya, sebaiknya, sebenarnya, secepat-cepatnya.
4. KataBenda(Nomina),KataGanti(Pronomina),KataBilangan(Numeralia)
4.1. Katabenda
Kata benda ialah kata yang mengacu pada benda, orang, konsep,
ataupun pengertian yang berfungsi sebagai objek dan subjek. Suatu
kata dapat digolongkan ke dalam kelas kata benda apabila memenuhi
persyaratan berikut.
(1) Dapatdiikutiolehfrasayang + sangat.
Contoh:
mobil (mobil yang bagus/mobil yangsangatbagus)
pemandangan (pemandangan yang indah/pemandangan yang
sangatindah)
pemuda (pemuda yang gagah/pemuda yangsangatgagah)
(2) Berimbuhanpe-, -an, pe-/-an, per-/-an, ke-/-an.
Contoh:
permainan
pertunjukan
kesehatan
(3) Dapatdiingkaridengankatabukan.
Contoh :
saya (bukansaya)
roti (bukanroti)
gubuk (bukangubuk)

4.2. KataGanti(Pronomina)
Kata ganti atau pronomina adalah kata yang dipakai untuk mengacu
padanominalain.Pronominaberfungsiuntukmenggantikatabendaatau
nomina.
Contoh:
Aku sudah mencoba membujuknya.
Kami sangat berharap kepada kalian.
67 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Dia telah meninggalkan kita.
Itu memang miliknya.
4.3. KataBilangan(Numeralia)
Kata bilangan atau numeralia adalah kata yang dipakai untuk
menghitung banyaknya orang, binatang, dan benda.
Contoh:
Ibu membeli gelas selusin.
Ia mendapat peringkat pertama di kelasnya.
Bapak Bardi memiliki dua puluh ekor kambing.
Sepertiga dari harta warisan itu disumbangkan ke panti asuhan.
5. Kata Tugas
Katatugasdapatdirincimenjadiempatjeniskata,yaitu(1)kata depan,
(2)kata sambung,(3)kata sandang, (4)kata seru, dan (5) partikel.
(1) KataDepan(Preposisi)
Kata depan adalah kata yang menghubungkan dua kata atau dua
kalimat.
Contoh:
di (sebelah)utara=menunjukarah
ke timur=menunjukarah
dari pasar=menunjuktempat
padaharisenin=menunjukwaktu
(2) KataSambung(Konjungsi)
Kata sambung adalah kata yang menghubungkan dua satuan bahasa
yang sederajat: kata dengan kata; frasa dengan frasa, klausa dengan
klausa.
Contoh :
adik dan kakak
makan atau minum
tidak makan, tetapi minum
ia tidak naik kelas karena bodoh
Adi meletakkan tasnya, lalu ia membuka seragamnya.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 68
(3) KataSandang(Artikula)
Kata sandang adalah kata tugas yang membatasi makna nomina.
Contoh:
sang guru (sang bermaknatunggal)
para pemimpin (para bermaknajamak)
si cantik (si bermaknanetral)
(4) KataSeru(Interjeksi)
Kata seru adalah tugas yang digunakan untuk mengungkapkan seruan
hati.
Contoh:
Aduh, kakiku sakit sekali.
Astaga, mengapa kamu berani mencuri ?
Ayo, jangan putus asa.
“Wah, mahal sekali!” kata adik.
Kata yang dicetak miring adalah kata seru. Contoh lain kata seru adalah
hai, nah, oh, celaka, gila, Masya Allah, dan Alhamdulillah.
(5) Partikel
Partikel adalah kategori atau unsur yang bertugas memulai,
mempertahankan, atau mengukuhkan sebuah kalimat dalam komunikasi.
Unsur ini digunakan dalam kalimat tanya, perintah, dan pernyataan
(berita).
Contoh partikel: -lah, -kah, -tah, -deh, -dong, -kek, dan -pun
Kita baru saja mempelajari kelas kata beserta ciri-cirinya. Dalam suatu
wacana,tentuterdapatberbagaikata,frasa,dankalimat.Kitadapatmerinci
setiap kata berdasarkan kelas katanya.
B. KlasifkasiKataBerdasarkanBentukKata
Dari segi bentuknya, kata dapat dibedakan atas empat macam, yaitu :
1. Kata Dasar
2. Kata Turunan
3. KataUlang
4. KataMajemuk
69 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
1. Kata Dasar
Kata dasar adalah kata yang tidak berimbuhan atau yang belum
diberikan awalan, akhiran, sisipan, dan penggabungan awalan akhiran.
Kata-kata seperti baik, getar, kerja, sakit, gunung disebut sebagai kata dasar
karena kata-kata itu tidak berimbuhan atau belum diberi imbuhan. Jika kata-
kata itu diberi imbuhan, hasilnya antara lain terbaik, getaran, pekerja, kesakitan,
dan pegunungan. Jika sudah mengalami penambahan atau pengimbuhan,
kata tersebut sudah dikategorikan ke dalam kata turunan.
2. Kata Turunan
Sebuah kata dapat menyampaikan beberapa pengertian melalui
bentukan-bentukannya. Dari satu kata pula, kita dapat membuat atau
mengembangkannya menjadi beberapa kata turunan. Dari kata turunan
tersebut, kita dapat mengungkapkan satu bahkan beberapa ide/perasaan.
Pemekaran kata dengan memberi imbuhan itu pun akan membuat kata-
kata tersebut mengalami perubahan jenis atau kelas katanya. Coba Anda
amati kata satu termasuk kata bilangan/numeralia yang berarti “bilangan
asli pertama”. Kata satu diberi awalan ber- menjadi bersatu. Kata tersebut
mengalami perubahan arti, meskipun masih memiliki arti dasar yang tetap,
yaitu “satu”, bersatu artinya berkumpul atau bergabung menjadi satu. Kata
bersatu bukan merupakan kelas kata bilangan lagi, tetapi termasuk kelas
kata kerja.
Bagaimana pengimbuhannya?
Anda telah melihat bahwa dari satu kata (misalnya satu) dapat kita
bentuk belasan kata turunannya. Bentuk berimbuhan tersebut menunjukkan
pertalian yang teratur antara bentuk dan maknanya. Hal ini dapat berlaku
pula pada kata-kata yang lainnya. Perhatikan tabel berikut dengan cermat.
- 46 -
3. Kata Ulang
Kata ulang adalah kata yang mengalami proses pengulangan bentuk baik seluruh kata
maupun sebagian. Semua kata ulang wajib di tulis dengan memakai tanda penghubung ( - ).
Contoh :
lauk-pauk mondar-mandir
anak-anak porak-poranda
berjalan-jalan biri-biri
gerak-gerik kupu-kupu
dibesar-besarkan laba-laba
huru-hara
Macam-macam kata ulang
1. Ulangan seluruh kata dasar
Misalnya :
anak-anak meja-meja
buku-buku ibu-ibu
main-main makan-makan
2. Ulangan kata dengan memberi imbuhan
Misalnya :
berjalan-jalan bermanja-manja
dibesar-besarkan dipukul-pukulkan
berlari-larian menarik-narik
3. Ulangan seluruh kata, namun terjadi perubahan suara pada kata yang kedua
Misalnya :
gerak-gerik caci-maki
mondar-mandir compang-camping
huru-hara terang-benderang
bolak-balik carut-marut
lauk-pauk
4. Ulangan seluruh kata yang dinamakan kata asal
Misalnya :
asuh pengasuh pengasuhan Ȭ mengasuh asuhan
baca pembaca pembacaan membaca bacaan
bangun pembangun pembangunan membangun bangunan
buat pembuat pembuatan perbuatan membuat buatan
cetak pencetak pencetakan percetakan mencetak cetakan
edar pengedar pengedaran pengedaran mengedar edaran
potong pemotong pemotongan perpotongan memotong potongan
sapu penyapu penyapuan persapuan menyapu sapuan
tulis penulis penulisan menulis tulisan
ukir pengukir pengukiran mengukir ukiran
impor pengimpor pengimporan mengimpor imporan
KataȱAsalȱ
Verba
Hasil Perbuatan Hal/Tempat Prosesȱ Pelaku
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 70
3. Kata Ulang
Kata ulang adalah kata yang mengalami proses pengulangan bentuk
baik seluruh kata maupun sebagian. Semua kata ulang wajib ditulis dengan
memakaitandapenghubung(-).
Contoh:
lauk-pauk mondar-mandir
anak-anak porak-poranda
berjalan-jalan biri-biri
gerak-gerik kupu-kupu
dibesar-besarkan laba-laba
huru-hara
Macam-macam kata ulang
1. Ulangan seluruh kata dasar
Contoh:
anak-anak meja-meja
buku-buku ibu-ibu
main-main makan-makan
2. Ulangan kata dengan memberi imbuhan
Contoh:
berjalan-jalan bermanja-manja
dibesar-besarkan dipukul-pukulkan
berlari-larian menarik-narik
3. Ulanganseluruhkata,namunterjadiperubahansuarapadakatayang
kedua
Contoh:
gerak-gerik caci-maki
mondar-mandir compang-camping
huru-hara terang-benderang
bolak-balik carut-marut
lauk-pauk
4. Ulanganseluruhkatayangdinamakankataasal
Misalnya :
anai-anai ubur-ubur
kunang-kunang lobi-lobi
kupu-kupu mata-mata
agar-agar
71 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
4. Kata Majemuk
Kata majemuk adalah gabungan dua kata atau lebih yang membentuk
satu pengertian.
Contoh:
duta besar
kereta api senja utama
meja tulis guru
rumah makan
terjun payung
buku sejarah baru
kereta api cepat luar biasa
lapangan udara
rumah sakit jiwa
siap tempur
Contoh di atas menunjukkan bahwa kata dasar majemuk dapat sendiri
dari gabungan dua kata, tiga kata, empat kata, lima kata bahkan dapat
lebih. Hal yang terpenting adalah gabungan kata-kata itu harus menunjuk
kepadasatuartidantidakmelebihibatasfungsisebagaikata.
Cara penulisan kata majemuk ada yang terpisah atas dua kata atau
lebih,seperticontohtadi(dutabesar,rumahmakan)danadayangditulis
serangkai(jikahubungankeduakatasudahsangatpadu).
Contoh:
matahari kacamata
sapu tangan beasiswa
olahraga antarkota
C. KlasifkasiKataBerdasarkanMaknaKata
Kita sudah mempelajari proses pembentukan kata yang semua itu
berpengaruh pada perubahan makna kata dari makna awalnya. Selain
proses bentukan kata, makna kata juga dapat ditimbulkan oleh dua hal,
yaituhubunganreferensialdanhubunganantarmakna.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 72
1. MaknaKataBerdasarkanHubunganReferensial
Makna kata ini dibedakan menjadi:
a. Maknadenotatif
Makna denotatif ialah makna yang paling dekat dengan bendanya
(maknakonseptual),ataukatayangmengandungartisebenarnya.
Contoh:
1. Bunga mawar itu dipetik Sita dan disuntingkan di rambutnya.
2. Untukmenafahikeduaanaknya,iamenjualsayuran di pasar.
3. Penjual menawarkan barang kepada pembeli.
4. Bajunya basah kuyup terkena keringat.

b. Maknakonotatif
Makna konotatif ialah makna kiasan atau diartikan makna yang
cenderunglaindenganbendanyata(maknakontekstual)disebutjuga
makna tambahan.
Contoh :
1. Ayahnya mendapat kursi sebagai anggota dewan.
kursi artinya jabatan/kekuasaan
2. Hatiku berbunga-bunga setelah anakku mendapat juara pertama.
berbunga-bunga artinya gembira
3. Sekarang ia bekerja di tempat yang basah.
basah artinya selalu menghasilkan uang
Dalam pengertian lain makna konotasi berkaitan dengan cakupan
makna halus dan cakupan makna kasar.
Contoh cakupan makna halus:
1. Neneknya sudah meninggal dua hari yang lalu.
2. Istri Pak Dadang seorang perawat di rumah sakit pusat.
3. Ibunya Rosita sedang hamil lima bulan.
4. Mari kita doakan para pahlawan yang telah gugur agar arwahnya
diterima oleh Allah.
Contoh cakupan makna kasar:
1. Pamannya sudah mampus seminggu yang lalu.
2. Kakakku sedang bunting, dia harus berhati-hati.
3. Bininya seorang dokter.
4. Pahlawan telah mati di medan laga.
73 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
c. Maknaidiomatik(ungkapan)
Secara umum ungkapan berarti gabungan kata yang memberi arti
khusus atau kata-kata yang dipakai dengan arti lain dari arti yang
sebenarnya.
Ungkapan dapat juga diartikan makna leksikal yang dibangun dari
beberapakata,yangtidakdapatdielaskanlagilewatmaknakata-kata
pembentuknya.
Contoh:
− ringantangan =rajinbekerja,sukamemukul
− geraklangkah =perbuatan
− dipeti-eskan =dibekukanatautidakdigunakan
− tertangkapbasah =terlihatsaatmelakukan
− galilubangtutuplubang=pinjamsini,pinjamsana
− bantingstir =mengubahhaluan
− jantunghati =kekasih
Ungkapan berfungsi menghidupkan, melancarkan serta mendorong
perkembangan bahasa Indonesia supaya dapat mengimbangi perkem-
bangan kebutuhan bahasa terhadap ilmu pengetahuan dan keindahan
sehingga tidak membosankan. Tata bahasa ibarat kebun, ungkapan
ibarat kembang-kembangnya. Dilihat dari bentuk dan prosesnya,
ungkapan dapat diperinci ke dalam beberapa jenis berikut.
1. Menurut jumlah kata
a. Dua kata
− mencari ilham : berusaha mencari ide baru
− bercermin bangkai : menanggung malu
b. Tiga kata atau lebih
− diam seribu bahasa : membisu
− hutangnya setiap helai bulu : tak terhitung banyaknya
2. Menurut zaman
a. Ungkapan lama
− matanya bagai bintang timur : bersinar, tajam
− rambutnya bagai mayang mengurai : ikal, keriting
− berminyak air : berpura-pura
b. Ungkapan baru
− ranjau pers : undang-undang pers
− berebut senja : siang berganti malam
− ranum dunia : penyebab kesulitan
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 74
3. Menurutasalnya
a. Ungkapan berasal dari bahasa asing
− black sheep : kambing hitam
− over nemen : mengambil oper
− side efect : akibat samping
b. Ungkapan berasal dari bahasa daerah
− soko guru : suri tauladan
− anak bawang : yang tidak diutamakan

2. MaknaKataBerdasarkanHubunganAntarmakna
Makna kata berdasarkan hubungan antarmakna terdiri atas sinonim,
antonim, dan hiponim.
a. Sinonim
Sinonim ialah pasangan kata atau kelompok kata yang mempunyai arti
mirip atau hampir sama. Walaupun sinonim menunjukkan kesamaan arti
kata, sesungguhnya arti kata-kata itu tidaklah sama betul. Dalam kalimat
tertentu, suatu kata mungkin dapat digunakan tetapi dalam kalimat lain
tidak dapat digunakan atau penggunaannya selalu dipertimbangkan oleh
unsurnilairasaataulingkunganpenuturnya(kontekstual).
Contoh sinonim dengan kata yang sama maknanya :
− BungHatatelahwafat.(telah=sudah)
− KitamerdekakarenajasaBungHata.(karena=sebab)
− BungHatasangatberjasa.(sangat=amat)
Contoh beberapa kata yang memiliki kemiripan makna :
− Tepat di muka gedung kantor pos Jakarta berdirilah sebuah
kompleks bangunan kuno yang kukuh.
− Persis di bangunan kantor pos Jakarta kota tertancaplah
sebuah kawasan bangunan kolot yang kuat.
Makna kalimat 1 dan 2 sama. Namun kalimat 1 lebih jelas isinya, kalimat
2 pilihan katanya kurang tepat sehingga pembaca / pendengar menjadi ragu
menafsirkanmaknanya.
b. Antonim
Antonim adalah kata-kata yang berlawanan maknanya/berlawanan
artinya.
75 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Contoh:
a) Sejaksakitbatuk,iapantang minum es.
Ia harusmeminumobat itu sesuai yang dianjurkan oleh dokter.
b) Aksipenebanganpohonmerupakanperusakan hutan.
Pemerintah menghimbau agar warga melestarikan hutan.
c) Kadang-kadang ia berlatih seminggu sekali.
Nasihat orang tuanya seringkali tidak didengarnya.
d) Perkembangananakitusangatlambat.
Dengan tangkasnya, ia menendang bola ke mulut gawang.
Terdapat beberapa perbedaan antara kata-kata yang berantonim.
Oposisi antarkata dapat berbentuk seperti berikut.
a. Oposisi kembar
Contoh:
− laki-laki-perempuan
− jantan–betina
− hidup-mati
b. Oposisi majemuk
Contoh:
− baju-merah
− sapu- tangan
− rumah-makan
c. Oposisi gradual
Contoh:
− kaya- miskin
− panjang- pendek
d. Oposisirelasional(kebalikan)
Contoh:
− orangtua-anak
− guru-murid
− memberi-menerima
e. Oposisi inversi
Contoh:
− Jual-beli
− Pulang-pergi
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 76
f. Oposisikomplementer
Contoh:
− mur-baut
− kompor-minyak
g. Oposisi inkompabilitas
Contoh:
− merah-hiau
h. Oposisi hierarki
Contoh:
- camat lurah.
c. Hiponim
Hiponim ialah kata yang memiliki hubungan hierarkis dengan
beberapa kata yang lain. Hubungan hierarki ini terdiri atas satu kata yang
merupakaninduk(hipernim),yangmemilikisemuakomponenmaknakata
lainnya yang menjadi unsur bawahannya (hiponim). Proses hiponim dan
hipernim menimbulkan istilah kata umum dan kata khusus.
Kata umum dipakai untuk mengungkapkan gagasan umum,
sedangkan kata khusus digunakan untuk perinciannya. Jadi, kata umum
dapat diterapkan untuk semua hal, sedangkan kata khusus diterapkan
untuk hal tertentu saja. Contoh penggunaan kata umum dan khusus dalam
kalimat seperti berikut.
1. Pukul 07.00 WIB bel berdering cukup keras.
Berdering (kata khusus), biasanya digunakan untuk bunyi bel. Kata
umumnya ialah bunyi. Kata bunyi bisa digunakan untuk semua suara
benda/sesuatu.
2. Untuk menyambut tahun baru, Ibu merangkai melati dan mawar.
Kata melati dan mawar merupakan kata khusus. Kata umumnya ialah
bunga.
Berdasarkan contoh penggunaan kata umum dan kata khusus di atas,
cermatilah kata umum dan kata khusus pada tabel berikut ini.
Kata Umum Kata Khusus
melihat memandang, menonton, meratap,
menyaksikan, menengok, mengintip
mamalia sapi, kambing, kucing
77 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
pola hidup berfoya-foya,boros,irit,mewah,
sederhana
musik jazz, rock, keroncong.
kendaraan mobil, motor, bus
membawa menjinjing, memikul, memanggul,
menenteng, menggendong
memotong memenggal, mengiris, menebang,
memancung, menggergaji
D. Penggunaan Kamus dalam Mencari Bentuk,
Kategori,danMaknaKata
Kamus dapat membantu seseorang untuk mencari variasi bentukan
kata, kelas kata, dan contoh-contoh pemakaiannya, termasuk pelafalan,
pedoman kata, dan bentuk ungkapannya. Kamus disusun berdasarkan
abjad yang disertai penjelasan tentang makna dan pemakaiannya. Di dalam
kamus, terdapat keterangan tentang hal-hal berikut.
(1) Labelbidangilmu,contoh:Adm(administrasidankepegawaian),Anat
(anatomi)Ark(arkeologi).
(2) Dialek, contoh Jw untuk Jawa, BT untuk Batak, Ar untuk Arab, Bld
untuk Belanda.
(3) Ragambahasa,contohcak untuk cakapan, hor untuk ragam hormat, kas
untuk ragam kasar.
(4) Penjelasanmakna,contohberlari:berjalankencang,
(5) Label kelas kata, contoh a (adjektiva), adv (adverbia), n (nomina), v
(verba)
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 78
Contoh Lembaran Kamus
E. BentukanKata/FrasaBaru
Kata adalah satuan terkecil dari tata bahasa yang bermakna. Makna kata
merupakan perwujudan kesatuan perasaan dari pikiran yang disampaikan
lewat bahasa. Dari satu kata, dapat kita bentuk belasan kata turunannya.
Bentuk berimbuhan tersebut menunjukkan pertalian yang teratur antara
bentuk dan maknanya. Dalam perkembangan bahasa Indonesia, kata banyak
mengalami penambahan. Hal ini terjadi karena adanya proses asimilasi
dan adaptasi dari kosakata asing dan juga akibat paradigma atau proses
analogi. Paradigma artinya pembentukan kata mengikuti pola atau contoh
yang sudah ada, sedangkan analogi membandingkan pola yang sudah ada.
Pada dasarnya keduanya sama.
Contohbentukankataberdasarkanparadigma:
Cuci
Mencuci(perbuatan)pencuci(pelaku)pencucian(proses)cucian(hasil)
79 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Berlaku pula pada kata-kata di bawah ini.

Pelaku Proses Hasil Perbuatan
potong pemotong pemotongan potongan memotong
cetak pencetak pencetakan cetakan mencetak
lukis pelukis pelukisan lukisan melukis
tanam penanam penanaman tanaman menanam
aj ar pelaj ar pembelaj aran aj aran mengaj ar
Bentuk Dasar
Makna
Contohpembentukanfrasaberdasarkanparadigmaatauanalogi.
1. Darifrasarumahproduksi,munculfrasayangsejenis,yaitu:
− rumah singgah
− rumah potong
− rumah duka
− rumah industri
2. Darifrasabawahsadar,munculfrasabaru:
− bawah umur
− bawah standar
− bawah tanah
− bawah harga
3. Daribentukankatapramugari dan pramuniaga, muncullah bentukan
kata:
− pramuwisma
− pramusiwi
− pramusaji
− pramuria
− pramuwisata
− pramujasa
4. Darifrasaalih bahasa,timbulfrasa:
− alih ragam
− alih ilmu
− alih kuasa
− alih haluan
− alih teknologi
5. Darifrasahari rayamunculfrasabaru:
− jalan raya
− pasar raya
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 80
− panen raya
6. Dari kata tamu agung muncul
− jaksa agung
− upacara agung
− hakim agung
− jumat agung
− dewan pertimbangan agung
− mahkamah agung
− karya agung
7. Dari gabungan kata angkattopi timbul gabungan kata:
− angkat diri
− angkat bicara
− angkat sumpah
− angkat sembah
− angkat bahu
− angkat kaki
8. Dari istilah adipati, timbul istilah:
− adibusana
− adikuasa
− adidaya
− adikarya
Contoh pembentukan kata yang dipengaruhi oleh imbuhan asing.
− -if :aktif,agresif
− -er : komplementer, parlementer
− -al : struktur, normal
− -is : teknis, praktis
− -isasi : modernisasi, normalisasi, legalisasi
− pasca- : pascapanen, pascasarjana
− pra- : prasejarah, prakarsa.
F. Pemakaian Kata , Frasa, dan Kalimat yang Kurang
Tepat
Dalam kegiatan berkomunikasi baik secara lisan maupun tulisan,
adakalanya pemakai bahasa tidak cermat memilih kata yang dituangkannya
di dalam kalimat. Akibatnya, kalimat yang diungkapkan tidak tepat atau
81 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
tidak sesuai dengan kaidah yang benar. Kesalahan itu dapat terjadi pada
penggunaan bentuk kata (proses morfologi), pemakaian kelompok kata
(frasa),pemilihanungkapan,ataukeefektifankalimat.
Dalam bentuk lisan, kesalahan itu terjadi disebabkan oleh hal-hal
berikut.
1. Kesalahanpenggunaanimbuhan(bentukkata).
Contoh :
a. PintumasukSMK3akandiperlebarkan.(salah)
PintumasukSMK3akandilebarkanatauPintumasukSMK3akan
diperlebar.(benar)
b. Jangan dibiasakan mengenyampingkanmasalahitu.(salah)
Jangan dibiasakan mengesampingkanmasalahitu.(benar)
c. Rudi sedang mencatpagarrumahnya.(salah)
Rudi sedang mengecat pagarrumahnya.(benar)
2. Ketidaktepatanpemakaianfrasa(kelompokkata).
Contoh :
a. Untuk sementara waktu, siswa tidak bisa praktik karena ruangan
sedangdirenovasi.(salah)
Untuk sementara siswa tidak bisa praktik karena ruangan sedang
direnovasi.(benar)
b. Bus Parahiyangan sudah dinyatakan laik darat.(salah)
Bus Parahiyangan sudah dinyatakan laik jalan.(benar)
3. Kesalahankalimat
a. Di dalamdarahorangitumengandungvirusHIV.(salah)
DarahorangitumengandungvirusHIV.(benar)
b. Untuk peningkatan mutu pendidikan dari sekolah swasta dimana
memerlukanketekunandankeuletanparapamong.(salah)
Untuk meningkatkan mutu pendidikan sekolah swasta diperlukan
ketekunandankeuletanparapamongnya.(benar)
Kesalahan juga banyak terjadi akibat penggunaan bentukan kata atau
frasa yang baru yang tidak lazim atau tidak benar secara kaidah bahasa.
Ketidaktepatanbentukankataataufrasajugadapatdisebabkankesalahan
secara analogi atau paradigma.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 82
Perhatikanlah contoh di bawah ini.
a. pertanggungan jawab dalam kalimat “Laporan pertanggungan jawab
gubernur telah diterima sebagian besar anggota dewan.” (tidak tepat
secarakaidah/tidaklazim)seharusnyapertanggungjawaban.
b. goreng pisang dalam kalimat “Ia membeli goreng pisang untuk adiknya.”
(tidaktepatsecarakaidah/tidaklazim)seharusnyapisang goreng.
c. pengangguran dalam kalimat “Ia menjadi pengangguran setelah
perusahaannyabangkrut.”(salahsecaraanalogi)seharusnyapenganggur
dari kata menganggur (verba)-penganggur (nomina)-pengangguran
(nominaproses)
d. ruang rokok untuk ruang khusus merokok (tidak lazim) meskipun
dianalogikan kepada ruang tunggu untuk ruang khusus menunggu.
e. Bentuk kata pemelajaran, tidak tepat secara analogi, sebab kata tersebut
berasal dari kata belajar yang diberi imbuhan pe-an, seperti kata berhenti
menjadi pemberhentian.
f. Kata penglepasan,pada kalimat “ Penglepasan siswa kelas XII dimeriahkan
dengan kegiatan pentas seni dari siswa-siswi.” Tidak tepat secara
analogi,sebab kata dasarnya lepas,jika diberi imbuhan pe-an,menjadi
pelepasan.
Untuk membuat kalimat yang cermat, kita harus memahami ciri kalimat
efektif.Kalimatyangbaikatauefektifmempunyaiciri-cirisepertiberikut.
a. Kepadanan
− Memiliki S dan P dengan jelas.
(didepanStidakbolehadakatadepandandidepanPtidakboleh
adakatapenghubungyang)
Contoh:
(1) Semuamahasiswaperguruantinggiiniharusmembayaruang
kuliah.(benar)
(2) Bagisemuamahasiswaperguruantinggiiniharusmembayar
uangkuliah.(salah)
− Tidak terdapat S ganda.
Contoh:
(1) Diapulangsetelahdiamembeliberbagaikebutuhan.(salah)
(2) Diapulangsetelahmembeliberbagaikebutuhan.(benar)
− Kata penghubung intra kalimat tidak dipakai dalam kalimat
tunggal.
Contoh:
(1) Kami datang agak terlambat. Sehingga kami tidak dapat
mengikutiacarapertama.(salah)
83 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
(2) Kami datang agak terlambat sehingga kami tidak dapat
mengikutiacarapertama.(benar)
b. Keparalelan
Persamaan bentuk kata digunakan dalam kalimat yang mengandung
rincian.
Contoh:
(1) Hargaminyakdibekukandandinaikkansecarabertahap(benar)
(2) Harga minyak dibekukan atau kenaikan secara bertahap.
c. Kehematan
Kehematanmenggunakankataataufrasa
− Menghindarkan penjamakan bentuk jamak
Contoh:
(1) Paratamu-tamumencicipihidanganyangdisediakan.(salah)
(2) Paratamumencicipihidanganyangdisediakan.(benar)
− Penggunaan kata-kata yang berlebihan.
Contoh:
(1)Iamemakaibajuwarnamerah.(salah)
(2)Iamemakaibajumerah.(benar)
d. Kepaduan(tegasdanlugas)
− Hindarkan kalimat bertele-tele.
Contoh:
(1) Kita harus dapat mengembalikan kepada kepribadian kita,
orang-orang kota yang telah terlanjur meninggalkan rasa
kemanusiaan itu dan yang secara tidak sadar bertindak ke luar
dari kepribadian manusia Indonesia dari sudut kemanusiaan
yangadildanberadab.(salah)
(2) Kitaharusdapatmengembalikankepribadiankitayangsudah
ke luar dari rasa kemanusiaan dan dari kepribadian manusia
Indonesia yang adil dan beradab.
e. Kecermatan
Kecermatan pemakaian kata, penulisan kata, penggunaan tanda baca.
Contoh : Dua puluh lima ribuan.
Bisadiartikanduapuluhlimalemaruangribuan(Rp25.000,-)
Atau
Dua puluh lembar uang, lima ribuan.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 84
RANGKUMAN
A. KlasifkasiKataberdasarkanKelasKata
Secara umum kelas kata terdiri atas 5 macam, yaitu:
(1) Katakerja(verba)
(2) Katasifat(adjektif)
(3) Kataketerangan(adverbia)
(4) Kata benda (nomina), kata ganti (pronomina), kata bilangan
(numeralia)
(5) Kata tugas yang dapat dirinci menjadi empat jenis kata, yaitu
(1) kata depan, (2) kata sambung, (3) kata sandang, (4) kata
seru, dan (5) partikel.
B. KlasifkasiKataBerdasarkanBentukKata
Dari segi bentuknya, kata dapat dibedakan atas empat macam, yaitu :
(1) KataDasar
(2) KataTurunan
(3) KataUlang
(4) KataMajemuk

C. KlasifkasiKataBerdasarkanMaknaKata
Selain proses bentukan kata, makna kata juga dapat ditimbulkan
oleh dua hal, yaitu:
(1) Makna kata berdasarkan hubungan referensial yang dibedakan
menjadi makna denotatif, makna konotatif, dan makna idiomatik
(ungkapan).
(2) Maknakataberdasarkanhubunganantarmaknayangterdiriatas
Makna kata berdasarkan hubungan antarmakna terdiri atas: sinonim,
antonim, dan hiponim.
D. PenggunaanKamusdalamMencariBentuk,Kategori,danMakna
Kata
Kamus dapat membantu seseorang bukan saja untuk mencari seperti
variasi bentukan kata, kelas kata dan contoh-contoh pemakaiannya,
termasukpelafalan,pedomankata,danbentukungkapannya.
85 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
E. PemakaianKata,Frasa,danKalimatyangKurangTepat
Dalam kegiatan berkomunikasi secara lisan atau tulisan masih
terdapat pemakaian bahasa yang kurang cermat dalam memilih kata
yang digunakan pada kalimat sehingga kalimat tidak sesuai dengan
kaidah bahasa yang benar. Ketidakcermatan dapat terjadi pada pemilihan
bentuk kata (proses morfologi, pemakaian kelompok kata (frasa),
pemilihan ungkapan, atau keefektivitasan kalimat. Kesalahan juga bisa
terjadi karena bentukan kata yang baru atau tidak lazim.
TUGASMANDIRI
Agar Anda lebih memahami materi pelajaran ini, kerjakanlah tugas
berikut.
1. Bacalah bacaan atau artikel di awal bab ini.
2. Dafarkanlah kata yang terdapat dalam bacaan berdasarkan kelas
katanya.
3. Carilah kata yang bermakna denotatif, konotatif, dan berbentuk
ungkapan.
4. Dafarkanlahkatayangbersinonim.
5. Tulislahantonimdarikatabersinonimpadano.4.
6. Tulislah kalimat yang menurut Anda kurang tepat pemakaian kata
ataufrasanya.Lalu,perbaikilahkalimattersebut.
UJIKOMPETENSI
I.Pilihlahjawabanyangpalingtepatdaripernyataandibawahini!
1. Kata bulanyangdipakaidalamartidenotatifterdapatpadakalimat
a Ia kejatuhan bulan.
b. Jangan mau menjadi bulan-bulanan.
c. Ia berbulan madu ke Bali.
d. Telah dua bulan ia pergi.
e. Bulan muda dua hari lagi.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 86
2. Kalimatdibawahinibermaknakonotatif,kecuali
a. Ketika berjumpa denganku, ia membuang muka.
b. Tampaknya ia tidak ambil pusing terhadap masalah yang dihadapinya.
c. Bu Aziz hanya dapat mengurut dada melihat tingkah laku anaknya
yang tidak senonoh.
d. Zainab menjadi bunga desa tempat ia dilahirkan.
e. Sepasang merpati itu bertengger di atas genting rumah tetangga.
3. Darifrasaalihbahasa,timbulahbentukankatadibawahini,kecuali
a. alih ilmu
b. alih teknologi
c. alih-alih
d. alih kuasa
e. alih haluan
4. Kalimatberikutyangberkonotasihalus(positif)ialah
a. Gerombolanperampokitutelahdiringkuspolisi.
b. Ayahnya bekerja sebagai buruh pabrik.
c. Sudah sepuluh tahun ia menjadi karyawan disebuah perusahaan
swasta.
d. Bini Pak Ahmad bernama Ani.
e. Daerahitusudahbebasbutahuruf.
5. Karena setetes darah, banyak jiwa yang diselamatkan.
Arti kata jiwa dalam kalimat di atas sama artinya dengan kata jiwa
dalam kalimat
a. Dokter Sadikin memeriksa jiwa pasien yang bernama Sinyo.
b. Dokter penyakit jiwa sedang memeriksa pasiennya.
c. Oh Tuhan, jiwa ini milikMu juga.
d. Jiwa anak itu terganggu.
e. Sebaiknya badan dan jiwa kita harus sehat.
6. Deretankataberikutyangtermasukkatasifat
a. melatih, berusaha, mudah
b. makan, lari, baik-buruk
c. mobil, pemuda, mainan
d. murah, sulit, luas
e. pemandangan, pertunjukan
87 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
7. Pamanku menjadi kambing hitam dalam masalah itu.
kambing hitam pada kalimat di atas bermakna
a. tumpuan kesalahpahaman
b. tumpuan kemarahan
c. tumpuan kesalahan
d. tumpuan ketidakadilan
e. tumpuan harapan
8. Kata-kata di bawah ini yang termasuk kata ulang kata dasar
a. berjalan-jalan, dibesar-besarkan
b. gerak-gerik, huru-hara
c. anak-anak, buku-buku
d. kunang-kunang, ubur-ubur
e. porak-poranda, gerak-gerik
9. Ungkapan lama yang jarang digunakan lagi adalah
a. hilang ingatan
b. tunawisma
c. matanya bagai bintang timur
d. ranjau pers
e. sampah masyarakat
10. Kalimat berikut yang mengandung kata berantonim, kecuali
a. Orang itu miskin harta namun kaya hati.
b. Biaya transpor pulang-pergi ditanggung panitia.
c. Menjenguk atau mengunjungi orang sakit itu menumbuhkan rasa
kesetiakawanan.
d. Besar-kecil, tua-muda berbondong-bondong ke lapangan menyak-
sikan pertandingan itu.
e. Penderitaan dan kebahagiaan adalah irama hidup.
11. Sebagai pemimpin, ia selalu menganjur-anjurkan kedisiplinan kepada
bawahannya.
Bentuk dasar kata menganjur-anjurkan pada kalimat di atas adalah
a. anjur
b. menganjur
c. anjurkan
d. menganjurkan
e. menganjur-anjur
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 88
12. Pasangan antonim komplementer
a. marah-hiau
b. mur-baut
c. gadis-jejaka
d. ibu-bapak
e. sabtu-minggu
13. Penggunaanakhiranyangtepatterdapatpadakalimat
a. Prof.SumintroekonomiwanterkemukadiIndonesia.
b. Prof.B.J.Habibieilmuwankebanggaanbangsa.
c. Prof.Dr.NugrohoSusantosejarahwanterkenal.
d. Ayahnya seorang geologiawan.
e. K.H. Hasan Basri rohaniawan yang rendah hati.
14. Penulisankatamajemukdibawahiniyangbenar
a. siap tempur
b. matahari
c. kaca mata
d. sapu tangan
e. ibu-bapa
15. Contohkalimatyanghematkata(tanpakata-katamubazir)adalah
a. Dafarnama-namakaryawanperludibagikanhariini.
b. Masalah-masalah sosial perlu didiskusikan sedini mungkin.
c. Sekretaris adalah merupakan tangan kanan bosnya.
d. Para pejabat-pejabat perusahaan sedang mengadakan rapat.
e. Para hadirin sekalian dimohon berdiri.
16. Kalimat berikut yang termasuk kalimat rancu adalah
a. Kepada hadirin, kami ucapkan selamat datang.
b. PertandinganantaraPSISdanPersiaberakhirseri.
c. Novel ini mengisahkan pelarian seorang gadis.
d. Dalam pembangunan gedung itu menggunakan baja tahan karat.
e. Sekolah kami akan mengadakan bazar dalam rangka ulangan
tahunyangke-35.
17. Kalimat yang menggunakan kata dalam makna umum adalah
a. Ia menggambar mobil-mobilan.
b. Adik sedang belajar menggambar.
c. Digambarnya pula gunung-gunung.
89 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
d. Kadang-kadang menggambar pohon-pohon.
e. Bunga mawar adalah bunga kesukaannya.
18. Di bawah ini terdapat kalimat yang menggunakan kata khusus
kecuali
a. Amir sedang menengok bibinya yang sakit.
b. Mereka melihat pemandangan yang indah.
c. Ia menoleh kepada adiknya.
d. Sarjana itu sedang mengamati hasil temuannya.
e. Karena pergaulannya kurang baik, membawa pengaruh buruk
pada ahlaknya.
19. Peraturan itu berlaku bagi seluruh mahasiswa tanpa kecuali.
Kejanggalan kalimat itu terjadi akibat penggunaan kata
a. seluruh
b. seluruh tanpa kecuali
c. berlaku
d. tanpa kecuali
e. bagi
20. Setiap hari Sabtu dan Minggu kami sekeluarga selalu berkumpul di
rumah Nenek.
Kalimat tersebut menggunakan antonim
a. polarasi
b. resasional
c. hierarki
d. suksesif
e. biner
II.Jawablahsoal-soaldibawahinidengantepatdanbenar!
1. Carilah kata-kata yang bersinonim dalam wacana di atas!
2. Carilah kata-kata berantonim dalam wacana tersebut!
3. Adakahpemakaiankata,kelompokkata,atauidiomyangkurangtepat,
Jika ada perbaikilah sehingga menjadi tepat!
4. Adakah penggunaan kata berkonotasi dan berdenotasi dalam wacana
tersebut? Kelompokkanlah mana kalimat yang bermakna denotasi dan
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 90
mana yang bermakna konotasi!
5. Sebutkan jenis-jenis ungkapan!
6. Buatlah masing-masing dua kalimat yang menggunakan kata umum
dan kata khusus!
7. Carilah 5 contoh pembentukan kata yang dipengaruhi oleh imbuhan
asing.
8. Jelaskan penyebab terjadinya kesalahan penggunaan kalimat dalam
bentuk lisan dan tulisan!
9. Jelaskanklasifkasikataberdasarkankelaskata!
10. Perbaikilah kalimat berikut agar menjadi kalimat yang benar!
− Banyak murid-murid pergi berdarma wisata ke Bali.
− Pacar saya paling tercantik sendiri di kota ini.
− Yang naik sepeda jalannya pelan-pelan dikarenakan banyak anak-anak.
− Peristiwa itu terjadi disebabkan karena kekurangwaspadaan kita.
91 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Kompetensi
Dasar
- Menggunakan secara lisan kalimat tanya/pertanyaan
dalam konteks bekerja
Indikator
- Mengajukan pertanyaan yang sesuai dengan topik
pembicaraan untuk menggali informasi secara santun
- Mengajukan pertanyaan yang memerlukan jawaban ya
atau tidak , misalnya untuk memantapkan pemahaman
(klarifkasi), meminta kepastian (konfrmasi)
- Menggunakan pertanyaan retorik dengan menerapkan
konsep dan ciri kalimat retorik
- Mengajukan pertanyaan secara tersamar dengan kalimat
tanya untuk tujuan selain bertanya, seperti: memohon,
meminta, menyuruh, mengajak, merayu, menyindir,
meyakinkan, menyetujui, atau menyanggah
Materi kalimat tanya telah kita pelajari pada kelas X. Pada bab ini, kembali akan
dipelajari kalimat tanya sebagai pengingat dan penguat. Setelah mempelajari
materi ini, kita diharapkan akan makin memahami hal-hal yang berkaitan
dengan kalimat tanya dan dapat menggunakannya dengan benar dan tepat
dalam berkomunikasi.

BAB 5
MENGGUNAKAN SECARA LISAN KALIMAT
TANYA/PERTANYAAN DALAM KONTEKS BEKERJA
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 92
Wacana
Pertumbuhan Kami Paling Tinggi
Pertumbuhan ekonomi berkaitan erat dengan kesejahteraan masyarakat.
Melihat kenyataan itu, Pemkab Sragen berupaya memacu pergerakan sektor-
sektor ekonomi. Mengupas strategi yang dialankan Pemkab Sragen, berikut
petikan wawancara SINDO dengan Bupati Sragen, Untung Wiyono.
Bagaimana visi Anda dalam membangun Sragen?
Kami berkeinginan menjadikan Sragen sebagai kabupaten cerdas
yang dilandasi kemandirian, kemajuan, dan penegakan supremasi hukum.
Didukung SDM berkualitas yang bertumpu pada ilmu pengetahuan
dan teknologi, hasil pertanian, industri, pariwisata, perdagangan/jasa,
kesehatan, wawasan lingkungan, dalam rangka mewujudkan keadilan dan
kesejahteraan lahir batin.
Apa program-program Pemkab untuk mengentaskan kemiskinan?
Pemkab membuat program dan kegiatan yang secara langsung maupun
tidak langsung dapat meningkatkan pendapatan masyarakat sekaligus
dapat mengurangi jumlah pengangguran. Kebiakan ini diarahkan agar
dapat mengurangi penduduk yang hidup di bawah garis kemiskinan. Untuk
itu, program dan kegiatan harus diarahkan pada kebutuhan mendasar bagi
masyarakat miskin.
Bagaimana efektivitas program-program tersebut?
Sangat efektif, terbukti pertumbuhan ekonomi terus mengalami
peningkatan. Tercatat, pada kuartal pertama 2007, pertumbuhan ekonomi
Sragen mencapai 6,8%. Angka ini paling tinggi di wilayah Karesidenan
Surakarta. Angka kemiskinan secara riil juga terus mengalami penurunan
setiap tahunnya.
Apa kendala yang dihadapi dalam menjalankan program-program itu?
Kendala awal adalah data yang kurang akurat. Selain itu, infrastruktur
yang sebelumnya belum memadai.
93 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Apa rencana Anda selanjutnya terkait program pengentasan kemiskinan?
Desentralisasi desa dan kecamatan yang berorientasi pada pelayanan
masyarakat, serta menempatkan tiga PNS di tiap-tiap desa. Satu PNS
adalah Petugas Penyuluh Lapangan (PPL) yang tugasnya mengarahkan
petani di desa untuk membangun ekosistem pertanian, peternakan, dan
perikanan yang ideal. Dua PNS lainnya fokus pada program pemberdayaan
masyarakat desa.
Anda puas dengan hasil yang telah diperoleh?
Yang jelas, kemajuan harus terus ditingkatkan untuk mewujudkan
masyarakat Sragen yang sejahtera.
Apa program terobosan yang akan dilakukan pada masa mendatang?
Salah satunya membuat program pendataan tanah. Program ini ber-
basis desa. Dengan berbasis desa, Pemkab berharap proses sertifkasi tanah
di Sragen bisa dilakukan secara serempak.
Kemudian, kami akan terus menjalankan program one-stop service.
Namun, keberadaan pelayanan terpadu satu pintu hanyalah salah satu
sarana untuk meningkatkan kualitas pelayanan masyarakat. Ke depan tetap
diperlukan berbagai inovasi lain. Manajemen pemerintahan harus inovatif,
tidak boleh berhenti.
(Sumber: Berita Kota Minggu, 6 Januari 2008)
A. Pengertian dan Fungsi Kalimat Tanya
Kalimat tanya adalah kalimat yang disampaikan dengan maksud
mendapat jawaban berupa informasi, penjelasan, atau pernyataan. Jawaban
atas kalimat tanya dapat berbentuk jawaban pendek atau panjang.
Kalimat tanya berfungsi untuk meminta jawaban berupa penjelasan,
untuk menggali informasi, untuk klarifkasi, atau konfrmasi. Kalimat
tanya juga digunakan untuk tujuan-tujuan tertentu yang disebut kalimat
tanya tersamar. Selain itu, ada juga kalimat tanya yang diajukan tanpa
memerlukan jawaban yang disebut kalimat tanya retoris. Pada pelajaran
ini, macam-macam kalimat tanya seperti itu akan kita pelajari kembali.
Perhatikan contoh keragaman kalimat tanya berikut.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 94
1. Apakah Anda bersedia ditugaskan di sini? (konfrmasi)
2. Dari semua barang yang ditawarkan ini, mana yang Anda pilih?
(pilihan)
3. Di manakah alamat Anda? (menggali informasi tentang tempat)
4. Apakah kita tidak malu menjadi bangsa yang terkenal karena korupsinya?
(retorik)
5. Siapa yang tidak hadir hari ini? (menanyakan orang)
6. Bagaimana perasaannya, hanyalah Tuhan yang tahu. (retorik)
7. Diakah orang yang kemarin mencarimu? (klarifkasi)
8. Sudahkah Anda terima kiriman saya kemarin? (konfrmasi)
9. Dapatkah Anda menyelesaikan tugas ini dengan cepat? (menyuruh)
10. Siapakah yang tidak ingin sukses? (retorik)
B. Jenis Kalimat Tanya
Dilihat dari pemakaian secara lisan maupun kalimat, kalimat tanya
dapat dibedakan menjadi kalimat tanya biasa, tanya retoris, kalimat tanya
bertujuan untuk klarifkasi atau konfrmasi, dan kalimat tanya tersamar.
1. Kalimat Tanya Biasa
Salah satu ciri kalimat tanya ialah menggunakan kata tanya. Kata tanya
biasanya digunakan untuk pertanyaan yang bertujuan meminta penjelasan
atau menggali informasi. Di bawah ini adalah tabel yang berisi macam-
macam kata tanya dan tujuan penggunaannya berikut jawaban yang
diinginkan oleh penanya. Perhatikan dengan saksama.
95 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

apa (-kah) ? suatu benda/binatang ya/tidak/bukan
bagaimana (-kah) ? cara/proses menj elaskan cara/proses kerj a sesuatu
berapa (-kah) ? j umlah menj elaskan j umlah tertentu (yang pasti)
bilamana (-kah) ? waktu menj elaskan waktu/kurun waktu tertentu
dari mana (-kah) ? arah/asal menj elaskan arah/asal muasal sesuatu
di mana (-kah) ? tempat menj elaskan nama/lokasi/posisi tempat
kapan (-kah) ? waktu menj elaskan waktu/kapan peristiwa terj adi
keberapa (-kah) ? urutan menjelaskan urutan ke berapa dari sejumlah angka
kemana (-kah) ? arah/tuj uan menj elaskan arah/tuj uan yang dituj u
mana (-kah) ? pilihan menj elaskan satu/beberapa dari sej umlah pilihan
mengapa (-kah) ? alasan menj elaskan alasan/sebab terj adinya sesuatu
siapa (-kah) ? orang/manusia menyebutkan nama dan penj elasan seperlunya
dengan apa (-kah) ? alat menyebutkan alat yang digunakan
Kata
Tanya
Partikel Menanyakan Jawaban yang di inginkan
Kalimat tanya untuk menggali informasi umumnya digunakan
pada saat wawancara atau dalam dialog yang membahas tentang suatu
hal. Pertanyaan diajukan kepada narasumber yang diharapkan dapat
memberikan informasi atau penjelasan yang lebih dalam sesuai dengan
yang ditanyakan.
2. Kalimat Tanya Retorik
Kalimat tanya retorik ialah kalimat tanya yang tidak memerlukan
jawaban atau tidak mengharuskan adanya jawaban. Kalimat tanya retorik
cenderung bersifat pernyataan hanya untuk mencari perhatian atau
bermaksud memberi semangat, gugahan, atau kritik. Kalimat tanya retorik
sering digunakan dalam pidato-pidato atau orasi.
Contoh kalimat tanya retorik:
1. Saya tidak habis pikir mengapa dia menolak penugasan itu.
2. Siapa yang bekerja keras, dialah yang akan menjadi orang sukses.
3. Mana mungkin kita mampu membalas jasa kedua orang tua kita.
4. Apakah kita harus kembali diajah?
5. Bagaimana bisa tugasmu selesai, kerjaanmu hanya bermalas-malasan.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 96
Ciri-ciri pertanyaan retorik:
(1) berbentuk pertanyaan dan penegasan,
(2) terkadang menggunakan kata tanya,
(3) tidak memerlukan jawaban,
(4) orang yang bertanya dan yang ditanya sama-sama mengetahui
jawabannya,
3. Kalimat Tanya untuk Konfrmasi dan Klarifkasi
Untuk melakukan klarifkasi (penjernihan) maupun konfrmasi
(pembenaran/penegasan), kita perlu mengajukan pertanyaan yang
jawabannya cukup perkataan ya atau tidak, atau ya atau bukan. Ada
beberapa hal yang menandai bentuk pertanyaan untuk konfrmasi atau
klarifkasi, yaitu seperti berikut.
1. Menggunakan informasi tanya dengan menekankan kata-kata yang
dipentingkan.
Contoh:
1. Dia yang memukulmu kemarin?
2. Kalau begitu, Bapak yang berada di belakang ini semua?
2. Menggunakan partikel –kah.
Contoh:
1. Inikah yang dinamakan cinta?
2. Anak itukah yang dicari polisi?
3. Menggunakan kata tanya apa atau apakah.
Contoh:
1. Apa Bapak bersedia hadir pada acara peresmian kantor baru?
2. Apakah Anda masih sekolah?
4. Menggunakan kata tidak atau bukan sebagai unsur penegas.
Contoh:
1. Kamu jadi berangkat ke Bandung atau tidak?
2. Minuman ini beralkohol atau bukan?
5. Sebagai penegasan benar tidaknya, menggunakan kata bantu: benar,
betul, jadi benar, dan jadi.
97 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Contoh:
1. Jadi dia yang mendapat rangking satu?
2. Betul kamu yang mengambil uangnya?
3. Jadi benar ayahnya seorang pembunuh bayaran?
4. Benar dia adik kandungmu?
4. Kalimat Tanya Tersamar
Kalimat tanya tersamar adalah kalimat yang berisi pertanyaan yang
diajukan secara tidak langsung bukan untuk menggali informasi, klarifkasi,
dan konfrmasi melainkan mengandung maksud-maksud lain.
Beberapa model kalimat tanya tersamar antara lain seperti berikut.
a. Kalimat tanya tersamar untuk tujuan memohon
Contoh:
1. Terima kasih Anda tidak membuang sampah di sini.
2. Tidak keberatan, kan kamu membawa koper ini?
3. Sudikah Anda mampir ke rumahku?
b. Kalimat tanya tersamar untuk tujuan meminta
Contoh:
1. Masakan Anda kelihatannya lezat sekali?
2. Dapatkah Anda membantu saya hari ini.
3. Bolehkah makanan ini saya cicipi?
c. Kalimat tanya tersamar untuk tujuan menyeluruh
Contoh:
1. Saya sangat senang jika Anda yang mengerjakan proyek ini.
2. Sebaiknya kamu jangan berangkat sekarang.
3. Maukah adik membantu saya menyelesaikan tugas ini?
d. Kalimat tanya tersamar untuk tujuan mengajak
Contoh:
1. Bukankah Bapak bersedia untuk menyumbangkan tenaga dan
pikiran dalam kegiatan amal ini?
2. Siapkah Anda berangkat sekarang?
3. Bisakah membuat kopi untuk kakek?
e. Kalimat tanya tersamar untuk tujuan merayu
Contoh:
1. Kamu orang yang sangat handal dalam mengatasi berbagai
masalah.
2. Tentunya Anda yang pantas menduduki jabatan ini.
3. Siapa yang menolak berteman dengan orang sebaik kamu?
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 98
f. Kalimat tanya tersamar untuk tujuan menyindir (mengkritik, mencela,
mengejek)
Contoh:
Memang ya pekerjaannya luar biasa sulit sehingga kamu bisa
menyelesaikannya dengan cepat. Pekerjaan semudah ini tidak bisa
diselesaikan dengan benar.
g. Kalimat tanya tersamar untuk tujuan meyakinkan
Contoh:
1. Saya rasa kamu mampu mengerjakannya hari ini?
2. Haruskah aku bersumpah agar kamu percaya?
3. Inikah hasil usahamu.
h. Kalimat tanya tersamar untuk tujuan menyetujui
Contoh :
1. Saya kira kita sama-sama sependapat bukan?
2. Mana mungkin saya menolak ajakanmu?
3. Anda setuju dengan usulnya, kan?
i. Kalimat tanya tersamar untuk tujuan menyanggah
Contoh:
1. Apakah tidak lebih baik kita tanyakan dulu masalah yang
sebenarnya?
2. Kamu ke sini tidak takut dimarahi ayahmu?
3. Mengapa kamu datang lagi ke sini?
j. Kalimat tanya tersamar untuk menawarkan sesuatu
Contoh:
1. Boleh saya bantu?
2. Anda membutuhkan bantuan saya?
3. Masih adakah yang perlu saya bawakan?
99 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
C. Mengutarakan Pendapat dengan Kalimat Tanya
yang Santun
Dalam melakukan tanya jawab, kita perlu memperhatikan adab
bertanya karena hal ini berhubungan dengan si penanya dan pihak yang
ditanya. Adab bertanya yang baik menjadi faktor utama sebagai penentu
respons pihak yang ditanya.
Teknik atau cara mengajukan pertanyaan adalah seperti berikut.
(1) Pertanyaan yang diajukan harus relevan dengan topik yang akan
ditanyakan.
(2) Pertanyaan yang diajukan benar-benar mengesankan keingintahuan
terhadap sesuatu yang menjadi topik pertanyaan.
(3) Pilihlah kata-kata yang baik dan santun agar mendapat respons yang
baik dan mendapatkan jawaban yang memuaskan.
(4) Hindari pertanyaan yang bersifat subjektif/pribadi.
(5) Pertanyaan yang diajukan harus bersifat menggali informasi sebelum
berlanjut ke pertanyaan yang bersifat konfrmasi atau penegasan.
(6) Jika pertanyaan menuntut sebuah tanggapan atau penilaian dari
narasumber, ada baiknya jika pertanyaan diawali dengan kata ”menurut
pendapat ...”. Misalnya, ”Menurut pendapat Bapak, bagaimana peranan
pemuda dalam memberantas penyalahgunaan narkoba?”
(7) Pertanyaan tidak bersifat memaksa, menekan, atau cenderung bertujuan
mencari kesalahan narasumber.
Contoh:
Berikut ini contoh sebuah wawancara reporter Berita Kota dengan
penyanyi dangdut legendaris A. Rafq seputar keluarga dan rumah
tangganya.
Wartawan : “Bagaimana Bang Rafq membina keluarga dan berhasil
awet hingga sekarang?”
A. Rafq : “Pertama begini, saya punya satu prinsip dalam mengurus
dan memelihara rumah tangga, semua itu konsepnya
lain.”
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 100
Wartawan : “Jadi, bagaimana dulu waktu memilih istri?”
A. Rafq : “Istri saya itu tipe orang yang tidak pernah ke sana
kemari, nggak pernah macam-macam. Istri saya orang
rumahan, orang pendidikan yang betul-betul dididik oleh
keluarga yang baik yang menurut saya cukup terhormat
dan dengan landasan agama. Saya menikah dengan jalur
agamis.”
Wartawan : “Maksudnya?”
A. Rafq : “Sampai saat ini saya dekenal orang. Bahkan katanya,
sampai hari ini untuk penyanyi skill on the scope, belum
ada yang bisa ngalahin saya. Itu kata orang. Toh orang
tidak akan percaya kalau lihat penampilan saya bahwa
saya nggak mabuk, bahwa saya nggak doyan perempuan.
Orang nggak percaya bahwa sampai hari ini saya nggak
penah kenal setetes minuman. Kenapa? Karena faktor
agama. Nah itu saya bawa dalam kehidupan saya.”
Wartawan : “Anak-anak bagaimana?” “Apakah mereka juga mengikuti
keteladanan yang Anda buat?”
A. Rafq : “Alhamdulillah, wasyukurillah, kita nggak boleh takabur,
ya. Anak-anak saya itu yang namanya persoalan mendekati
narkoba, satu pun nggak ada. Merokok pun jika mungkin
terjadi dilakukan secara sembunyi-sembunyi di belakang
saya.”
Wartawan : “Hal apalagi yang Anda tekankan dalam mendidik
anak?”
A. Rafq : “Masalah shalat dan mengaji. Soal kualitas dan perkem-
bangannya itu masing-masing, tetapi saya tekankan.
Anak saya itu nggak ada satu pun yang berani ninggalin
shalat. Anak saya, jangankan ninggalin, terlambat saja
saya pukul langsung.”
Wartawan : “Keras sekali Anda mendidik anak?”
A. Rafq : “Ooh saya keras soal shalat. Tapi soal yang lain saya
dudukin. Saya ngomong, jangan gitu, jangan gini, lalu
memberi nasihat-nasihat. Tapi kalau soal shalat, lagsung
saya pukul. Langsung itu. Saya nggak ada ampun kalau
soal shalat.”
101 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Wartawan : “Efeknya bagaimana ke anak-anak?”
A. Rafq : Ooh luar biasa. Di mana saja mereka mesti shalat. dam-
paknya pun luar biasa kalau mau berpegang pada agama,
nomor satu shalat. Boleh dibuktiin.
(Sumber: Berita Kota Minggu, 27 April 2008)
Drama
Bapak
Karya: B. Selano
Bapak : “Dia putra sulungku. Si anak hilang telah kembali ulang.
Dan sebuah usul diajukan segera mengungsi ke daerah
penduduk yang serta aman tenteram. Hem ya.. ya, usulnya
dapat kumengerti. Karena ia sudah terbiasa bertahun-
tahun hidup di sana. Dalam sangkar. Jauh dari debu
prahara. Bertahun-tahun mata hatinya digelapbutakan
oleh nina bobok, lelabuai oleh si penjajah. Bertahun-tahun
semangatnya diinakkan oleh suap roti keju. Celaka. Oo,
betapa celakanya.”
Si bungsu senyum memandang.
Bungsu : “Ah, Bapak rupanya lagi ngomong seorang diri.”
Bapak : “Ya, Anakku, terkadang orang lebih suka ngomong sendiri.
Tapi bukankah tadi engkau bersama abangmu?”
Bungsu : “Ya, sehari kami tamasya mengitari seluruh penjuru kota.
Sayang sekali kami tidak berhasil menjumpai ma.....”
Bapak : “Tunanganmu?”
Bungsu : “Ah, dia selalu sibuk dengan urusan kemiliteran melulu.
Bahkan, ketika kami mendatangi asramanya, ia tidak ada.
Kata mereka, ia sedang rapat dinas. He heh, seolah seluruh
hidupnya tersita untuk urusan-urusan militer saja.”
Bapak : “Kita sedang dalam keadaan darurat perang, Nak. Dan
dalam keadaan ini bagi seorang prajurit, kepentingan negara
ada di atas segalanya. Bukan saja seluruh waktunya, bahkan
jiwa raganya. Tapi, eh, mana abangmu sekarang?”
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 102
Bungsu : “Oo, rupanya dia begitu rindu kepada bumi kelahirannya.
Seluruh penjuru kota dipotreti semua. Tapi, kurasa abang
akan segera tiba dan sudahkah Bapak menjawab usul yang
diajukannya itu?”
Bapak : “Itulah, itulah yang hendak kuputuskan sekarang ini,
Nak.”
Bungsu : “Nah, itu dia!”
Si sulung datang dengan mencangklong pesawat potret menge-
nakan kata mata hitam. Terus duduk melepas kaca mata dan
meletakkan pesawat potret di meja.”
Sulung : “Huhuh, kota tercintaku ini rupanya sudah berubah wajah
dipenuhi baju seragam menyandang senapan. Dipagari
lingkaran kawat berduri dan wajahnya kini menjadi garang
berhiaskan laras-laras mesin. Tapi, di atas segalanya, kota
tercintaku ini masih tetap memperlihatkan kejelitaannya.”
Bapak : “Begitulah, Nak, suasana kota yang sedang dikecam
keadaan darurat perang.”
Sulung : “Ya, pertanda akan hilang keamanan, berganti huru-hara
keonaran. Dan mumpung masih keburu waktu, bagaimana
dengan putusan Bapak atas usulku itu?”
Bapak : “Menyesal sekali, Nak...”
Sulung : “Bapak menjawab dengan penolakan, bukan?”
Bapak : “Ya.”
Bungsu : “Jawaban Bapak sangat biaksana.”
Sulung : “Biaksana? Ya, kaubenar, manisku. Setidak-tidaknya
demikianlah anggapanmu karena bukankah secara
kebetulan tunanganmu adalah seorang perwira TNI di sini.
Tapi maaf, bukan maksudku menyindirmu, adik sayang.”
Bungsu : “Ah, tidak mengapa. Kauhanya sedang keletihan. Menga-
sohlah dulu, ya, Abang. Mengasolah, kaubegitu capek
tampaknya. Bapak, biar aku pergi belanja dulu untuk
hidangan makan siang nanti.”
Sibungsu pergi. Si sulung mengantar dengan senyum.
Bapak : “Nak, pertimbangan bukanlah karena masa depan adikmu
103 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
seorang. Juga bukan karena masa depan sisa usiaku.”
Sulung : “Hem. Lalu? Karena rumah dan tanah pusaka ini barang-
kali, ya Bapak.
Bapak : “Sesungguhnyalah, Nak. Lebih dari itu.”
Sulung : “Oo, ya? Apa itu ya, Bapak?”
Bapak : “Kemerdekaan.”
Sulung : “Kemerdekaan? Kemerdekaan siapa?”
Bapak : “Bangsa dan bumi pusaka ini.”
Si Sulung tertawa.
Sulung : “Bapak yang baik. Bertahun sudah aku di daerah pen-
dudukan sana bersama beribu bangsa awak tercinta. Dan
aku seperti juga mereka, tidak pernah merasa menjadi
budak belian ataupun tawanan perang. Ketahuilah, Bapak,
di sana hidup merdeka.”
Bapak : “Bebaskah kamu menuntut kemerdekaan?”
Sulung : “Hoho, apa mesti dituntut. Kami di sana manusia-manusia
merdeka.”
Bapak : “Bagaimana kemerdekaan menurut kau, Nak?”
Sulung : “Hem. Di sana kami punya wali negara, bangsa awak. Di
sana, segala lapangan kerja terbuka lebar-lebar bagi bangsa
awak. Di sana, bagian terbesar tentara polisi, alat negara
bangsa awak. Di atas segalanya, kami di sana hidup dalam
damai. Rukun berdampingan antara si putih dan bangsa
awak...”
Bapak : “Dan di atas segalanya pula, di sana si Putih menjadi
dipertuan. Dan sebuah bendera asing jadi lambang
kedaulatan, lambang kuasa, penjajahan. Dapatkah itu kau-
artikan suatu kemerdekaan?”
Sulung : “Baik, baik. Tapi ya, Pak, kita bukan politisi.”
Bapak : “Nak, setiap patriot pada hakikatnya adalah seorang politisi
juga. Kendati tidak harus berarti menjadi seorang diplomat,
seorang negarawan. Dan justru, karena kesadaran dan
pengertian politiknya itulah seorang patriot akan senan-
tiasa membangkang terhadap tiap politik penjajahan.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 104
Betapapun manis bentuk lahirnya. Renungkanlah itu,
Nak. Dan marilah kuambil contoh masa lalu. Bukankah
dulu semasa kita masih hidup, keluarga dalam suasana
aman tenteram dan masa pensiun yang enak, sudah
dengan sendirinya berarti hidup dalam kemerdekaan?
Tidak Anakku! Kemerdekaan tidak ditentukan oleh semua
itu. Kemerdekaan adalah soal harga diri kebangsaan, soal
kehormatan kebangsaan. Ia ditentukan oleh kenyataan,
apakah suatu bangsa menjadi yang dipertuan mutlak
atas bumi pusakanya sendiri atau tidak. Ya, anakku,
renungkanlah kebenaran ucapan ini. Renungkanlah ......”
RANGKUMAN
A. Pengertian dan Fungsi Kalimat Tanya
Kalimat tanya adalah kalimat yang disampaikan dengan maksud
mendapat jawaban berupa informasi, penjelasan, atau pernyataan.
Kalimat tanya berfungsi untuk meminta jawaban berupa penjelasan,
untuk menggali informasi, untuk klarifkasi, atau konfrmasi. Kalimat tanya
juga digunakan untuk tujuan-tujuan tertentu yang disebut dengan kalimat
tanya tersamar.
B. Macam-Macam Kalimat Tanya
Dilihat dari pemakaian secara lisan maupun tulisan, kalimat tanya
dapat dibedakan menjadi beberapa macam, yaitu:
(1) Kalimat tanya biasa
(2) Kalimat tanya retorik
(3) Kalimat tanya untuk konfrmasi dan klarifkasi
(4) Kalimat tanya tersamar
C. Mengutarakan Pendapat dengan Kalimat Tanya yang Santun
Dalam melakukan tanya jawab, kita perlu memperhatikan adab
bertanya karena hal ini berhubungan dengan si penanya dan pihak yang
ditanya. Adab bertanya yang baik menjadi faktor utama sebagai penentu
respons pihak yang ditanya. Untuk itu, kita perlu mengetahui teknik-
105 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
teknik mengajukan pertanyaan agar tujuan kita tercapai.
TUGAS KELOMPOK
1. Bacalah wacana dialog di awal bab bersama teman sebangku Anda
dengan penghayatan. Satu orang sebagai pewawancara, satunya lagi
sebagai narasumber. Ucapkanlah secara lisan kalimat tanya dengan
intonasi yang tepat. Lakukanlah secara bergantian!
2. Analisislah bersama teman Anda, pemakaian kalimat tanya yang
terdapat pada naskah drama di atas. Klasifkasikanlah berdasarkan
macamnya!
3. Buatlah dialog singkat dengan menggunakan beberapa kalimat
tanya!
4. Jelaskanlah kalimat tanya yang Anda gunakan dalam dialog
tersebut!
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Yang bukan unsur pembentuk kalimat tanya/ciri kalimat tanya
adalah
a. Partikel -kah
b. intonasi tanya
c. tanda tanya
d. kata tanya
e. partikel -lah
2. Kata tanya yang tepat untuk menanyakan terjadinya suatu peristiwa
adalah
a. apa d. bilamana
b. siapa e. mengapa
c. bagaimana
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 106
3. Ayah Amirudin akhirnya mencarikan jodoh anaknya seorang gadis
dari marga Siregar.
Pertanyaan yang sesuai dengan kalimat tersebut adalah
a. Ayah Amirudin mencarikan jodoh anaknya?
b. Apakah anaknya diodohkan oleh ayahnya?
c. Mengapa ayahnya menjodohkan anaknya?
d. Siapakah yang mencarikan jodoh anaknya?
e. Anaknya dicarikan oleh ayahnya jodoh?
4. Kalimat tanya yang hanya memerlukan jawaban singkat berupa ya,
tidak, bukan, belum disebut kalimat tanya
a. konfrmasi
b. retorik
c. tersamar
d. memerintah
e. menggali informasi
5. Kata tanya yang tidak baku pemakaiannya dalam kalimat adalah
a. ke mana d. kenapa
b. siapa e. kapan
c. apa
6. Kalimat tanya tersamar untuk tujuan menyuruh
a. Maukah adik membantu saya menyelesaikan tugas ini?
b. Masakan Anda kelihatannya lezat sekali?
c. Sudikah Anda mampir ke rumahku?
d. Saya sangat senang jika Anda menjalankan proyek ini.
e. Dapatkah Anda membantu saya hari ini?
7. Kalimat tanya yang berisi pertanyaan diajukan secara tidak langsung
bukan untuk menggali informasi, klarifkasi, dan konfrmasi disebut
kalimat tanya
a. retorik
b. konfrmasi
c. tersemar
d. berita
e. klarifkasi
107 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
8. Kalimat tersamar untuk tujuan meyakinkan adalah
a. Saya rasa kamu mampu menjalankannya hari ini.
b. Boleh saya bantu?
c. Anda setuju, kan dengan usulnya?
d. Apakah Anda masih sekolah?
e. Saya tidak habis pikir mengapa ia menolak penugasan itu.
9. Kalimat tanya tersamar untuk tujuan menyanggah
a. Bukankah naskah ini harus diketik?
b. Benarkah makanan ini saya cicipi?
c. Bukankah kita tidak punya dana sebesar itu?
d. Inikah hasil usahamu?
e. Mana mungkin saya menolak ajakanmu.
10. Kalimat tanya tersamar untuk tujuan menyindir adalah …..
a. Haruskah aku bersumpah agar kamu percaya?
b. Pekerjaan semudah ini tidak bisa kamu selesaikan dengan benar?
c. Kamu orang yang sangat handal dalam mengatasi berbagai
masalah.
d. Jadi dia yang mendapat rangking satu?
e. Anak itu dicari polisi?
11. Kalimat tanya yang menggunakan intonasi dengan menekankan kata-
kata yang berkepentingan adalah
a. Berapakah usiamu sekarang?
b. Betul kamu yang mengambil uangnya?
c. Dia yang memukul kemarin?
d. Masih adakah yang perlu saya bawakan?
e. Apakah Bapak bersedia hadir pada acara itu?
12. Kalimat tanya tersemar untuk tujuan merayu adalah
a. Terima kasih Anda tidak membuang sampah di sini.
b. Siapkah Anda berangkat sekarang?
c. Siapa yang menolak berteman dengan orang sebaik Anda?
d. Anda membutuhkan bantuan saya?
e. Mana mungkin saya menolak ajakanmu.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 108
13. Kalimat tanya tersamar untuk tujuan menyetujui
a. Inikah hasil usahamu?
b. Benar ia adik kandung saya?
c. Siapa yang bekerja keras dialah yang akan sukses.
d. Anak itulah yang dicari polisi.
e. Tentunya Anda yang pantas menduduki jabatan itu.
14. Kalimat tanya tersamar untuk tujuan meminta
a. Sudikah Anda mampir ke rumahku?
b. Siapkah Anda berangkat sekarang?
c. Minuman itu pahit apa tidak?
d. Boleh, kan makanan ini saya cicipi?
e. Anda membutuhkan bantuan saya!
15. Kalimat tanya retorik sering digunakan pada situasi
a. wawancara
b. dialog
c. pidato
d. diskusi
e. percakapan
16. Di bawah ini merupakan kalimat tanya yang santun, kecuali
a. Apakah Bapak bersedia menjadi pembicara dalam diskusi besok?
b. Bersediakah Bapak menjadi pembicara dalam diskusi besok?
c. Berkenankah Bapak menjadi pembicara dalam diskusi besok?
d. Mau tidak Bapak menjadi pembicara dalam diskusi besok?
e. Tentunya Bapak bersedia untuk menjadi pembicara dalam diskusi
besok, bukan?
17. Kalimat tanya tersamar untuk tujuan mengajak
a. Maukah adik membantu saya menyelesaikan tugas ini?
b. Siapkah Anda berangkat sekarang?
c. Tidak keberatan, kan membawakan koper ini?
d. Bolehkah saya istirahat sebentar di sini?
e. Terima kasih Anda tidak merokok di ruangan ini.
109 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
18. Kalimat tanya tidak baku di bawah ini adalah
a. Bukankah dia yang membawa bukumu?
b. Apakah kamu sudah mengirimkan surat untuk Nenek di kampung?
c. Kapan kamu bisa main ke rumahku?
d. Mana surat yang harus saya tanda tangani?
e. Bagaimana kalau kamu yang melanjutkan tugas itu?
19. Kalimat tanya yang bertujuan untuk menawarkan sesuatu
a. Masih adakah yang perlu saya bawakan?
b. Paman setuju atau tidak ia kuliah di Bandung?
c. Jadi benar ayahnya seorang pembunuh bayaran?
d. Kamu jadi membeli baju atau membeli sepatu?
e. Sebaiknya Anda berangkat sekarang.
20. Kalimat tanya yang bertujuan untuk menggali informasi
a. Benarkah barang ini milik Bapak?
b. Maukah kamu mampir ke rumah ku?
c. Sudikah kiranya Bapak membantu kami?
d. Untuk apa kita hidup bila harus terus menderita?
e. Bagaimana cara Bapak membangun usaha ini?
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Carilah kalimat pertanyaan yang bersifat retoris dari cerita drama di
atas!
2. Temukan kalimat tanya yang bersifat konfrmasi dari cerita drama di
atas!
3. Setelah kamu membaca percakapan dalam naskah drama, jelaskan
topik pembicaraan dalam naskah drama tersebut!
4. Adakah sikap-sikap yang menyimpang dari ketentuan dalam
menerapkan pola gilir dalam berkomunikasi dalam dialog drama
tersebut?
5. Buatlah kalimat tanya tersamar dengan tujuan mengajak, menyuruh,
meminta, masing-masing satu kalimat!
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 110
6. Jelaskan teknik atau cara mengajukan pertanyaan yang baik!
7. Ubahlah pernyataan di bawah ini menjadi pertanyaan yang memerlukan
jawaban ya atau tidak dan ya atau bukan.
a. Pamannya seorang montir.
b. Bapaknya mempunyai sawah yang luas.
c. Kepala sekolah sedang mengikuti seminar.
d. Kenalannya manajer koperasi.
e. Kegiatan ekstrakurikuler sekolahku menarik.
8. Sebutkan hal-hal yang menandai kalimat konfrmasi dan klarifkasi!
9. Buatlah dua contoh kalimat tanya yang bersifat klarifkasi!
10. Sebutkan empat cara untuk mengubah pernyataan menjadi pertanyaan
yang memerlukan jawaban ya atau tidak atau ya atau bukan!
111 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Kompetensi
Dasar
- Membuat parafrasa lisan dalam konteks bekerja
Indikator
- Memparafrasakan informasi secara lisan dari hal yang
telah dibaca dengan menggunakan bahasa sendiri
- Memparafrasakan informasi secara lisan dari hal yang
sudah didengar dengan menggunakan bahasa sendiri
Materi kalimat parafrasa telah kita pelajari di kelas X. Pada bab ini akan
dipelajri kembali materi tentang membuat parafrasa secara lisan dari sumber
yang dibaca maupun yang didengar. Tujuan pembelajaran ini agar kita makin
memahami dan terlatih membuat parafrasa, khususnya parafrasa lisan.

BAB 6
MEMBUAT PARAFRASA LISAN DALAM
KONTEKS BEKERJA
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 112
Wacana
Pemiahan Ikan Mas Koki Ala Tulungagung
Masih Menekankan Kuantitas daripada Kualitas
Siapa pun orangnya pasti sudah tidak asing lagi dengan jenis ikan
ini. Mas Koki adalah salah satu ikan hias paling populer sejak dulu. Selain
perawatannya mudah, ikan ini juga lebih mudah untuk dipiahkan, asalkan
proses pemiahannya benar. Salah satu sentra budi daya ikan hias adalah
Kota Tulungagung. Dari kota marmer ini, ribuan mas koki bahkan diekspor
ke luar negeri.
Tahap pertama yang paling penting dalam proses pemiahan ikan mas
koki adalah pemilihan induk. Jika kita ingin menghasilkan anakan mas
koki yang baik, kualitas induk harus benar-benar diperhatikan. Pertama-
tama, kita harus bisa membedakan mana ikan jantan dan mana ikan betina.
Menurut Sayuti, salah satu peternak ikan mas koki dari Tulungagung, untuk
mengetahui ciri-ciri jantan atau betina, cukup melihat sirip bawah bagian
depan. Jika mas koki jantan, sirip tersebut akan bertekstur kasar, panjang,
bagian tepinya ada gerigi kecil-kecil, dan bentuk tubuhnya langsing. Jika
betina, sirip tersebut akan bertekstur halus, pendek, dan bagian tepinya rata
serta memiliki bentuk tubuh yang lebih besar daripada mas koki jantan.
Induk yang baik hendaknya dipilihkan dari ikan mas koki yang berumur
minimal 6 bulan ( kira-kira sebesar kepalan tangan orang dewasa ) dan
maksimal 10 bulan karena pada umur itu telur maupun sperma dari induk
dianggap sudah matang dan ikan ini mulai menunjukkan birahinya.
Selain hal tersebut di atas, indukan berkualitas harus memenuhi
berbagai kriteria lainnya lagi, seperti sisik harus gena, gerak harus lincah,
sirip yang sempurna (tidak robek atau kusut), bebas dari penyakit, dan yang
paling penting, ikan tersebut harus dipilih yang benar-benar siap kawin.
Ciri ikan mas koki betina siap kawin biasanya akan terlihat pada usia sekitar
6 bulan. Perut mas koki betina akan membesar dan terkesan lunak jika
disentuh. Selain itu, biasanya ikan mas koki betina yang siap kawin akan
selalu berenang di tepi kolam mencari tempat untuk meletakkan telurnya.
Jika ikan mas koki betina sudah menunjukkan ciri-ciri tersebut, segeralah
carikan induk jantan yang berkualitas untuk dikawinkan.
Setelah ditentukan induk yang baik, langkah selanjutnya adalah
menyiapkan tempat untuk mengawinkan. Tempat yang ideal untuk
mengawinkan ikan mas koki adalah bak air atau kolam berukuran 1 x 4 meter
persegi dan diisi air sedalam 30 cm. Kemudian, kolam diberi ganggang air
113 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
untuk tempat maskoki menempelkan telur, atau kalau tidak ada ganggang
air, bisa disiasati dengan memberi kain kasa atau kelambu. Setelah semua
persyaratan tersebut terpenuhi, calon induk bisa segera ditempatkan dalam
kolam pengawinan tersebut. Dalam waktu kurang dari 24 jam atau setelah
tampak telur yang menempel pada gagang/kain kasa, indukan mas koki
bisa dipindahkan ke kolam lainnya.
Agar tetasan yang dihasilkan baik, pakan untuk induk saat pengawinan
juga harus diperhatikan. “ Supaya anakan yang dihasilkan bisa berkualitas
baik, induk harus diberi pakan jentik-jentik nyamuk. Kalau tidak ada, bisa
digantikan dengan cacing darah. Tapi sangat disarankan pemberian pakan
jentik-jentik nyamuk,” jelas Sayuti.
Hasil anakan yang baik bisa diketahui dari telurnya. Menurut Sayuti,
telur ikan mas koki yang baik berwarna putih kecokelatan dan berbentuk
butiran kecil-kecil.
Telur ikan mas koki menetas dalam jangka waktu kurang lebih 3 hari.
Pada saat itu diusahakan agar kolam tidak terkena sinar matahari langsung.
Caranya kolam ditutupi bagian atasnya karena anakan ikan mas koki sangat
rentan terhadap perubahan suhu yang drastis. Anakan yang berumur 2
hari sebaiknya diberi makanan kutu air sampai berumur 9 hari. Setelah itu,
anakan bisa diberikan pakan berupa cacing darah yang kecil-kecil. Setelah
berumur 12 hari, anakan ikan mas koki sudah bisa dipasarkan.
Pemasaran ikan mas koki tidaklah sesulit yang dibayangkan karena
pada dasarnya penggemar jenis ikan ini masih cukup banyak. Menurut
Sayuti, anakan ikan mas koki sebesar batang korek api dengan panjang 1 cm
(umur kurang dari 2 minggu) bisa laku sampai Rp 40,00-/Rp 50,00- per ekor,
sedangkan satu pasang induk yang baik rata-rata bisa menetaskan sampai
5.000 ekor sekali tetas.
Setelah 18-20 hari berikutnya, induk sudah bisa dikawinkan lagi,
sampai berumur 10 bulan. Jika dihitung-hitung, sepasang induk mas koki
selama waktu produktif 4 bulan (antara 6 bulan sampai 10 bulan) bisa
menghasilkan 30.000 ekor anakan. Dapat dihitung berapa keuntungan yang
diperoleh dari budi daya ikan ini.
Menurut Hariyanto atau dikenal Ari, penghobi mas koki di Jakarta,
sayangnya petani Tulungagung masih kurang memerhatikan kualitas ikan
yang dihasilkannya. “Mereka masih menekankan kuantitas, dan tidak
memerhatikan penanganan saat panen. Akibatnya, koki dari Tulungagung
kualitas dan harga jualnya tidak bisa tinggi. Dan penghobi-penghobi di
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 114
Jakarta masih menyukai koki impor. Padahal harga koki impor jauh lebih
mahal dibandingkan koki lokal.”
(Sumber : MajalahIkan+Mancing, Januari 2003)
A. Pengertian Parafrasa
Berdasarkan Kamus Besar Bahasa Indonesia, parafrasa adalah seperti
berikut.
(1) Pengungkapan kembali suatu tuturan dari sebuah tingkatan atau macam
bahasa menjadi macam yang lain tanpa mengubah pengertiannya.
(2) Penguraian kembali sebuah teks (karangan) dalam bentuk (susunan
kata-kata) yang lain, dengan maksud untuk dapat menjelaskan makna
yang tersembunyi.
Parafrasa mengandung arti pengungkapan kembali suatu tuturan atau
karangan menjadi bentuk lain namun tidak mengubah pengertian awal.
Parafrasa tampil dalam bentuk lain dari bentuk aslinya, misalnya sebuah
wacana asli menjadi wacana yang lebih ringkas, bentuk puisi ke prosa,
drama ke prosa, dan sebaliknya. Parafrasa cenderung diuraikan dengan
menggunakan bahasa si pembuat parafrasa bukan diambil dari kalimat
sumber aslinya apalagi membuat parafrasa secara lisan.
Memparafrasakan suatu tuturan atau karangan secara lisan bisa
dilakukan setelah mendengar tuturan lisan atau setelah membaca suatu
naskah tulisan. Hal itu lazim dilakukan oleh orang yang sudah terbiasa
membuat parafrasa. Untuk mereka yang baru dalam taraf belajar, langkah
membuat parafrasa ialah dengan cara meringkasnya terlebih dahulu.
Namun, harus diingat parafrasa disusun dengan bahasa sendiri, bukan
dengan bahasa asli penulis.
B. Cara Membuat Parafrasa
Berikut adalah hal yang perlu dilakukan untuk membuat parafrasa
dari sebuah bacaan.
(1) Bacalah naskah yang akan diparafrasakan sampai selesai untuk
memperoleh gambaran umum isi bacaan/tulisan.
115 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
(2) Bacalah naskah sekali lagi dengan memberi tanda pada bagian-bagian
penting dan kata-kata kunci yang terdapat pada bacaan.
(3) Catatlah kalimat inti dan kata-kata kunci secara berurut.
(4) Kembangkan kalimat inti dan kata-kata kunci menjadi gagasan pokok
yang sesuai dengan topik bacaan.
(5) Uraikan kembali gagasan pokok menjadi paragraf yang singkat dengan
bahasa sendiri.
Agar lebih jelas perhatikanlah contoh di bawah ini.
Wacana asli
Masalah-masalahyangdihadapi di bidang pendidikan pada saat akan
dimulainya pelaksanaan RepelitaI adalah sangat berat dan mendesak.
Di bidang kurikulum terasa sekali kebutuhan akan pembaharuan agar
sistem pendidikan dapat memenuhi tuntutan pembangunan dan
kemajuan. Di samping itu, terdapat ketidakseimbangan baik di antara
berbagai tingkat pendidikan vertikal maupun di antara berbagai jenis
pendidikan. Jumlah anak yang tidak tertampung di sekolah jauh lebih
besar daripada jumlah anak yang bersekolah. Demikian pula jumlah
anak yang putus sekolah (drop out) adalah jauh lebih besar daripada
mereka yang berhasil menyelesaikan suatu tahap pendidikan.
Sementara itu, tenaga-tenaga yang bekerja di bidang pendidikan
baik teknis maupun administratif sangat kurang jumlahnya. Di
samping itu, mutukeahliantenaga-tenaga tersebut perlu ditingkatkan.
Prasaranapendidikan seperti gedung dan ruang sekolah sangat tidak
mencukupi. Buku-buku sangat sedikit jumlahnya. Kecuali itu, sedikit
sekali sekolah-sekolah yang mempunyai perpustakaan,alat-alatperaga
ataupun laboratorium dan tempatpraktik.
Akhirnya, organisasi dan pengelolaan pendidikan dan kebudayaan
di pusat maupun di daerah belummencerminkan kerjasama yangserasi.
Demikian pula belum ada sistem informasi pendidikan untuk keperluan
perencanaan yang terarah.
Wacana di atas dapat diparafrasakan sebagai berikut.
Banyak masalah berat yang dihadapi pada awal Repelita I:
masalah kurikulum, ketidak-seimbangan tingkat dan jenis pendidikan;
penampungan murid dan masalah putus sekolah; kekurangan tenaga
pendidikan, kurangnya mutu keahlian dan fasilitas; kurangnya kerja
sama dan tiada sistem informasi.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 116
Membuat parafrasa lisan berarti uraian tertulis yang telah dibaca atau
yang telah didengar, diungkapkan kembali secara lisan dengan kalimat
sendiri dengan menerapkan teknik membuat parafrasa sama seperti di
atas.
Teknik membuat parafrasa lisan adalah seperti berikut.
(1) Membaca informasi secara cermat.
(2) Memahami isi informasi secara umum.
(3) Menulis inti atau pokok informasi dengan kalimat sendiri.
(4) Mencatat kalimat pokok atau inti secara urut.
(5) Mengembangkan kalimat inti atau kata-kata kunci menjadi pokok-
pokok pikiran yang sesuai dengan tema/topik informasi sumber.
(6) Menyampaikan atau menguraikan secara lisan pokok pikiran tersebut
dengan menggunakan kata atau kalimat sendiri.
(7) Jika kesulitan menguraikannya, hal di bawah ini dapat membantu:
(a) Gunakan kata-kata yang bersinonim dengan kata aslinya.
(b) Gunakan ungkapan yang sepadan jika terdapat ungkapan untuk
membedakan dengan uraian aslinya.
(c) Ubahlah kalimat langsung menjadi tidak langsung atau kalimat
aktif menjadi pasif.
(d) Jika berbentuk narasi, bisa menggunakan kata ganti orang ketiga.
C. Memparafrasakan Puisi Menjadi Prosa
Puisi merupakan salah satu karya sastra yang bentuknya tidak sama
dengan prosa atau karangan biasa. Puisi terbagi ke dalam larik-larik
atau bait. Pada puisi banyak terdapat kata-kata yang bermakna kias atau
konotasi. Oleh karena itu, isi atau tema puisi biasanya tersirat.
Hal-hal yang perlu diperhatikan dalam memparafrasakan puisi menjadi
prosa ialah seperti berikut.
(1) Bacalah atau dengarkan pembacaan puisi dengan seksama.
(2) Pahami isi kandungan puisi secara utuh.
(3) Jelaskan kata-kata kias atau ungkapan yang terdapat dalam puisi.
(4) Uraikan kembali isi puisi secara tertulis dalam bentuk prosa dengan
menggunakan kalimat sendiri.
(5) Sampaikan secara lisan atau dibacakan.
117 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Contoh parafrasa puisi
Menyesal
Pagiku hilang sudah melayang
Hari mudaku sudah pergi
Sekarang petang datang membayang
Batang usiaku sudah tinggi
Aku lalai di hari pagi
Beta lengah di masa muda
Kini hidup meracun hati
Miskin ilmu, miskin harta
Ah... apa guna kusesalkan
Menyesal tua tiada berguna
Hanya menambah luka sukma
Kepada yang muda kuharapkan
Atur barisan di hari pagi
Menuju ke arah padang Bakti
PuisiBaru, Ali Hasyimi
Setelah kita mendengarkan pembacaan puisi tersebut, dapat kita
parafrasa sebagai berikut.
Puisi “menyesal”, karya Ali Hasymi mengisahkan seseorang yang
menyesali masa mudanya tidak dimanfaatkan dengan sebaik-baiknya. Ia
lalai dan lengah. Kini di hari tuanya, ia merasa miskin ilmu, miskin harta
(tidak berilmu dan tidak mempunyai harta apa-apa). Ia merasa tidak ada
guna menyesali diri. Akan tetapi, ia tidak berhenti dalam sesalnya. Ia
bangkit dan mengajak generasi muda: atur barisan di hari pagi, menuju ke
arah padang bakti.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 118
D. Memparafrasakan Naskah Drama Menjadi Prosa
atau Cerita
Naskah drama juga termasuk karya sastra memiliki ciri khas tersendiri.
Naskah drama terdiri atas uraian cerita dan dialog, namun lebih banyak
unsur dialognya. Dalam naskah drama, tokoh ditulis berjajar di sebelah
kiri diikuti dengan percakapan tokoh tersebut. Sesekali terdapat penjelasan
mengenai gerakan, perilaku, pikiran, atau perasaan si tokoh yang ditulis
di dalam kurung. Memparafrasa naskah drama sama dengan puisi, yaitu
kita harus membacanya untuk memahami jalan ceritanya secara utuh.
Jika dalam puisi banyak terdapat simbol, pada naskah drama, kita harus
memperhatikan unsur berikut.
(1) Pahami seting atau latar cerita.
(2) Pahami dialog dan ambil simpulannya secara menyeluruh.
(3) Pahami penjelasan tentang tokoh yang ada di dalam kurung.
Setelah mendapatkan kesan secara umum jalan cerita dalam naskah
drama, uraikan kembali cerita drama ke bentuk prosa singkat dengan
menggunakan bahasa sendiri.
Bacalah naskah drama berikut!
Kudrisedangasyikmemukul-mukulmejadenganiramadangdut.Yadimenari-
narididepankelas.RurindanMinidudukdibangkuderetanpalingdepan.Mereka
berduasedangbelajar.
Rurin : (kesal) “Hentikan!”
Kurdi : (belagakbodoh) “Ha...?” (terusmemukul-mukulmejagurulagi)
Rurin : (bangkit lalu menarik lengan Yadi seraya membentak) “Keluar
kau!”
Yadi : (keluar sebentar dan ketika mendengar Kurdi menabui meja lagi,
lalumasukkekelasdanmenari-narilagi) “Enak juga menari-nari
begini, ya Kur!”
Kurdi : “Asyi iiiiiik!”
Rurin : (membentak lagi sambil menutup kedua telinganya) “Hei....
berhenti!”
Kurdi : “Aaa ... pa! ” (makinkerasmenabuhmeja). “Ayo kita ganti irama
jaipongan.”
119 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Yadi : “Oke, oke !” (mulaimenarilagi)
Kurdi : “Asy... asy...”
Yadi : “Asy i i i i i i i k!”
Mini : (agak terkejut) “Ooo..., rupanya kalian memang sudah
bersekongkol, ya?”
Kurdi : “Lho, kok ikut marah?”
Mini : “Kalian memang suka mengganggu!”
Kurdi : “Mengganggu?”
Mini : “Jangan tabuh meja itu! Kalau mau menari-nari dan tabuh-
tabuhan sana di depan toko atau di pasar!”
Kurdi : “Hei, berlagak jago ya !” (menunjuk keluar). “Kalau mereka
boleh ribut, kenapa kami tidak boleh?”
Mini : “Sudahlah, Rin! Biarkan saja! Nanti kalau sudah bosan akan
diam sendiri!”
Rurin : “Berhenti atau tidak?” (mengancam)
Yadi : “Teruskan, Kur! Kita kan sedang istirahat.”
Kurdi : (berhentimenabuhmeja,laluberkacakpinggangmenantangRurin)
“mau apa?”
Rurin : “Jangan pukul begitu”.
Yadi : (memberisemangat) “Ayo, pukul saja, Kur!”
Rurin : “Heh, beraninya sama anak perempuan! Tak tau malu!”
Mini : “Sudahlah, tak usah ribut! Kita ini teman sekelas, bukan?”
Yadi : “Bagus Kur! Ayoh lawan saja”.
Mini : (setelah menatap Yadi, lalu kepada Kurdi) “Mereka bermain di
luar kelas tau”
Kurdi : “Ayo, kita mulai, Yad!” (menabuhmejalagi).
Rurin : (tidak sabar lagi. Bangkit mengambil penggaris, lalu mengancam)
“Kalian mau keluar atau tidak!”
Mini juga bangkit membantu Rurin, Kurdi didorong-dorong keluar. Sebuah
pukulan mengenai punggung Kurdi. Lalu, terjadi perebutan penggaris. Yadi
bersorak-soraksambilbertepuktangan.Suasanadikelasmakinriuh.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 120
Parafrasanya adalah
Kurdi sedang asyik menabuh-nabuh meja dengan irama dangdut,
sedangkan Yadi sedang menari-nari di depan kelas. Rurin dan Mini duduk
di bangku deretan depan. Mereka berdua sedang belajar. Rurin dengan
kesal berkata, “Hentikan!” Namun dengan berlagak bodoh, Kurdi berkata,
“Ha?” sambil terus memukul mukul meja guru lagi. Rurin kesal dan bangkit
lalu menarik lengan Yadi seraya membentak dan berkata, ”Keluar!”
Kemudian, Yadi keluar sebentar dan ketika mendengar Kurdi menabuhi
meja lagi, sambil berkata kepada Kurdi, “Enak juga menari-nari begini,
ya Kur!” Kurdi membalas dengan berkata, “Asyiiik.” Dengn kesal, Rurin
membentak lagi sambil menutup kedua tangannya sambil berteriak, “Hei...
berhenti!” Kurdi membalas dengan berkata “Aa...pa!” dan menabuh meja
makin keras dan kembali menabuh meja lagi sambil mengajak Yadi, “Ayo,
kita ganti irama Jaipongan,” dan terus mengajar Yadi menari, lalu Yadi
menjawab, “Oke-oke!” Sambil mulai menari lagi. Kurdi berkata, “asy.. asy..”
Yadi membalas, “Asyiiik!” Mini datang, agak terkejut dan berkata kepada
Kurdi dan Yadi, “Oo.. rupanya kalian sudah bersekongkol, ya?” Kurdi
membalas Mini dengan berkata, “Lho kok ikut marah?” ”Kalian memang
suka mengganggu?” Dengan suara keras, Mini melarang Kurdi, “Jangan
tabuh meja itu!” “Kalau mau menari-nari sana di depan toko atau di pasar!”
sambil menunjuk ke luar, Kurdi berkata, “Hei, berlagak jago ya?” “Kalau
mereka boleh ribut, kenapa kami tidak boleh?” Mini menjawab sambil
menghampiri Rurin, “Sudahlah, Ri! Biarkan saja! Kalau sudah bosen, akan
diam sendiri.” Namun, Rurin dengan nada mengancam berkata, “Berhenti
atau tidak?” Yadi malah menyuruh Kurdi untuk terus menabuh meja,
dengan berkata, “Teruskan, Kur! Kitakan sedang istirahat.”
Kurdi akhirnya berhenti menabuh meja sambil berkacak pinggang
menantang Rurin dan berkata, “Mau apa?” Rurin menjawab, “Jangan pukul
begitu.” Yadi memberi semangat kepada Kurdi dengan berkata, “Ayo, pukul
saja, Kur!” Rurin menjawab, “Heh! Beraninya sama anak perempuan! Tak
tau malu.” Mini melerai, “Sudahlah tak usah ribut. Kita ini teman sekelas,
bukan?” Yadi menjawab, “Bagus Kur, ayo lawan saja!”. Mini menatap
Yadi dan Kurdi bergantian seraya berkata, “Mereka bermain di luar kelas,
tahu!” Kurdi mengajak Yadi menabuh meja lagi. Rurin tidak sabar lagi
melihat kelakuan Kurdi dan Yadi. Ia bangkit mengambil penggaris, lalu
mengancam, “Kalian mau keluar atau tidak?” Mini bangkit membantu
Rurin dengan mendorong-dorong Kurdi keluar, sebuah pukulan mengenai
punggung Kurdi, mereka saling berebutan penggaris. Yadi bersorak-sorak
121 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
sambil bertepuk tangan menambah riuh suasana kelas.
Uraian parafrasa naskah drama dapat berbentuk tidak langsung, yaitu
dengan mengubah dialog atau percakapan para tokoh menjadi kalimat
tidak langsung. Ungkapkan kembali cerita drama dengan bahasa sendiri.
E. Pola Penyajian Informasi Lisan
Beberapa pola penyajian atau penyampaian informasi secara lisan
adalah seperti berikut.
1. Pola Contoh
Parafrasa dengan pola contoh dikembangkan memerinci atau
memberikan ilustrasi untuk menjelaskan ide pokoknya.
Contoh:
Pohon pisang merupakan pohon yang banyak fungsinya. Selain
buahnya, daun dan batangnya dapat dimanfaatkan. Daun pisang dapat
digunakan untuk membungkus, sedangkan batangnya dimanfaatkan
untuk membuat perhiasan dalam pernikahan.
2. Pola Proses
Parafrasa diuraikan dalam bentuk proses, dengan memerinci cara kerja,
langkah-langkah atau tahapan pelaksanaan. Parafrasa dengan pola ini
berbentuk uraian ekspositoris.
Contoh:
Berikut ini adalah proses pembuatan lumpia.
Pertama, tumis bawang bombai dan bawang putih sampai harum.
Kedua, masukkan daun bawang dan ayam cincang, masak selama
kurang lebih tiga menit. Ketiga, masukkan jagung manis, jamur
kancing, bayam, lada, gula pasir, dan bumbu penyedap secukupnya.
Keempat, aduk sampai rata jagung dan bumbu-bumbu tersebut sampai
layu. Terakhir, masukkan larutan maizena sedikit demi sedikit sambil
diaduk-aduk kurang lebih lima menit dan sisihkan.
3. Pola Sebab Akibat
Parafrasa dengan pola ini diawali dengan mengemukakan atau
menggambarkan hal-hal yang menunjukkan sebab dan akhiri dengan
suatu akibat.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 122
Contoh:
Mencuci dengan sabun deterjen dapat memudarkan warna tekstil
atau bahan pakaian. Memudarnya warna pakaian terlihat seperti
lusuh dan usang. Pakaian lusuh tidak layak untuk dipakai. Akibatnya,
banyak orang tidak menggunakan lagi sabun deterjen untuk mencuci
pakaian.
4. Pola Urutan/Kronologis
Parafrasa pola ini pemaparannya diuraikan berdasarkan urutan waktu
dan rangkaian kejadiannya. Parafrasa pada pola urutan/kronologis
bersifat narasi.
Contoh:
Saya mendengar suara kentongan, sepertinya itu pedagang bakmi
lewat. Saya pergi keluar dan membuka pintu pagar, lalu memanggilnya.
Ia berhenti. Pedagang itu seorang laki-laki. Dia bertanya, “Mau pesan
berapa porsi?” Saya jawab “Satu porsi saja.” Kemudian, laki-laki itu
menyiapkan bakmi sesuai pesanan saya. Setelah bakmi selesai dibuat,
saya memberikan uang lima ribu rupiah untuk membayar bakmi
kepada pedagang keliling itu, kemudian saya masuk ke rumah, dan
pedagang berlalu dari depan rumah saya.
RANGKUMAN
A. Pengertian Parafrasa
Parafrasa adalah pengungkapan kembali satu tuturan bahasa ke
bentuk bahasa lain tanpa mengubah pengertian. Pengungkapan kembali
tersebut bermaksud menjelaskan makna yang tersembunyi.
B. Cara Membuat Parafrasa
Ada beberapa hal yang harus dilakukan dalam membuat parafrasa
dari sebuah bacaan. Untuk membuat parafrasa lisan, langkah-langkahnya
adalah membaca informasi secara cermat, mencatat kalimat inti,
mengembangkan kalimat inti menjadi pokok pikiran, menyampaikan
pokok pikiran dalam bentuk uraian lisan dengan kalimat sendiri.
Gunakan sinonim, ungkapan yang sepadan, mengubah kalimat langsung
123 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
menjadi kalimat tidak langsung, mengubah kalimat aktif menjadi kalimat
tidak aktif, serta menggunakan kata ganti orang ketiga untuk narasi jika
kesulitan menguraikan.
C. Memparafrasakan Puisi Menjadi Prosa
Hal-hal yang perlu diperhatikan dalam memparafrasakan puisi
menjadi prosa, ialah :
1. Bacalah atau dengarkan pembacaan puisi dengan seksama.
2. Pahami isi kandungan puisi secara utuh.
3. Jelaskan kata-kata kias atau ungkapan yang terdapat dalam puisi.
4. Uraikan kembali isi puisi secara tertulis dalam bentuk prosa dengan
menggunakan kalimat sendiri.
5. Sampaikan secara lisan atau dibacakan.
D. Memparafrasakan Naskah Drama Menjadi Prosa atau Cerita
Jika dalam puisi banyak terdapat simbol, pada naskah drama kita
harus memperhatikan unsur berikut :
1. Pahami seting atau latar cerita.
2. Pahami dialog dan ambil simpulannya secara menyeluruh.
3. Pahami penjelasan tentang tokoh yang ada di dalam kurung.
E. Pola Penyajian Informasi Lisan
Penyajian atau penyampaian informasi secara lisan dapat
menggunakan pola contoh, pola proses, pola sebab akibat, dan pola
urutan/kronologis.
TUGAS MANDIRI :
Agar lebih memahami dan terlatih membuat parafrasa, kerjakanlah
tugas berikut:
1. Bacalah bacaan di awal bab ini dengan cermat!
2. Buatlah parafrasanya sesuai dengan langkah-langkah membuat
parafrasa.
3. Ungkapkan secara lisan parafrasa tersebut.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 124
TUGAS KELOMPOK
1. Mintalah salah seorang siswa membacakan wacana yang terdapat
pada awal bab ini.
2. Dengarkan dengan saksama!
3. Buatlah parafrasa bacaan yang didengarkan tersebut, lalu sampaikan
secara lisan. Mintalah teman mengomentarinya.
Lakukan secara bergantian!
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Kalimat yang menggunakan kata bermakna konotasi ialah
a. Surat itu dimasukkan ke dalam bus surat.
b. Pelayan toko itu kebanyakan masih gadis.
c. Rombongan kesenian itu sudah datang sejak tadi malam.
d. Ia benar-benar sudah tidak waras lagi.
e. Buku itu jatuh dari meja tulis karena disentuh Anti.
2. Pengungkapan kembali suatu tuntunan atau karangan menjadi bentuk
lain yang dilakukan bukan oleh penulisnya diistilahkan dengan
a. ikhtisar
b. rangkuman
c. parafrasa
d. ringkasan
e. gubahan
3. Usai mendengarkan siaran, silakan menyampaikan respons-respons
bermakna
a. masukan
b. himbauan
e. umpan balik
d. pengkajian
e. tanggapan
125 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
4. Parafrasa puisi yaitu
a. perubahan puisi menjadi prosa
b. perubahan prosa menjadi drama
c. perubahan teks menjadi ikhtisar
d. perubahan teks menjadi cerpen
e. perubahan teks menjadi puisi
5. Sebuah cerpen mengandung amanat tertentu.
Sinonim kata amanat adalah
a. kesan
b. topik
c. pesan
d. ide tokoh
e. sudut pandang
6. Teks drama biasanya menggunakan bentuk kalimat
a. langsung
b. tak langsung
c. berita
d. perintah
e. pasif
7. Kita menghendaki pemerintah yang stabil dan berwibawa.
Kata stabil pada kalimat di atas dapat diganti dengan kata
a. kokoh
b. tangguh
c. tidak goyah
d. tetap
e. mantap
8. Di bawah ini adalah cara membuat parafrasa tulis, kecuali
a. Bacalah naskah yang akan diparafrasa sampai selesai.
b. Baca naskah asli sekali lagi dengan memberi tanda pada bagian-
bagian penting.
c. Ringkaslah naskah dengan cara memadatkan sub-bab menjadi
paragraf, paragraf menjadi kalimat, dan kalimat menjadi kata.
d. Parafrasakan naskah sesuai dengan bahasa aslinya.
e. Parafrasakan naskah dengan memadatkan ringkasan yang dibuat
dengan bahasa sendiri.

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 126
9. Penumpang pesawat terbang akan sangat diuntungkan jika kereta
tersebut berhenti di dekat bandara.
Kemungkinan parafrasa yang muncul adalah
a. Jika kereta berhenti di dekat bandara, penumpang pesawat tidak
nyaman.
b. Jika kereta api dapat berhenti di dekat bandara, penumpang
pesawat sangat diuntungkan.
c. Baik penumpang pesawat maupun kereta api sama-sama untung.
d. Penumpang pesawat terbang akan sangat tidak diuntungkan. Jika
kereta tersebut berhenti dekat bandara.
e. Dibangunnya stasiun dekat bandara akan menguntungkan
penumpang kereta api.
10. Sebagai bangsa yang berjiwa besar, kita menghindarkan segala kolusi.
Makna kata kolusi adalah
a. pandangan gelap
b. kongsi dagang ilegal
c. kerja sama yang saling menguntungkan
d. kerja sama yang tersembunyi untuk maksud yang tidak terpuji
e. menyelewengkan anggaran pembangunan
11. Pola perjanjian parafrasa yang penerapannya diuraikan berdasarkan
urutan waktu dan kejadiannya disebut
a. perbandingan
b. proses
c. kronologis
d. sebab akibat
e akibat sebab
12. Rumah itu diual di bawah tangan.
Makna ungkapan dibawahtanganadalah
a. diual di muka umum
b. diual dengan angsuran
c. diual dengan harga murah
d. diual tanpa perantara
e. diual dengan perjanjian yang ditandatangani kedua belah pihak
13. Pola perjanjian yang mendahulukan fakta-fakta sebagai suatu sebab
kemudian diikuti akibat-akibat dikenal dengan pola
a. akibat sebab
127 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
b. sebab akibat
c. contoh
d. proses
e. kronologis
14. Mulanya hewan ini lahir berwarna merah. Beberapa hari kemudian
tubuh kecil sebesar sepertiga jari kelingking itu mulai merona warna
kulit aman. Bulu-bulu halus menghiasi tubuhnya. Setelah seminggu
makin jelas bulu hitam di tubuhnya. Pada usia dua minggu sempurnalah
tubuhnya dengan sepasang matanya yang hitam mulai terbuka. Hewan
ini disebut hamster.
Wacana di atas dihadirkan dengan pola
a. proses
b. sebab akibat
c. contoh
d. kronologis
e. akibat sebab
15. Pola penyajian parafrasa yang menekankan urian pada langkah-
langkah kerja disebut
a. contoh
b. sebab akibat
d. proses
d. kronologis
e. analogi
16. Parafrasa dengan pola mengembangkan rincian atau ilustrasi untuk
menjelaskan ide pokoknya disebut pola
a. contoh
b. proses
c. sebab akibat
d. urutan
e. perbandingan
17. Kepandaian merupakan talenta yang sebaiknya didukung oleh fasilitas
yang memadai.
Makna kata talenta dan fasilitas adalah
a. bakat sarana
b. kebiasaan, jaminan
c. sifat perlengkapan
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 128
d. kekayaan, penunjang
e. pembawaan, kepandaian
18. Penggunaan idiom dalam kalimat di bawah ini benar, kecuali
a. Ia jatuh hati pada dara jelita anak Pak Lurah.
b. Tabiatnya yang kurang baik sudah mendarah daging.
c. Kami berusaha menyelesaikan persoalan itu dengan kepala
dingin.
d. Ia lepas tangan dalam persoalan itu.
e. Kabar burung itu belum tentu kebenarannya.
19. Parafrasa yang disampaikan secara lisan dapat menggunakan pola
penyajian di bawah ini, kecuali
a. sebab akibat d. proses
b. kronologis e. perbandingan
c. contoh
20. Di bawah ini adalah cara meringkas naskah bila membuat parafrasa
tulis, kecuali
a. padatkan subbab menjadi paragraf
b. hilangkan bagian-bagian yang tidak penting
c. padatkan paragraf menjadi kalimat
d. padatkan kalimat menjadi kata-kata
e. satukan bagian penting dan yang tidak penting
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Jelaskan pengertian parafrasa!
2. Jelaskan cara membuat parafrasa!
3. Jelaskan cara membuat parafrasa lisan!
4. Hal apa saja yang dapat diparafrasa!
5. Carilah sebuah puisi, kemudian buatlah parafrasa puisi tersebut!
6. Temukan dialog berupa drama, kemudian buatlah parafrasa dari dialog
drama tersebut!
7. Carilah sebuah wacana, kemudian parafrasa wacana tersebut!
8. Jelaskan cara meringkas naskah bila membuat parafrasa tulis!
9. Jelaskan pendapatmu mengapa bila membuat parafrasa tulis, naskah
yang akan diparafrasa harus dibaca sampai selesai!
10. Hal apa sajakah yang dapat digunakan untuk membantu memudahkan
parafrasa sebuah wacana?
129 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Kompetensi
Dasar
- Menerapkan pola gilir dalam berkomunikasi
Indikator
- Berkomunikasi dengan menggunakan kata, bentuk
kata, dan ungkapan dengan santun
- Memanfaatkan pola gilir dalam berkomunikasi secara
efektif
Ada banyak hal yang perlu dipahami oleh seseorang dalam berkomunikasi.
Selain cakap memilih kata dan menyusun kalimat yang baik, dalam
berkomunikasi, seseorang juga harus mempertimbangkan penggunaan
bahasa secara santun. Di samping itu, ia juga harus memahami pola gilir
dan dapat menerapkannya jika ingin komunikasi berjalan lancar. Pada bab
ini, kita akan mempelajari berkomunikasi yang baik dengan bahasa yang
santun serta memahami pola gilir dalam berkomunikasi dan penerapannya.
Akhir pelajaran diharapkan kita sudah dapat memahami pola gilir dalam
berkomunikasi dan dapat menerapkannya saat berkomunikasi.

BAB 7
MENERAPKAN POLA GILIR DALAM
BERKOMUNIKASI
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 130
Wacana
Gebyar Busana Daerah
Sesuai Pakem
Padu padan lintas kepulauan. Tema besar inilah yang diusung Himpu-
nan Ratna Busana (HRB) ketika mengadakan pergelaran busana di Jakarta.
Tema tersebut menyimpan makna tersendiri. Para perancang seperti Car-
manita, Chossy Latu, Denny Wirawan, Ghea Panggabean, Oscar Lawalata,
Reshna Sapto, Samuel Watimewa, Susi Lucon diminta menghadirkan krea-
si pada sejumlah busana tradisional seperti busana Aceh, baju kurung, baju
bodo, kebaya panjang, dan kebaya tradisional Jawa.
Namun, ada pakem yang tak boleh dilanggar. Pakem-pakem itu di
antaranya adalah para perancang harus mempertahankan siluet yang sama
dengan aslinya. Selain itu, perancang pun tidak boleh mengadopsi detail
rancangan yang berasal dari luar Indonesia.
“Seperti detail lengan, tidak boleh meniru model kimono dari Jepang,”
ujar Ratna Maida Ning, penasehat HRB.
Perubahan sedikit boleh dilakukan oleh para perancang, tukas Ratna,
tetapi tidak boleh menggantikan siluet baju itu sendiri. Misalnya, perubahan
bentuk lengan yang tidak meninggalkan kaidah berbusana sesuai asalnya
tetap diperbolehkan.
Hasilnya? “Ini benar-benar hasil desain saya yang keluar dari desain
populer yang sedang digemari saat ini,” papar Chossy Latu.
Namun, Chossy mengatakan bahwa busana yang ditampilkan dengan
jalan memadu padankan kekayaan busana Indonesia ini bisa menjadi
alternatif bagi siapa pun yang ingin tampil dengan busana daerah.
Untuk memenuhi paket tersebut, Chossy melakukan alternatif modi-
fkasi busana pada warna. Pada salah satu rancangannya, Chossy padu
padan baju bodo dengan selendang padang.
Ketika menyelaraskan, Chossy tidak hanya mempertimbangkan warna.
Siluet baju bodo yang aslinya sangat longgar, ia buat lebih ramping. Hal ini,
ungkap dia, agar busana yang terpadu padan bisa selaras dan enak dilihat
dan juga dikenakan oleh pemakainya.
Berbagai modifkasi bentuk lengan serta tambahan detail payet juga
dilakukan oleh para perancang. Selain modifkasi baju bodo yang tampil
ramping, ada pula yang membuat dengan model jahitan bawah yang lebih
bervolume.
131 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Berbagai kain asli Indonesia turut tampil seperti kain tenun Bali,
tenun Sulawesi Selatan, kain tenun Lampung, batik Palembang, dan tenun
ikat Ende Flores hadir dalam padu padan ini. Tak ketinggalan kain batik
rancangan dari Keraton Solo tampil dalam pergelaran ini di antaranya motif
parang karya KPH Sawonggaling, koleksi batik antik HRB.
Padu padan tersebut juga diperindah balutan selendang dari beberapa
pulau yang ada di Indonesia, seperti selendang berbahan kain songket tiga
negeri dari Palembang, selendang jepri yang biasa digunakan masyarakat
Jambi, Palembang, dan Padang, serta selendang lokcan yang juga berasal
dari Pulau Sumatra.
Uniknya, konsep padu padan ini juga berlaku pada paduan busana dua
potong plus selendang yang berasal dari tiga pulau yang berbeda. Meski
belum pernah dipopulerkan sebelumnya dan masih terasa asing, HRB
berharap pergelaran ini bisa memperkenalkan budaya dan melestarikan
tanpa harus jauh meninggalkan pakem.
(Sumber : Republika, 10 Juni 2007)
A. Menggunakan Kata, Bentukan kata, serta Kalimat
yang Santun dalam Berkomunikasi
Dalam berkomunikasi yang baik seseorang dituntut untuk
mempertimbangkan situasi berbicara. Pertimbangan ini memunculkan
bentuk ragam berbahasa. Situasi resmi tentu berbeda dengan situasi tidak
resmi. Pembicaraan pada situasi resmi cenderung menggunakan kata,
bentukan kata, serta ungkapan yang baku. Berbeda dengan ragam tidak
resmi yang digunakan saat santai, saat bergaul, dan dalam suasana akrab
(konsultatif) tidaklah harus menggunakan bentukan kata dan susunan
kalimat yang baku.
Perhatikan contoh berikut!
1. Terima kasih saya ucapkan atas kehadiran Bapak dan Ibu sekalian di
tempat ini dalam rangka memenuhi undangan kami
2. Makasih, ya, atas kedatangan kamu semua pada perayaan hari ulang
tahunku!
3. Thanks berat, ye! Akhirnya, lu pada dateng juga ke sini tuk menuhin
undangan gue.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 132
Kalimat nomor satu sangat berbeda dengan nomor dua dan tiga, baik
pada tataran pilihan kata, bentukan kata maupun susunan gramatikal
kalimatnya. Kalimat nomor satu digunakan dalam situasi resmi, sedang-
kan kalimat kedua dan ketiga dalam bentuk situasi umum atau akrab.
Pada situasi santai atau akrab, seseorang lebih bebas memilih kata dan
bentukannya daripada saat situasi resmi atau formal. Berkomunikasi dalam
kondisi dan situasi apa pun, yang terpenting adalah bisa menciptakan
komunikasi yang efektif dan lancar.
Untuk mencapai komunikasi yang efektif proses penyampaian dan etika
berbahasa yang santun tetap harus diperhatikan. Kata-kata kasar sebaiknya
dihindari. Selain kurang pantas, kata-kata kasar juga menyinggung pera-
saan orang lain.
Di samping itu, dalam situasi komunikasi yang terdiri atas dua atau
lebih orang, sikap saling menghargai dan menerapkan pola gilir dengan
memberikan kesempatan berbicara akan menciptakan kelancaran serta
suasana yang lebih nyaman.
B. Memahami Pola Gilir dalam Berkomunikasi
Pemahaman terhadap pola gilir sangat penting dalam keberhasilan
berkomunikasi. Komunikasi harus berjalan dua arah (ada yang men-
dengarkan dan ada yang berbicara). Dengan adanya pola gilir diharapkan
komunikasi akan seimbang dan berjalan lancar karena adanya proses
pergantian bicara sesuai topik pembicaraan atau sesuai keperluan.
Beberapa sikap yang harus dimiliki ketika menerapkan pola gilir dalam
berkomunikasi antara lain seperti berikut
1. Menghargai mitra bicara.
Dalam kegiatan berkomunikasi, kita tidak boleh meremehkan lawan
bicara, bagaimanapun keadaan lawan bicara tetap kita hormati dan
hargai.
2. Peka terhadap kesempatan
Dalam kegiatan berkomunikasi secara lisan, sering terjadi dominasi
satu pihak saat bicara terhadap pihak lain. Kita harus sadar dan
mengetahui kapan saatnya kita bicara dan kapan saatnya kita diam
untuk mendengarkan sehingga proses komunikasi berlangsung lancar
dan nyaman.
133 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
3. Sadar akan relevansi pembicaraan.
Komunikasi berjalan dengan lancar dan mencapai tujuan jika
pembicaraan sesuai dengan permasalahan sehingga tercipta komunikasi
yang efektif dan lancar.
4. Memilih kata yang tepat
Memilih dan menggunakan kata bentukan kata dan ungkapan yang
santun sesuai dengan situasi komunikasi, demi kelangsungan dan
kenyamanan komunikasi. Berkomunikasi dalam kondisi dan situasi
apa pun tetap memperhatikan etika berbahasa yang santun hindari
kata-kata kasar, kurang pantas yang dapat menyinggung perasaan
pihak yang diajak bicara.
C. Penerapan Pola Gilir dalam Berbagai Situasi
Menerapkan pola gilir komunikasi dapat terjadi pada situasi-situasi
berikut.
(1) Suasana kehidupan sehari-hari, seperti di rumah tangga, di sekolah, di
pasar, di kantor , di arisan, dan sanggar.
(2) Diskusi kelompok, seperti di sekolah dan di kampus, kegiatan pramuka,
dan di dunia kerja.
(3) Film atau sinetron
(4) Naskah drama dan pementasan drama
Berikut beberapa contoh penerapan pola gilir dalam berkomunikasi.
1. Penerapan Pola Gilir dalam Diskusi
Diskusi adalah bentuk kegiatan berbicara dalam rangka membahas
sesuatu masalah secara teratur dan terarah. Diskusi bertujuan mencari jalan
keluar, pemecahan masalah, membuat keputusan, atau simpulan. Untuk
dapat memahami pola gilir berkomunikasi dalam satu diskusi, kita harus
memahami lebih dahulu hal-hal yang berkaitan dengan diskusi. Hal-hal
yang berkaitan dengan kegiatan diskusi, antara lain sebagai berikut.
a. Unsur-Unsur Diskusi
Unsur-unsur yang terlibat dalam diskusi, adalah sebgai berikut.
(1) Pemimpin/Moderator, bertugas merencanakan dan memper-
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 134
siapkan dengan teliti topik diskusi, membuka diskusi, mengatur
jalannya diskusi, serta menutup diskusi.
(2) Sekretaris, bertugas mencatat jalannya diskusi, masalah-masalah
yang dilakukan peserta, saran maupun jawaban penyaji dari awal
sampai akhir.
(3) Penyaji/pemakalah/pemrasaran, bertugas menyampaikan pemba-
hasan dengan sistematis, mudah dipahami, tidak menyinggung
peserta, terbuka, dan bersikap objektif dalam meninjau suatu
persoalan.
(4) Peserta diskusi, bertugas menanggapi, memberi masukan, dan
lain-lain.
b. Jenis-jenis diskusi
Berdasarkan ruang lingkupnya, diskusi dibedakan seperti berikut.
(1) Diskusi kelompok, adalah jenis diskusi yang biasa dilakukan di
dalam kelas untuk membahas suatu masalah.
(2) Diskusi panel, adalah diskusi yang dilakukan oleh sekelompok orang
(yang disebut panel) yang membahas suatu topik yang menjadi
perhatian umum di hadapan khalayak/pendengar,penonton.
Khalayak diberi kesempatan untuk bertanya atau memberikan
pendapat.
(3) Seminar, adalah pertemuan untuk membahas suatu masalah di
bawah pimpinan ahli (misalnya guru besar atau pakar)
(4) Simposium, adalah pertemuan dengan beberapa pembicara yang
mengemukakan pidato singkat tentang topik tertentu atau tentang
beberapa aspek dari topik yang sama.
(5) Kongres, adalah pertemuan wakil organisasi untuk mendiskusikan
dan mengambil keputuan mengenai pelbagai masalah.
(6) Konferensi adalah rapat atau pertemuan untuk berunding atau
bertukar pendapat mengenai suatu masalah yang dihadapi bersama.
(7) Lokakarya adalah pertemuan antara para ahli atau pakar untuk
membahas masalah praktis atau yang bersangkutan dengan
pelaksanaan di bidang keahliannya.
(8) Sarasehan adalah pertemuan yang diselenggarakan untuk mende-
ngarkan pendapat para ahli mengenai suatu masalah dalam bidang
tertentu.
135 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
c. Teknik dan Tahapan dalam diskusi
Teknik diskusi berkaitan dengan bentuk dan jenis diskusi. Untuk
tatanan sekolah, bentuk diskusi cukup bersifat umum dan sederhana.
Susunan tempat duduk dalam diskusi dapat dilihat pada skema berikut.

X
- 85 -
Diskusi adalah bentuk kegiatan berbicara dalam rangka membahas sesuatu masalah
secara teratur dan terarah. Diskusi bertujuan mencari jalan keluar, pemecahan masalah,
membuat keputusan, atau kesimpulan. Hal-hal yang berkaitan dengan kegiatan diskusi, yaitu
sebagai berikut:
1). Unsur-unsur Diskusi
Unsur-unsur yang terlibat dalam diskusi, yaitu:
a. Pemimpin / Moderator bertugas merencanakan dan mempersiapkan dengan teliti topik
diskusi, membuka diskusi, mengatur jalannya diskusi, serta menutup diskusi.
b. Sekretaris bertugas mencatat jalannya diskusi, masalah-masalah yang dilakukan peserta,
saran maupun jawaban penyaji dari awal sampai akhir.
c. Penyaji / pemakalah / pemasaran bertugas menyampaikan pembahasan dengan sistematis,
mudah dipahami, tidak menyinggung peserta, terbuka, dan bersikap objektif dalam
meninjau suatu persoalan.
2). Jenis-jenis diskusi
Berdasarkan ruang lingkupnya diskusi dibedakan menjadi:
a. Diskusi kelompok adalah jenis diskusi yang biasa dilakukan di dalam kelas untuk
membahas suatu masalah.
b. Diskusi panel adalah jenis diskusi dengan menampilkan beberapa penulis dan dipimpin
seorang moderator.
c. Seminar adalah pertemuan untuk membahas suatu masalah yang mencakup berbagai
disiplin ilmu atau berbagai kegiatan di masyarakat.
d. Simposium adalah pertemuan untuk mendiskusikan suatu kumpulan pendapat mengenai
pokok masalah tertentu.
e. Kongres adalah pertemuan wakil organisasi untuk membahas suatu masalah.
f. Konferensi adalah rapat atau pertemuan untuk berunding dan bertukar pendapat atau
pertemuan untuk berunding mengenai suatu masalah yang dihadapi bersama.
g. Lokakarya adalah pertemuan antara para ahli atau pakar untuk menghasilkan atau
memutuskan suatu modul, pendapat atau karya bersama.
h. Sarasehan adalah pertemuan yang diselenggarakan untuk mendengarkan pendapat para
ahli mengenai suatu masalah dalam bidang tertentu.
3). Teknik dan Tahapan dalam diskusi
Teknik diskusi berkaitan dengan bentuk dan jenis diskusi. Untuk tatanan sekolah
bentuk diskusi cukup bersifat umum dan sederhana. Susunan tempat duduk dalam diskusi
dapat dilihat pada skema tersebut:
Keterangan gambar
X Æ Pimpinan Diskusi
S Æ Peserta Diskusi
Æ Pendengar
MEJA
MEJA
MEJA
X
X
X
S S S S S
S
S
S
S S
S
S
S
S
S
S
S
S
S
S
S
S
S
S
S S S
S
S
S
S S S S S
X
Keterangan gambar
X → Pimpinan Diskusi
S → Peserta Diskusi
Ada dua tahap dalam pelaksanaan diskusi, yaitu tahap persiapan dan
tahap pelaksanaan atau penampilan.
1) Tahapan Persiapan
a. Tahap persiapan dilaksanakan dengan tujuan memperoleh
kesepakatan mengenai hal yang akan dibicarakan.
b. Membagikan tugas kepada para calon pembicara atau penyaji jika
pembicara lebih dari satu.
2) Tahap Pelaksanaan
Ada empat tahap yang harus dilalui dalam pelaksanaan diskusi.
a) Pembukaan
Pimpinan diskusi mengemukakan pokok masalah yang akan
disampaikan dan memperkenalkan calon pembicara.
Contoh ucapan moderator:
1. Dalam diskusi kali ini, kita akan membicarakan ....
2. Marilah kita buka diskusi ini dengan membaca/berdoa ....
3. Saya perkenalkan pembicara dalam diskusi ini ialah Saudara
... notulis Saudara ....
b) Pelaksanaan diskusi
Pemimpin diskusi mempersilakan para pembicara menyampaikan
pandangannya. Selanjutnya sanggahan atau dukungan dari
pembicara disampaikan sesuai dengan aturan yang telah disepakati.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 136
Contoh ucapan moderator:
1. Saya persilahkan Sdr ... menyajikan makalahnya.
Contoh Ucapan penyaji :
1. Terima kasih atas kesempatan yang diberikan moderator
kepada saya untuk ....
c) Acara tanya jawab
Pemimpin diskusi mempersilakan para pendengar/peserta menga-
jukan pertanyaan kepada pembicara dipandu oleh pemimpin
diskusi, pembicara/penyaji.
Contoh ucapan moderator:
1. Saya beri kesempatan 3 orang peserta mengajukan pertanyaan,
pendapat atau tanggapannya.
2. Penanya pertama silakan ....
3. Penyaji silahkan memberikan jawaban atau tanggapan balik
(peserta yang mengacungkan jari lebih dahulu yang diberikan
kesempatan pertama dan bergilir selanjutnya)
Contoh ucapan peserta :
1. Terima kasih atas kesempatan yang diberikan moderator.
Pertanyaan saya yaitu ....
2. Tadi saudara pembicara menjelaskan ... menurut pendapat
saya ....
3. Saya mohon kepada pembicara pertama untuk menjelaskan
....
4. ... demikian usulan dari saya.
Contoh ucapan penyaji:
1. Terima kasih atas pertanyaan Saudara ... dan jawaban saya
sebagai berikut .....
2. Terima kasih atas tanggapan Saudara ..... tentang ....
d) Penutup
Pembacaan simpulan pembahasan diskusi yang telah berlangsung
oleh pemimpin diskusi.
2. Penerapan Pola Gilir dalam Pementasan Drama
Naskah drama dipersiapkan sebelum drama diperankan atau
dipentaskan. Naskah drama adalah cerita yang ditulis dalam bentuk dialog
disertai gerak-gerik dan tingkah laku para tokoh dalam drama.
Dalam sebuah drama, kedudukan pelaku sangat penting. Untuk
mementaskan sebuah drama, seorang pemain harus memahami isi
137 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
drama termasuk proses dialog. Dalam dialog, telah diatur penggiliran
pembicaraan diantara para tokoh. Setiap tokoh telah diatur kapan saat
menjawab, menanggapi, merespons tokoh lainnya. Meskipun unsur spontan
(improvisasi) ada dalam dialog drama, namun tokoh yang berimprovisasi
tetap harus memerhatikan dengan cermat saat melakukan improvisasi
dialog agar tidak bertabrakan dengan perkataan tokoh lain.
Beberapa hal yang harus diperhatikan jika memerankan tokoh dalam
drama adalah seperti berikut.
a. Teknik Berdialog
Agar penonton menangkap jalan cerita drama, para pelaku harus
menyampaikan dialog dengan jelas, ucapan harus wajar, tidak
dibuat-buat.
b. Mimik
Mimik merupakan perubahan raut muka, misalnya tersenyum karena
senang, mengerutkan dahi ketika sedang berpikir, atau menegang saat
marah.
c. Intonasi
Intonasi ialah lagu atau irama dalam mengucapkan kalimat. Ada
tekanan keras atau lembut dalam ucapan, tempo, dan tekanan nada
menaik atau menurun.
Contoh naskah drama:
TANGIS
Pentas : Menggambarkan sebuah taman atau halaman.
01. Fani dan Gina sedang menangis, dengan suara yang enak didengar,
dengan komposisi yang sedap dipandang.
02. Hana : (muncul dan tertegun, mendekati kedua temannya)
”Ada apa ini? Fani, Gina, mengapa menangis?
Mengapa? Katankanlah, siapa tahu aku dapat membantu.
Ayolah Fani, apa yang terjadi? Ayolah Gina, hentikan sebentar
tangismu!
03. Fani dan Gina tidak menggubris Hana. Mereka terus menangis secara
memilukan.
04. Hana : ”Ya, Tuhan! Duka macam apakah yang Kaubebankan
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 138
kepada kedua temanku ini? Dan apa yang harus kulakukan
bila aku tidak tahu sama sekali persoalannya semacam ini?
Fani, Gina, sudahlah! Kita memang wanita sejati, tanpa ada
seorang pun yang berani meragukan, dan oleh karena itu
pula, kita juga berhak istimewa untuk menangis. Namun
apa pun persoalannya, tidaklah wajar membiarkan seorang
sahabat kebingungan semacam ini, sementara kalian berdua
menikmati indahnya tangisan dengan enaknya. Ayolah,
hentikan tangisan kalian. Kalau tidak, ini akan kuanggap
sebagai penghinaan yang tidak termaafan, dan sekaligus
akan mengancam kelangsungan persahabatan kita!”
05. Fani dan Gina tertegun sejenak mendengar kata-kata Hana. Mereka
menghentikan tangis, saling bertatapan, lalu Gina memberikan selembar
kertas kepada Hana. Keduanya meneruskan tangisan mereka.
06. Hana membaca tulisan pada kertas itu. Ia termangu beberapa saat,
geleng-geleng kepala, kemudian ikut menangis pula.
07. Inu : (muncul tergopoh-gopoh)” Ada apa? Ada apa ini, mereka
menganggu lagi? Gila! Mereka memang terlalu! Sudahlah,
aku yang akan menghadapinya! (mencari batu untuk senjata)
Tenanglah kalian. Kita mengakui bahwa kita memang
makhluk lemah (mulai menangis), miskin, bodoh, dan tak
punya daya. Tetapi, itu tidak berarti bahwa kita dapat mereka
hina secara semena-mena. (sambil menangis) berapa kali mereka
melakukannya? Huh, cacing pun mengeliat jika diinjak, apa
lagi kita, manusia! Mungkin kini mereka akan gentar pada
tekad perlawanan kita. Tetapi jangan puas, mereka harus diberi
pelajaran agar tahu benar-benar bahwa kita bukanlah barang
mainan. (Menangis) Baiklah, akan kucari mereka dengan batu-
batu di tanganku! (beranjak pergi).
08. Hana : (menahan Inu seraya memberikan selembar kertas)
09. Inu : (menerima kertas itu, membacanya, bengong sesaat, kemudian
geleng-geleng kepala dan tertawa sendiri. Diamatinya teman-
temannya satu per satu sambil tersenyum-senyum).
10. Jati : (muncul, heran melihat situasi itu, kemudian marah kepada Inu)
”Inu! Kauapakan mereka?
11. Inu : ”Tenang, Jati. Tidak ada apa-apa!”
12. Jati : ”Enak saja! Senang, ya, dapat membuat orang lain menangis?
139 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
13. Inu : ”Hai, bukan aku penyebabnya, Jati!” (tertawa)
14. Jati : ”Kamu mampu tertawa sementara ketiga sahabatmu menangis
duka. Di mana perasaanmu, Inu?”
15. Inu : ”Jati, apakah setiap tangis itu duka?”
16. Jati : ”Tetapi, mereka jelas nampak menderita!”
17. Inu : (tertawa) ”Tampak menderita tidak sama dengan nyata
menderita!”
18. Jati : ”Gila! Tidak kusangka! Aku kini tahu mutu pribadimu yang
sesungguhnya, Inu!”
19. Inu : ”Ampun, Jati! Sabar, Jati ! Nih, coba baca.” (memberikan selembar
kertas).
20 Jati : (dengan segan menerima, kemudian tertegun ketika membacanya)
”Maaf, kami sedang latihan akting menangis, jangan nganggu,
ya!? Trim’s!”
Gila! Sudah! Selesai! Hentikan latihan gila-gilaan ini!”
21. Semua tertawa terbahak-bahak, sementara Jati salah tingkah.
(dikutip dari Buku Kumpulan drama Remaja, berjudul tangis oleh A.Rumadi)
Pola gilir juga dapat dilakukan dalam membawakan acara. Untuk acara
hiburan yang cukup banyak dan panjang, biasanya dipandu oleh dua orang
MC atau pembawa acara. Kedua pembawa acara tersebut saling bergantian
berbicara mengantarkan setiap acara yang akan dipertunjukkan dan
mengomentarinya. Dalam memberikan pengantar atau komentar, dapat
diterapkan pola gilir agar tak terjadi saling ingin bicara dan mendominasi.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 140
RANGKUMAN
A. Menggunakan Kata, Bentukan kata, serta Kalimat yang Santun
dalam Berkomunikasi
Dalam berkomunikasi yang baik seseorang dituntut untuk
mempertimbangkan situasi berbicara. Pertimbangan ini memunculkan
bentuk ragam berbahasa. Situasi resmi tentu berbeda dengan situasi
tidak resmi. Pembicaraan pada situasi resmi cenderung menggunakan
kata, bentukan kata, serta ungkapan yang baku. Berbeda dengan ragam
tidak resmi yang digunakan saat santai, saat bergaul, dan dalam suasana
akrab (konsultatif) tidaklah harus menggunakan bentukan kata dan
susunan kalimat yang baku. Untuk mencapai komunikasi yang efektif
proses penyampaian dan etika berbahasa yang santun tetap harus
diperhatikan.
B. Memahami Pola Gilir dalam Berkomunikasi
Beberapa sikap yang harus dimiliki ketika menerapkan pola gilir
dalam berkomunikasi ialah menghargai mitra bicara, peka terhadap
kesempatan, sadar akan relevansi pembicaraan, serta memilih dan
menggunakan kata bentukan kata dan ungkapan yang santun sesuai
dengan situasi komunikasi, demi kelangsungan dan kenyamanan
komunikasi.
C. Penerapan Pola Gilir dalam Berbagai Situasi
Menerapkan pola gilir komunikasi dapat terjadi pada:
1. Suasana kehidupan sehari-hari.
2. Diskusi kelompok.
3. Film atau Sinetron.
4. Naskah drama dan pementasan drama.
141 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
TUGAS KELOMPOK
1. Bentuklah kelompok yang terdiri atas 4–5 orang. Kemudian,
tetapkanlah masing-masing anggota menjadi pemeran tokoh drama
berjudul “Tangis” di atas. Lakonkanlah naskah drama tersebut
dengan penghayatan dan penerapan pola gilir yang tepat!
2. Buatlah dafar acara dengan pengantar dan komentar di setiap acara,
kemudian 2 orang anggota kelompok menjadi pembawa acara yang
membacakan acara dengan menerapkan pola gilir yang tepat.
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Sikap yang harus dimiliki ketika menerapkan pola gilir dalam
berkomunikasi tertera di bawah ini, kecuali
a. menghargai mitra bicara
b. peka terhadap kesempatan
c. sadar akan relevansi pembicaraan
d. bahasa harus jelas dan terperinci
e. menggunakan kata, bentuk kata, dan ungkapan santun sesuai
komunikasi
2. Pola gilir dalam berkomunikasi adalah
a. percakapan yang terjadi harus berjalan dua arah
b. percakapan tentang suatu topik secara mendalam
c. pembicaraan yang terjadi antara dua sahabat karib
d. percakapan antara tiga orang saja
e. pembicaraan yang mengarah pada diskusi kelompok
3. Menerapkan pola gilir dalam berkomunikasi dapat terjadi pada
peristiwa berikut, kecuali
a. suasana kehidupan sehari-hari
b. flm dan sinetron
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 142
c. pementasan
d. di dunia kerja
e. monolog
4. Berikut ini adalah langkah-langkah yang harus diperhatikan oleh
seorang penyaji dalam diskusi, kecuali
a. menguasai masalah yang disajikan
b. berbicara dengan jelas dan objektif
c. menyajikan makalah bila diminta pendengar
d. berbicara tetap pada temanya
e. membatasi waktu bicara
5. Perbuatan yang harus dihindari oleh pemandu diskusi pada waktu
berlangsungnya diskusi adalah
a. mengatur proses diskusi
b. mematuhi dan menjalankan peraturan diskusi
c. membela penyaji yang pendapatnya disanggah
d. menyusun kesimpulan diskusi dan mengumumkan hasilnya
e. menguasai pokok-pokok masalah yang didiskusikan
6. Kalimat yang sopan untuk menyanggah pendapat dalam diskusi
adalah
a. saya tidak setuju dengan ide yang dikemukakan
b. rasanya janggal bila penyaji berpendapat seperti apa yang
disampaikan tadi
c. saya sama sekali tidak mengerti apa yang disampaikan penyaji
d. dari tadi saya ingin menanggapi karena saya belum paham
e. saya menemukan beberapa hal yang kiranya dapat
dipertimbangkan
7. Di bawah ini merupakan jenis-jenis diskusi, kecuali
a. simposium
b. seminar
c. rapat
d. lokakarya
e. diskusi panel
8. Orang yang bertugas menanggapi, menambah, dan memperbaiki ide,
gagasan, serta pendapat penyaji disebut
a penyaji
143 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
b. peserta diskusi
c. moderator
d. ketua diskusi
e. wakil ketua
9. Yang bukan merupakan manfaat diskusi
a. menguji sikap toleransi
b. melaksanakan sikap demokrasi
c. mengembangkan latihan berpikir
d. mengembangkan kebebasan pribadi
e. menghargai pendapat orang lain
10. Pertemuan wakil suatu organisasi untuk membahas masalah tertentu
disebut
a. konferensi
b. lokakarya
d. kongres
d. simposium
e. sarasehan
11. Yang berhak menyimpulkan hasil diskusi adalah
a. notulis
b. moderator
c. penyaji
d. peserta
e. penyelenggara
12. Yang tidak memerlukan penggunaan bahasa resmi adalah pada suasana
di bawah ini
a. diskusi
b. sidang
c. pidato kenegaraan
d. forum ilmiah
e. ruang praktik dokter
13. Perbedaan pokok antara diskusi panel dan simposium terletak
pada
a. peserta yang hadir
b. makalah yang dibahas
c. waktu yang disediakan
d. ada tidaknya pendengar
e. keresmian pidato
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 144
14. Berikut ini adalah tugas seorang pemrasaran dalam diskusi,
kecuali
a. menaati waktu yang diberikan
b. membuat makalah
c. mengarahkan dan mengatur jalannya diskusi
d. mempresentasikan makalah
e. menjawab pertanyaan dengan singkat dan tepat
15. Dalam berdiskusi kita harus terlibat aktif artinya
a. cepat tanggap
b. agresif
c. tangkas
d. sering bertanya
e. berani mengemukakan pendapat
16. Kalimat yang hanya dapat dipergunakan dalam ragam tak resmi
adalah
a. Jangan-jangan mereka tidak sampai ke puncak gunung itu.
b. Kenapa Yayuk Basuki tidak diikutsertakan pada kejuaraan ini?
c. Mari kita menghadapi masa depan kita dengan optimis.
d. Saya kurang setuju dengan usul Saudara.
e. Semoga usul saya ini mendapat dukungan dari peserta lain.
17. Kalimat di bawah ini yang paling santun untuk menyanggah pendapat
seseorang ketika berdiskusi adalah
a. Saya menolak pendapat Saudara.
b. Saudara Andi, saya tidak setuju dengan pendapat Saudara karena
kurang didukung fakta dan data yang logis.
c. Saudara seharusnya memikirkan terlebih dahulu apa yang akan
Saudara katakan.
d. Saya rasa pendapat Saudara mustahil untuk dilaksanakan.
e. Saudara sungguh tidak logis.
18. Bukan hal yang menentukan keefektifan sebuah proses komunikasi
adalah
a. saling menghargai
b. cara penyampaian
c. penerapan pola gilir
d. panjang waktu pembicaraan
e. bahasa santun penutur
145 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
19. Di bawah ini termasuk beberapa cara menyetujui usul diskusi,
kecuali
a. menjelaskan secara terperinci usul tersebut
b. mengembangkan pendapat lain yang mendukung
c. menjawab pertanyaan penyanggah
d. memberikan fakta-fakta secara umum
e. menyangkal secara halus terhadap usul itu
20. Maaf yang kita diskusikan sekarang adalah masalah program kerja. Jadi
pendapat Saudara tidak relevan dengan masalah yang kita bicarakan.
Penggalan diskusi tadi berisi
a. tawar-menawar
b. penolakan
c. setuju
d. pendapat yang tidak relevan
e. isi diskusi
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Jelaskan pendapatmu mengapa pemahaman konsep pola gilir sangat
penting dalam keberhasilan komunikasi!
2. Jelaskan apa yang dimaksud pola gilir dalam berkomunikasi!
3. Jelaskan beberapa sikap yang harus dimiliki ketika menerapkan pola
gilir dalam komunikasi!
4. Jelaskan dalam situasi apa saja kita perlu menerapkan pola gilir!
5. Jelaskan manfaat diskusi!
6. Sebutkan jenis-jenis diskusi yang kamu ketahui!
7. Jelaskan unsur-unsur yang terlibat dalam diskusi!
8. Jelaskan empat tahap yang harus dilalui dalam diskusi!
9. Carilah penggalan drama. Kemudian, perankan drama tersebut dengan
menerapkan pola gilir!
10. Buatlah contoh susunan tempat duduk dalam diskusi dalam bentuk
skema!
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 146
TES SEMESTER GANJIL
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Wacana yang berisi uraian kalimat-kalimat informasi disebut
a. narasi d. argumentasi
b. informasi verbal e. visualisasi
c. informasi nonverbal
2. Informasi nonverbal diperlukan bila data informasi membutuhkan
a. penjelasan d. visualisasi
b. perincian e. persentase
c. alasan-alasan
3. Gambaran klasifkasi data yang disusun berdasarkan baris dan kolom
disebut
a. grafk d. denah
b. tabel e. matrik
c. diagram
4. Gambaran informasi yang berbentuk garis-garis menaik dan menurun
disebut
a. grafk lingkaran d. denah
b. tabel e. peta
c. grafk garis
5. Di bawah ini yang bukan termasuk kegiatan menyimak adalah
a. mencatat hal-hal pokok dari narasumber
b. mencatat kata-kata kunci yang dianggap penting
c. mendengarkan dengan saksama
d. memparafrasakan informasi sumber
e. memahami makna informasi yang disampaikan
6. Keberhasilan menyimak dapat diukur dari hal berikut, kecuali
a. memahami informasi yang didengarkan
b. dapat mengutarakan kembali informasi yang didengar dengan
makna yang sesuai
c. dapat mengaktualisasikan informasi baik lisan maupun tulisan
147 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
d. membuat kesimpulan dengan menguraikan inti pokok informasi
yang disampaikan
e. mengemukakan tanggapan sesuai dengan intruksi yang
disampaikan.
7. Di bawah ini yang bukan perintah berisi nasihat ialah
a. Berhati-hatilah selama dalam perjalanan!
b. Mimpi indahlah dalam tidurmu!
c. Simpanlah baik-baik surat wasiat ini!
d. Jagalah bicaramu di mana saja kauberada.
e. Hendaknya selalu waspada dalam segala suasana.
8. Sebagai langkah pertama adalah membaca cerita ringan (1). Setelah
itu, pahami isi cerita tersebut (2). Apakah cerita berbentuk narasi atau
bukan (3). Kemudian catatlah ide-ide pokoknya (4). Itulah yang harus
kamu lakukan (5).
Kalimat yang berbentuk perintah ialah
a. kalimat 1 dan 3 c. kalimat 3 dan 4
b. kalimat 2 dan 4 d. kalimat 4 dan 5
e. kalimat 5 dan 2
9. Kalimat perintah yang menuntut respons tindakan langsung ialah
a. Tutuplah pintu itu!
b. Tataplah masa depanmu!
c. Titiplah barang-barangmu kalau kaupergi!
d. Keluarkan semua pikiran kotormu agar kau tenamg!
e. Ikuti aturan sekolah kalau kau mau berhasil!
10. Berikut ini adalah ciri-ciri kalimat perintah, kecuali
a. intonasi menaik di awal
b. intonasi menurun di akhir
c. menekankan kata yang dipentingkan
d. menggunakan partikel -lah
e. berpola kalimat inversi (P-S)
11. Kalimat perintah yang berpola inversi ialah
a. Jangan pulang dulu sebelum bel!
b. Bapak dan Ibu silakan berdiri!
c. Hadirin dimohon duduk kembali.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 148
d. Tolong sampaikan surat ini kepadanya.
e. Buanglah sampah ini di tempatnya!
12. Yang berhak mengisi lembar disposisi ialah
a. pimpinan d. kepala biro umum
b. manajer e. tata usaha
c. kepala bagian
13. Buku petunjuk cara melakukan sesuatu berkaitan dengan penggunaan
benda atau alat disebut
a. buku petunjuk d. buku keterangan
b. buku pedoman e. primbon
c. buku manual kerja
14. Dalam dunia kerja, bentuk perintah umumnya disampaikan secara
tertulis dalam bentuk
a. pedoman d. surat
b. undang-undang e. manual kerja
c. peraturan
15. Penyusunan pengumuman hendaknya jelas, singkat, dan padat
merupakan
a. fungsi pengumuman d. syarat pengumuman
b. isi pengumuman e. bagian surat pengumuman
c. tujuan pengumuman
16. Bagian-bagian surat perintah adalah
a. bagian kepala, bagian isi, bagian kaki
b. nama, alamat, nomor urut surat perintah
c. judul, badan surat, kaki surat
d. dasar, pertimbangan, isi perintah
e. nomor, judul, konsideran
17. Surat-menyurat intern kantor adalah surat
a. memorandum d. penawaran
b. undangan e. telegram
c. pesanan
18. Kalimat yang lazim digunakan dalam memorandum adalah
a. Surat ini harap segera diselesaikan.
149 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
b. Harap disiapkan laporan bulanan untuk bahan rapat.
c. Demikianlah pemberitahuan dari kami.
d. Kehadiran Anda sangat ditunggu-tunggu.
e. Kapan diadakan rapat staf? Harap diinformasikan.
19. Makna konotatif dari kata angin terdapat pada kalimat
a. Perahu itu dikandaskan angin topan.
b. Ban yang berisi angin telah diciptakan sejak tahun 1830.
c. Kepalanya berisi angin.
d. Angin barat menggerakkan kapal-kapal nelayan.
e. Curah hujan di Jakarta dipengaruhi oleh angin Muson.
20. Frasa idiomatik terdapat dalam kalimat
a. Dokter itu telah makan garam.
b. Tangan kanan Pak Budi harus diamputasi.
c. Anak itu mengendarai sepeda sambil berlepas tangan.
d. Tempat itu dipakai arena mengadu domba.
e. Adik jatuh bangun saat belajar berjalan.
21. Berikut ini merupakan kalimat yang menggunakan ungkapan dengan
tepat.
a. Sikapnya selalu mengkambinghitamkan orang lain.
b. Dokter itu benar-benar seorang yang bertangan dingin.
c. Para pelajar itu sedang praktik lapangan di swalayan.
d. Kekuasaan pemerintah ada di tangan rakyat.
e. Orang itu adalah tangan kanan majikan rumah ini.
22. Untuk mempercepat pengurusan dokumen-dokumen impor itu,
berikan saja amplop kepada staf Biro Umumnya. Supaya cepat beres.
Kata yang bergaris bawah merupakan kata yang bermakna
a. polisemi d. idiom
b. denotasi e. sinonim
c. konotasi
23. Di bawah ini yang merupakan kalimat tanya tersamar adalah
a. Apakah pemerintah akan menaikan harga BBM?
b. Di mana ia tinggal sekarang?
c. Apa kata dunia?
d. Bolehkah saya pinjam teleponmu sebentar?
e. Berapa lama Jepang menduduki Indonesia?
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 150
24. Kalimat tanya yang tak perlu diawab ialah
a. Siapa yang sedang bicara dengan Bapak?
b. Yang mana barang kepunyaanmu?
c. Haruskah kumati karnamu?
d. Apakah Bapak bersedia diwawancarai?
e. Apa penyebab penyakit cikungunya?
25. Sudahkah ia minta maaf kepada ibunya?
Kalimat tanya yang sepadan dengan kalimat di atas adalah
a. Kapankah ia datang dari kampung?
b. Sudah jam berapa sekarang?
c. Perlukah ia dengan kartu kredit ini?
d. Ke manakah gerangan perginya orang itu?
e. Siapakah pahlawan wanita dari Aceh?
26. Parafrasa yang disampaikan secara lisan dapat menggunakan pola
penyajian di bawah ini, kecuali
a. sebab-akibat c. contoh
b. akibat-sebab d. proses
e. kronologis
27. Pola penyajian parafrasa yang menggambarkan rangkaian waktu
disebut dengan penyajian
a. sebab-akibat c. proses
b. contoh d. akibat-sebab
e. kronologis
28. Pola penyajian parafrasa yang menekankan uraian tentang langkah-
langkah kerja disebut
a. sebab-akibat c. perbandingan
b. akibat-sebab d. kronologis
e. contoh
29. Parafrasa wacana atau teks yaitu
a. perubahan bentuk teks kepada puisi
b. perubahan puisi kepada prosa
c. perubahan prosa kebentuk drama
d. perubahan teks kepada bentuk ikhtisar/rangkuman
e. perubahan teks kepada bentuk cerpen
151 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
30. Orang yang bertugas membahas topik permasalahan dalam diskusi
ialah
a. moderator c. penyaji
b. notulis d. peserta
e. penyanggah
31. Pihak yang baik secara aktif maupun pasif ikut terlibat di dalam diskusi
diebut
a. modeator c. penyaji
b. notulis d. peserta
e. penyanggah
32. Berikut adalah unsur-unsur yang berkaitan dengan kelancaran sebuah
diskusi, kecuali
a. komponen diskusi
b. aturan/teknik berdiskusi
c. penerapan pola gilir pada diskusi
d. topik masalah yang dipilih
e. posisi duduk dalam diskusi
33. Yang termasuk komponen diskusi berikut ini, kecuali
a. moderator c. donatur
b. materi diskusi d. peserta
e. sarana
34. Ungkapan pembuka diskusi yang santun ialah di bawah ini, kecuali
a. Dalam diskusi kali ini, kita akan membicarakan .....
b. Marilah kita buka diskusi ini dengan berdoa .....
c. Terima kasih atas kehadiran Saudara pada diskusi kali ini .....
d. Terima kasih sudah pada ngumpul untuk membahas .....
e. Marilah kita memulai diskusi ini dengan .....
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Jelaskan apa yang dimaksud dengan kegiatan menyimak!
2. Hal apa saja yang harus dilakukan agar menyimak mencapai hasil yang
baik?
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 152
3. Sebutkan ciri-ciri kalimat perintah!
4. Apa perbedaan surat edaran dan pengumuman?
5. Sebutkan macam-macam surat yang berisi perintah kerja yang kalian
ketahui selain contoh di atas!
6. Tuliskanlah sinonim dari kata-kata ini:
a. rumah c. formal
b. khusus d. upah
7. Buatlah 2 buah contoh kalimat tanya yang bersifat klarifkasi!
8. Tuliskan 2 kalimat pertanyaan yang tersamar dan jelaskan!
9. Jelaskan apa yang dimaksud dengan parafrasa!
10. Sebutkan contoh ungkapan membuka pembicaraan dalam ragam tak
resmi!
153 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Indikator
- Menggunakan kata atau ungkapan dalam memulai
atau mengakhiri suatu pembicaraan baik formal
maupun non-formal secara tepat dan efektif
- Menerapkan pola gilir percakapan secara aktif untuk
keperluan mengajukan pertanyaan, tanggapan,
pendapat, atau menyatakan penghargaan
- Mengalihkan topik pembicaraan (topic switching)
secara halus dengan menggunakan ungkapan yang
tepat
- Menyatakan pendapat yang berbeda tanpa
menimbulkan konfik secara halus dan santun

Kompetensi
Dasar
- Bercakap-cakap secara sopan dengan mitra bicara
dalam konteks bekerja
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Bagaimana bercakap-cakap secara sopan dengan mitra bicara akan dibahas
pada Bab 8 ini yang meliputi bagaimana memilih kata untuk memulai
atau mengakhiri percakapan, penerapan pola gilir dalam bercakap-cakap,
mengalihkan topik pembicaraan secara halus, dan mengungkapkan
perbedaan pendapat dengan santun. Tujuan pembelajaran adalah agar kita
dapat menerapkan hal-hal tersebut dengan baik saat bercakap-cakap dengan
mitra bicara dalam kondisi dan situasi apa pun.
BAB 8
BERCAKAP-CAKAP SECARA SOPAN
DENGAN MITRA BICARA DALAM KONTEKS
BEKERJA
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 154
Wacana
Pria Punya Usaha
Dengan modal kecil membangun usaha
Roby Siswanto (22), pria kelahiran Bengkulu, bosan berkeliling Jakarta
mencari lowongan yang berujung pada ketidaksesuaian syarat iazah.
Banyak pekerjaan yang mematok persyaratan iazah sarjana. Berbekal
pengalaman saat menjadi santri di Pesantren Tebu Ireng, Jombang, Roby
mencoba membuat bisnis minuman sari tebu yang ia lihat saat masih menjadi
santri. Bisnis yang ia geluti ini terinspirasi makin banyaknya minuman
instan yang kini dilarang karena mengandung zat kimia dan pewarna.
Mulailah ia menyiapkan peralatan yang diperlukan. Ia harus membeli
peralatan giling tebu seharga Rp 5 juta per set, sudah termasuk mesin
kompresor berbahan bakar bensin yang ia peroleh dari seorang bos. Selain
itu, ia juga harus menyiapkan gerobak, wadah, atau gelas, serta payung
besar. Sekarang tinggal mencari tempat yang tepat untuk berjualan sari tebu.
Tempat yang paling pas, menurutnya ialah di dekat sekolah atau depan
supermarket yang banyak dilalui orang atau anak-anak. Untuk penyediaan
tebu, ia dapatkan dari penyuplai tebu dari Bengkulu atau Jambi. Tebu dari
kedua daerah tersebut mempunyai rasa yang manis dan tak membuat
batuk, katanya.
Modal yang dikeluarkan semua tak kurang dari Rp. 7 juta, masih
mendingan jika harus digunakan untuk menyogok bila ingin menjadi pegawai
negeri, seperti yang banyak dilakukan teman-temannya. Setelah dihitung
ternyata omzet yang dihasilkan dari berbisnis tebu bisa mencapai Rp. 200
ribu per hari, hampir menyamai keuntungan bisnis angkot atau warung
makan. Padahal bahan baku yang digunakan sangat sederhana hanya
batang tebu seharga Rp 4.500 per batang. Dari satu batang dapat diperoleh
5 -6 gelas sari tebu yang diual Rp 1.500-Rp 2.000 per gelas.
Modal seadanya yang membawa sukses
Lain lagi dengan wiraswastawan bernama lengkap Topo Goedel
Atmodjo (32) yang memiliki bengkel motor modifkasi “Tauco Custom”
di Jalan Raya Kebagusan Jagakarsa. Sejak lulus SMA, tahun 1994 dan
mengalami kesulitan mencari kerja, ia terjun ke bidang mesin khususnya
mesin motor. Dari SMA, Topo memang sudah menyukai mesin, mungkin
karena dulu kakeknya punya bengkel. Berangkat dari hobinya terhadap
mesin motor, ia kemudian mencoba membuka bengkel motor modifkasi.
155 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Menurutnya, bengkel modifkasi motor masih jarang dan prospeknya cukup
bagus. Dengan modal semangat dan uang seadanya, ia memulai bisnis ini.
Bengkelnya dibuat pertama kali dengan menumpang pekarangan
rumah orang di gang sempit, bahkan ia pun tidur di tempat itu. Kemudia,
bersama temannya yang ingin membuka bengkel mobil, ia menyewa lahan.
Semua alat-alat bengkel, ia rakit sendiri.
Bengkel modifkasinya makin dikenal orang lewat mulut ke mulut.
Banyak yang memakai jasanya. Selain harganya murah, bengkel modifkasi
juga tepat untuk orang yang mau memperbaiki motor bermodal cekak.
Untuk perbaikan motor modifkasi ini, ia mencari barang-barang atau
onderdil ke lapak-lapak lalu ia memanfaatkan bahan-bahan reject dari lapak
tersebut untuk memperbaiki motor orang.
Untuk memodifkasi motor, pelanggan biasanya mempunyai keingi-
nan sendiri. Ia mendiskusikannya dengan pemilik motor, apa yang
diinginkannya. Setiap orang yang datang ke sini pasti ditanyakan dulu,
maunya seperti apa. Setelah itu, ia membuatkan konsepnya sesuai dengan
permintaan. Kalau orang tersebut tidak tahu sama sekali tentang modifkasi,
ia akan menjelaskan sedetail mungkin mengenai konsepnya. Jadi, ia selalu
berusaha memberikan yang terbaik buat pemilik motor agar puas.
Kalau mengenai harga, memang relatif bergantung pada konsepnya.
Tetapi, bagi penggemar motor modifkasi, itu sudah biasa. Pengalamannya
selama mengerjakan motor modifkasi, harga yang tinggi sudah mencapai
Rp 70 juta. Ada juga yang Rp 15 juta bergantung modelnya. Ia menerima
semua jenis motor yang bisa dimodifkasi untuk semua aliran. Ada aliran
trel, sport, super, dan klasik, sedangkan motornya bisa jenis tiger, scorpio,
shogun, thunder, mio, dan lain-lain. Modifkasi itu dibuat karena hobi
sehingga berapa pun biaya tidak jadi masalah bagi mereka. Kini, sekitar
seribu lebih desain telah dihasilkannya selama 13 tahun buka bengkel. Ke
depan, ia berencana ingin membuka lapangan kerja lebih luas lagi.
Setiap gagal selalu bangkit
Kemal Rozandi (42), pria kelahiran Jakarta ini termasuk interpreneur
atau wiraswastawan yang mau memetik hikmah kegagalan. Berkali-kali
usahanya jatuh, berkali-kali pula ia bangkit. Sebelum menjalani bisnisnya
yang sekarang, ia pernah bekerja di salah satu lembaga penunjang pasar
modal di Jakarta karena latar belakang pendidikannya berkaitan dengan
perbankan. Karena krisis moneter beberapa waktu yang lalu, perusahaannya
tutup. Ia pun kemudian mengembangkan usaha minimarket, itu pun gulung
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 156
tikar karena tak kuat bersaing dengan ritel-ritel yang ada. Setelah berkali-
kali gagal, ia lalu mencoba berbisnis jaket. Kemal tertarik membuat jaket
karena ia hobi naik sepeda motor. Dalam benaknya, ia melihat pengendara
motor, jumlahnya luar biasa besar. Jaket menurut Kemal juga merupakan
kebutuhan yang cukup penting. Setidaknya untuk naik sepeda motor,
seseorang harus memiliki satu jaket agar lebih aman dan nyaman. Dengan
pikiran itu, ia berpendapat bahwa bisnis jaket cukup prospektif.
Sebelum jaket dibuat, ia membuat desainnya terlebih dahulu. Setelah
desain dibuat, ia kemudian menjahit dan memproduksi dalam jumlah
terbatas. Biasanya ia mencoba hasil produksinya dulu, jika dirasakan cukup
enak, nyaman, dan punya nilai jual, ia segera memproduksi dalam jumlah
banyak dan dipasarkan. Saat ini, berkat ketekunan dan kesabarannya, Kemal
sudah mampu memproduksi tidak kurang dari 300 jaket setiap bulan.
(Sumber: Wirausaha &Keuangan, Ed.024, April 2007)
A. Pilihan Kata atau Ungkapan untuk Memulai
Percakapan
Proses penyampaian bahasa Indonesia dalam berkomunikasi secara
lisan dapat dilakukan dalam dua cara, yaitu secara langsung dan tidak
langsung. Secara langsung maksudnya berhadapan atau bertatap muka
dengan mitra bicara dan tidak langsung ialah dengan menggunakan sarana
seperti telepon atau media komunikasi yang lainnya. Apa pun caranya,
yang jelas setiap proses komunikasi dilakukan dengan tujuan agar pesan
yang disampaikan dapat dipahami oleh kedua pihak sehingga terjadi hasil
yang efektif dan memuaskan.
Agar dapat terjadi hubungan komunikasi timbal balik yang sesuai
dengan tujuan komunikasi, segala hal yang berkaitan dengan proses
komunikasi harus diperhatikan. Unsur utama dalam komunikasi adalah
bagaimana seseorang dapat menggunakan bahasa yang baik dan tepat.
Selain itu, perlu dipertimbangkan pula aspek situasi, waktu, tempat, dan
hubungan pembicara mitra atau kawan bicaranya, misalnya, saat membuka
percakapan, saat menyampaikan pesan, dan ketika akan menutup
pembicaraan. Hal ini biasanya memengaruhi pilihan kata dan ungkapan
yang digunakan dalam percakapan.
157 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Untuk memulai percakapan dalam situasi formal biasanya meng-
gunakan ungkapan sebagai berikut.
1. Selamat pagi.
2. Selamat siang.
3. Selamat malam.
4. Assalamu’alaikum pemirsa di mana saja Anda berada.
5. Salam sejahtera bagi kita semua.
6. Selamat malam para pendengar radio.
7. Selamat datang.
Atau ucapan pembuka dengan sapaan:
1. Bapak-Bapak dan Ibu-Ibu serta hadirin ... selamat malam.
2. Para tamu undangan yang kami muliakan.
3. Assalamu ‘alaikum, Saudara-saudaraku ....
4. Yang terhormat dewan guru ....
5. Yang saya hormati Kepala Sekolah ....
6. Teman-teman yang saya cintai, selamat pagi ....
7. Siswa-siswi yang saya sayangi ....
8. Para pendengar setia radio Sonora, selamat berjumpa.
9. Hadirin yang berbahagia, selamat datang, selamat malam ....
10. Para karyawan PT. Sejahtera, selamat siang ....
11. Sahabat yang dimuliakan Allah, Assalamu’alaikum ....
12. Para pemirsa, kita berjumpa lagi selama tiga puluh menit ke depan
....
13. Selamat malam, Pak, saya Ardi. Bisa bertemu dengan ....
14. Selamat pagi, apakah saya bisa bertemu dengan Bapak ....
Ungkapan pembuka lewat telepon dalam ragam formal:
1. Assalamu’alaikum…
2. Selamat pagi. Bisa bicara dengan… saya dari…
3. Selamat sore, ada yang bisa saya bantu?
4. Halo, selamat siang…
5. Selamat pagi. Saya Ahmad. Bisa bicara dengan...
6. Wa’alaikum salam, Yayasan Restu Ibu, ada yang bisa kami bantu?
7. PT. Rahmat, Assalamu’alaikum, ada yang bisa dibantu?
8. Cafe Halal, Selamat Malam...
9. Selamat sore. Maaf mengganggu, bisa bicara dengan...
Ungkapan atau salam pembuka pada percakapan di telepon dalam
situasi nonformal:
1. Halo, gimana kabarnya?
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 158
2. Halo, Rahmatnya ada?
3. Halo, ada Wiwin, Bu?
4. Halo, Pak. Bisa dengan Zulkifi?
B. Salam dan Ungkapan dalam Mengakhiri Percakapan
Ketika akan mengakhiri percakapan biasanya seseorang akan
menegaskan kembali hal-hal pokok yang berkaitan dengan materi
pembicaraan yang dianggap penting untuk diingat atau dilakukan kepada
kawan bicaranya. Selanjutnya baru menyampaikan ucapan penutup
pembicaraan.
Saat akan mengakhiri percakapan, biasanya pembicara mengucapkan
hal-hal seperti di bawah ini.
1. Menegaskan kembali yang hal penting dari apa yang telah dibicarakan
agar tetap diingat atau tak lupa untuk dilakukan.
Dalam situasi formal
Contoh:
1. Baiklah, jangan lupa datang di acara wisudaku.
2. Baiklah pemirsa di rumah, jika ada saran dan kritik, kirimkan
ke ...
3. Jadi, jangan sampai lupa rencana kita.
4. Baiklah, sampai bertemu besok di rapat.
5. Sebelum mengakhiri diskusi ini, saya ingatkan kembali ....
6. Sebelum menutup rapat ini, saya tegaskan kembali ....
7. Demikian yang bisa saya sampaikan, ingat ....
8. Sekian saja pertemuan kita hari ini, jangan lupa ....
9. Sebelum ditutup, saya ingatkan kembali ....
10. Sebagai penutup, kita simpulkan bahwa ....
11. Insya Allah, kita akan mengadakan pertemuan kembali ....
Dalam situasi nonformal
Contoh:
1. Oke, jangan lupa besok ketemu ....
2. Udah dulu, ya, pokoknya besok ....
3. Oke, jadi, kan besok?
4. Sampai minggu depan, ingat kita masih ada urusan
5. Sip deh, jadi kita besok berangkat ....
159 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
2. Mengucapkan terima kasih
Dalam situasi formal
Contoh:
1. Atas perhatian Bapak dan Ibu sekalian, kami mengucapkan terima
kasih.
2. Terima kasih atas waktu dan kesempatannya.
3. Terima kasih atas kesedian waktunya.
4. Terima kasih atas segala bantuan yang telah diberikan.
5. Terima kasih untuk pesan-pesannya.
Dalam situasi nonformal
Contoh:
a. Makasih banyak!
b. Makasih, ya!
c. Trims, yuk!
d. Thanks sudah mau kasih saran!
3. Permintaan maaf
Dalam situasi formal
Contoh:
1. Kami mohon maaf jika ada pelayanan yang tak berkenan.
2. Mohon maaf jika ada kata-kata yang tak pantas.
3. Sebelumnya kami mohon maaf bila tak berkenan ....
4. Mohon maaf atas keterlambatan ....
5. mohon dibukakan pintu maaf jika ada kesalahan ucapan ....
Dalam situasi nonformal
Contoh:
1. Maaf, ya, kalau ada salah ucap.
2. Maafn ya, kalau ada salah kata.
3. Maaf, ya!
4. Ungkapan perpisahan serta harapan
Dalam situasi formal
Contoh:
1. Selamat jalan semoga sampai ditujuan.
2. Semoga berhasil, sampai jumpa.
3. Selamat berpisah, semoga kita bertemu lagi.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 160
4. Sampai berjumpa dalam kesempatan yang lain.
5. Sampai di sini dulu pertemuan kita, semoga sukses.
Ucapan perpisahan nonformal
Contoh:
1. Dada ...
2. Bye ...
3. Goodbye ..
4. Sampai nanti,ya ..
5. Dah, yuk!
6. Sampai nanti, ya!
7. Salam buat keluarga, ya!
5. Menutup percakapan dengan salam penutup. Salam penutup biasanya
disesuaikan dengan salam pembuka atau berdaarkan waktu.
Dalam situasi formal
Contoh:
1. Assalamu’alaikum.
2. Selamat malam.
3. Selamat siang.
Salam penutup dalam situasi nonformal
Contoh:
1. Met malam!
2. Malam.
3. Assalamu’alaikum.
4. Siang.
C. Penerapan Pola gilir dalam Percakapan secara Aktif
Dalam percakapan terkadang terjadi pola satu arah diakibatkan oleh
seseorang mendominasi pembicaraan. Agar percakapan dapat berlangsung
dengan merata dalam arti setiap orang yang terlibat percakapan mendapat
giliran yang sama dalam berbicara, dapat diterapkan sistem pola gilir.
Penerapan pola gilir dapat dilakukan dengan cara melemparkan pertanyaan.
Apalagi jika Anda moderator atau pemimpin dalam diskusi, Anda bisa
meminta anggota lainnya memberikan pendapat, gagasan, atau penilaian.
161 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Di bawah ini, beberapa contoh ungkapannya.
1. Bagaimana menurut pendapat Anda?
2. Mungkin di antara kalian ada yang berpendapat lain?
3. Menurut pandanganmu gimana?
4. Adakah yang memiliki pendapat lain?
5. Mungkin ada yang mempunyai gagasan lain?
6. Saya yakin ada yang mempunyai pendapat yang lebih baik.
D. Mengalihkan Topik Pembicaraan secara Halus
Dalam suatu percakapan baik formal, semi formal, maupun nonformal,
pengalihan pembicaraan ke topik lain biasa terjadi. Hal ini bisa diakibatkan
karena adanya keterkaitan antara satu masalah terhadap masalah lainnya
atau satu topik terhadap topik lainnya. Dalam suatu pembicaraan,
pengembangan gagasan atau meluasnya pembicaraan kepada pokok
pembicaraan yang lain masih dianggap wajar jika tetap pada pokok
persoalan yang sedang dibahas.
Proses pengalihan topik pembicaraan bisa disadari dan juga tidak
disadari. Jika memang harus dilakukan, pengalihan topik dapat dilakukan
secara halus dan santun agar tak mengganggu kenyamanan proses
percakapan yang tengah berlangsung. Pengalihan topik dapat dilakukan
dengan ungkapan berikut.
1. Mungkin ada kaitannya dengan ....
2. Mungkin menyimpang sedikit, tapi ....
3. Bagaimana menurut Anda mengenai faktor lain seperti ....
4. Maaf, saya dengar Ibu suka juga pada ....
5. Bagaimana jika kita meninjau sisi lain misalnya ....
6. Persoalan ini berkaitan juga dengan masalah...
Dalam situasi nonformal, pengalihan topik pembicaraan dapat
dilakukan dengan menyatakan ungkapan:
1. Saya dengar Bapak bisa melakukan hal lain, seperti ....
2. Wah, makin seru kalau kita bicara soal ....
3. Boleh tau pandangan Ibu tentang ....
Pengalihan topik dalam suatu diskusi bisa saja menyimpang dari pokok
persoalan semula. Hal ini tidak boleh dibiarkan. Jika Anda moderator,
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 162
Anda harus bisa mengembalikan pembicaraan yang menyimpang tersebut
kembali pada topik pembicaraan yang sebenarnya, dengan mengucapkan:
1. Maaf, pertanyaan agar dipersingkat.
2. Maaf, pertanyaan langsung ke pokok permasalahan.
3. Pertanyaan agar terfokus pada topik pembicaraan ....
4. Saya ingatkan kembali bahwa topik pembicaraan kita adalah ....
E. Menggungkapkan Perbedaan Pendapat secara
Halus
Perbedaan pendapat di antara pembicara baik pada forum diskusi atau
situasi semiformal sudah biasa terjadi. Tidak setiap orang selalu menyetujui
pendapat mitra bicaranya. Masing-masing orang memiliki pandangan
atau pemikirannya sendiri. Tetapi, perbedaan pendapat itu tak boleh
menjadi pemicu konfik. Perbedaan pendapat dapat semakin memberi
wawasan yang lebih luas tentang suatu pokok permasalahan. Mencari
solusinya bisa lebih variatif. Segala unsur yang berbeda dicarikan sudut
persamaannya atau disinergikan untuk mengarah pada satu kesimpulan
atau penyelesaian. Bukan hanya itu saja, setiap perbedaan pendapat harus
dihormati dan disikapi secara santun. Ungkapan seperti, mustahil, itu tidak
benar, pendapatnya tidak masuk akal, dan itu gagasan orang bodoh harus
dihindari. Ungkapan itu bukan saja dapat menyinggung mitra bicara, tetapi
juga bisa merendahkan harga diri orang.
Menyampaikan pendapat yang berbeda atau menyanggah pendapat
orang lain yang berbeda dengan pendapat kita dapat dilakukan secara
halus dengan mempertimbangkan hal-hal berikut.
(1) Nyatakan permohonan “maaf” dahulu.
(2) Berikan kesan mendukung gagasan yang akan disanggah sebelum
menyertakan kekurangannya.
(3) Ungkapkan kekurangan dengan perkataan yang halus seperti, “kurang”
atau “belum,” bukan kata-kata “tidak”.
(4) Ungkapkan kekurangan pendapat mitra bicara dengan alasan yang
logis.
163 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
RANGKUMAN
A. Pilihan Kata atau Ungkapan untuk Memulai Percakapan
Proses penyampaian bahasa Indonesia dalam berkomunikasi secara
lisan dapat dilakukan dalam dua cara, yaitu secara langsung dan tidak
langsung. Secara langsung maksudnya berhadapan atau bertatap muka
dengan mitra bicara dan tidak langsung ialah dengan menggunakan
sarana seperti telepon atau media komunikasi yang lainnya.
Ragam yang digunakan dapat ragam formal, semi formal, atau
nonformal.
B. Salam dan Ungkapan dalam Mengakhiri Percakapan
Saat akan mengakhiri percakapan, biasanya pembicara melakukan
hal-hal seperti di bawah ini.
(1) Menegaskan kembali yang hal penting dari apa yang telah dibicarakan
agar tetap diingat atau tak lupa untuk dilakukan.
(2) Mengucapkan terima kasih.
(3) Permintaan maaf.
(4) Ungkapan perpisahan serta harapan.
(5) Menutup percakapan dengan salam penutup.
C. Penerapan Pola gilir dalam Percakapan secara Aktif
Agar percakapan dapat berlangsung dengan merata dalam arti
setiap orang yang terlibat percakapan bisa berbicara, dapat diterapkan
sistem pola gilir dengan cara melemparkan pertanyaan supaya mitra
bicara yang lain mendapatkan kesempatan. Pengalihan topik tetap harus
secara santun dan halus agar tak mengganggu kenyamanan proses
percakapan yang tengah berlangsung.
D. Mengalihkan Topik Pembicaraan Secara Halus
Dalam suatu percakapan baik formal, semiformal maupun
nonformal, pengalihan pembicaraan ke topik lain biasa terjadi. Hal ini
bisa diakibatkan karena adanya keterkaitan antara satu masalah terhadap
masalah lainnya atau satu topik terhadap topik lainnya.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 164
E. Menggungkapkan Perbedaan Pendapat secara Halus
Perbedaan pendapat di antara pembicara baik pada forum diskusi
atau situasi semiformal wajar terjadi. Menyampaikan pendapat yang
berbeda atau menyanggah pendapat orang lain yang berbeda dengan
pendapat kita dapat dilakukan secara halus.
TUGAS MANDIRI
Amatilah acara debat atau diskusi di televisi kemudian tulislah
ungkapan-ungkapan yang menandakan hal-hal berikut
1. membuka percakapan
2. menerapkan pola gilir
3. memberi tanggapan
4. mengalihkan topik pembicaraan (jika ada)
5. menyatakan pendapat yang berbeda dengan santun
6. menutup perbincangan.
Beri keterangan waktu penayangan dan nama acara serta stasiun
televisi atau media elektronik yang meliputnya!
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini !
1. Faktor yang menyebabkan komunikasi menjadi efektif adalah di bawah
ini, kecuali
a. usia penutur
b. hubungan antarpembicara
c. waktu berlangsungnya pembicaraan
d. tempat dilakukannya pembicaraan
e. suasana pembicaraan
165 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
2. Yang tidak termasuk contoh ungkapan memulai percakapan dalam
situasi formal adalah
a. Assalamu’alaikum
b. Salam sejahtera bagi kita semua
c. Selamat siang semuanya,
d. Sampai nanti malam di acara yang sama
e. Selamat malam permisa di mana saja Anda berada
3. Manusia melakukan percakapan dengan tujuan di bawah ini, kecuali
a. saling memahami
b. saling sepaham
c. mencapai hasil yang diidamkan
d. saling mengerti
e. mendapatkan tanggapan memuaskan
4. Di bawah ini, yang merupakan pembuka percakapan lewat telepon
ialah
a. Halo, apa kabar semuanya?
b. Gimana kabarnya?
c. Halo Rudi, bagaimana kabarmu?
d. Salam kangen dari fans kamu.
e. Gimana, nih, kabarnya, dah lama nggak ketemu?
5. Ucapan membuka acara pada situasi formal yaitu
a. Baiklah, acara selanjutnya adalah ...
b. Para hadirin kami mohon agar berdiri ...
c. Halo semuanya, apa kabar, nih?
d. Selamat jumpa di mana saja kamu berada ...
e. Para hadirin yang kami muliakan, selamat malam ...
6. Ungkapan membuka percakapan dalam situasi semiformal, kecuali
a. Selamat datang para undangan ...
b. Halo semuanya yang lagi pada ngumpul ...
c. Buat kamu-kamu, selamat pagi ...
d. Hai semuanya ...
e. Salam jumpa di mana saja kamu berada ...
7. Di bawah ini, ucapan menutup acara dalam situasi formal adalah
a. Demikianlah acara hari ini ...
b. Udah dulu ya, daa ...
c. Demikianlah sambutan Bapak Kepala Sekolah ...
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 166
d. Oke para pemirsa sekian dulu ...
e. Akhirnya kita tutup acara ini dengan doa ...
8. Di bawah ini ucapan pembuka wawancara ialah
a. Apa kabar, Pak? Boleh nanya ...
b. Numpang nanya, Pak, boleh?
c. Assalamu’alaikum, Pak, mohon maaf mengganggu ...
d. Halo apa kabar Bapak di sana?
e. Berjumpa lagi dengan saya di ...
9. Ucapan penutup percakapan lewat telepon dalam situasi nonformal,
adalah di bawah ini, kecuali
a. sayonara...see you Good bye...!
b. Dah dulu, ya...daa ...
c. Sampai jumpa lagi di lain kesempatan.
d. Daa ... bye-bye..
e. udah dulu, ya, asalamu’alaikum ...
10. Yang bukan merupakan ucapan atau salam perpisahan adalah
a. Selamat tinggal, sampai berjumpa lagi ...
b. Selamat jalan, good luck.
c. Sampai jumpa lagi.
d. Salam kompak selalu.
e. Sampai bertemu lagi, semoga sukses.
11. Hal-hal yang biasanya disampaikan ketika seseorang mengakhiri acara
atau percakapan, kecuali
a. menyimpulkan materi atau hal-hal pokok
b. mengucapkan terima kasih
c. menyampaikan permohonan maaf
d. menyapa hadirin atau mitra bicara
e. menyampaikan salam penutup
12. Ungkapan permohonan maaf yang baku adalah
a. Mohon maaf yang sebesar-besarnya, ya.
b. Beribu-ribu maaf kami haturkan ...
c. Maaf banget, ya ...
d. Kami akhiri acara ini, mohon maaf jika ada kesalahan.
e. Sekali lagi kami mohon dengan sangat pintu maaf.
167 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
13. Ucapan terima kasih dalam mengakhiri percakapan yang baku adalah
a. Makasih banget, ya!
b. Trims berat buat semua!
c. Atas perhatiannya, kami ucapkan terima kasih.
d. Terima kasih banyak, ya.
e. Trims sekali lagi.
14. Ungkapan untuk menutup wawancara secara formal, yaitu
a. Terima kasih atas waktunya, Pak.
b. Terima kasih atas kehadiran Bapak.
c. Terima kasih atas kesediaan Bapak membantu.
d. Terima kasih atas nasihatnya.
e. Baik, terima kasih, ya!
15. Ungkapan dalam mengakhiri acara dengan menegaskan kembali hal
penting yang tepat, kecuali
a. Sampai di sini pertemuan kita, ingat rapat berikutnya ...
b. Baiklah, jangan lupa kita bertemu lagi minggu depan ...
c. Oke teman-teman, kita ketemu lagi lusa ...
d. Demikianlah acara ini, saya tutup dengan doa.
e. Sebelum diakhiri, saya ingin ingatkan kembali...
16. Jika ingin menyanggah pendapat secara halus, perlu diperhatikan di
bawah ini, kecuali
a. menyatakan maaf terlebih dahulu
b. mengungkapkan kekurangan pendapat orang lain dengan
objektif
c. menghindari kata-kata menghina atau menjatuhkan
d. menggunakan kata-kata yang santun
e. menyatakan penolakan terhadap pendapat tersebut
17. Ungkapan yang tepat untuk memberikan mitra bicara kesempatan
mengajukan pendapat ialah
a. Ada yang ingin ditanyakan?
b. Saya setuju dengan pendapat Anda.
c. Saya sependapat dengan usulan Saudara.
d. Bagaimana pandangan Anda tentang hal ini?
e. Ada pertanyaan lainnya?
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 168
18. Ungkapan halus untuk mengalihkan topik pembicaraan di bawah ini,
kecuali
a. Penyebab lain juga bisa karena ...
b. Maaf sedikit menyimpang namun ...
c. Fakta lain yang berkaitan dengan hal ini ada juga seperti ...
d. Tolong pertanyaan jangan melebar ke mana-mana.
e. Beberapa seperti ... berkaitan juga dengan masalah ini.
19. Pengalihan topik pembicaraan kadang diperlukan untuk hal di bawah
ini, kecuali
a. mengembangkan topik
b. mengurangi kebosanan
c. memberikan variasi pada materi pembicaraan
d. mengganti topik yang sedang dibicarakan
e. memberi sedikit penyegaran
20. Hal yang bisa dilakukan untuk menerapkan pola gilir pada percakapan
adalah berikut ini, kecuali
a. mengajukan pertanyaan.
b. memberikan kesempatan mitra bicara untuk berpendapat
c. memberikan waktu pada mitra bicara untuk menyampaikan ide
d. memberikan kesempatan untuk bertanya
e. memohon maaf...
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Buatlah tiga ucapan pembuka percakapan lewat telepon!
2. Buatlah tiga contoh ungkapan pembuka dalam percakapan formal!
3. Buatlah tiga contoh ungkapan pembuka dalam percakapan nonformal!
4. Apa tujuan dalam berkomunikasi secara lisan?
5. Buatlah tiga contoh ungkapan mengakhiri percakapan secara formal!
6. Buatlah tiga contoh ungkapan dalam mengakhiri ucapan secara
nonformal!
7. Buatlah contoh ucapan perpisahan dalam situasi formal!
8. Hal-hal apa yang harus diperhatikan dalam mengungkapkan perbedaan
pendapat secara santun?
9. Hal apa saja yang biasa diucapkan untuk mengakhiri percakapan?
10. Berikan dua contoh ungkapan untuk mengalihkan topik pembicaraan
secara halu!
169 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Indikator
- Menyampaikan gagasan yang tepat dengan topik
diskusi
- Menyanggah pendapat tanpa menimbulkan konfik
dalam suatu forum diskusi dengan santun dan
ekspresif
- Menyampaikan argumentasi terhadap topik diskusi
yang dibicarakan
- Menghargai mitra bicara yang menyampaikan
argumen terhadap topik diskusi
- Menyusun simpulan berdasarkan fakta, data, dan
opini dengan tepat

Kompetensi
Dasar
- Berdiskusi yang bermakna dalam konteks bekerja
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Pada bab ini, kita akan mempelajari hal-hal yang berkaitan dengan diskusi:
manfaat diskusi, tugas dan peranan unsur diskusi, cara menyampaikan
pendapat, gagasan, sanggahan sesuai topik diskusi dengan tepat dan
argumentatif; cara menghargai pendapat orang lain dalam diskusi, serta
menyusun simpulan diskusi. Setelah mempelajari materi ini, diharapkan
kita dapat memahami proses diskusi dan dapat terlibat aktif dalam diskusi
yang meliputi kemampuan menyampaikan pendapat serta alasan yang logis,
memberikan sanggahan yang santun dan tepat sesuai topik diskusi, dapat
menghargai pendapat orang lain, dan dapat menyusun simpulan diskusi
dengan tepat.
BAB 9
BERDISKUSI YANG BERMAKNA
DALAM KONTEKS BEKERJA
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 170
Wacana
Dunia Sedang Lapar
Saat ini, dunia mengonsumsi minyak 225 juta barrel per hari. Dengan
pertumbuhan ekonomi dunia seperti sekarang, diperkirakan bakal ada
penambahan konsumsi rata-rata per tahun 1,6 persen atau setara 4 juta
barel. Mengacu perkiraan Badan Energi Internasional (IEA), konsumsi
minyak dunia tahun 2030 akan naik 50 persen.
Konsumsi boleh saja meningkat seiring dengan pertumbuhan sosial
dan ekonomi global, tetapi dari mana kebutuhan minyak dunia akan
dipenuhi mengingat produksi minyak ada batasnya. Minyak fosil sendiri
memberikan kontribusi 80 persen dari kebutuhan energi dunia.
Penurunan suplai minyak fosil akan mengimbas pada penurunan
pasokan energi. Apabila permintaan dan penawaran minyak dunia
makin timpang, mobilitas akan terhambat, akan melemahkan persaingan,
menurunkan produksi, mengurangi invertasi, serta berdampak pada
penurunan kesejahteraan dan kualitas hidup.
Saat ini, harga minyak mentah dunia mendekati 100 dolar AS per barel.
Harga minyak mentah dunia yang makin fuktuatif dan sensitif menjadi
indikasi makin menipisnya cadangan minyak dunia, yang mendorong terus
berkurangnya exportable surplus.
Kondisi ini tak bisa dianggap angin lalu. Pernahkah Anda mem-
bayangkan bagaimana bila mendadak pabrik-pabrik berhenti beroperasi
karena tidak ada pasokan minyak? Tranportasi darat, udara, dan laut
macet, serta pembangunan infrastruktur terhenti karena tidak ada bahan
bakar minyak?
Tak bisa dibayangkan berapa miliar pekerja yang mendadak menjadi
pengangguran. Lantas, bagaimana caranya agar mobilitas sebagai faktor
penggerak penting kehidupan masyarakat modern bisa terus dipertahankan
atau bahkan ditingkatkan? Tantangan ini yang dicari jawabannya dalam
Challenge Bibendum Shanghai 2007, yang berlangsung 14-17 November 2007
di Shanghai, China. Acara ini digelar untuk yang kesembilan kalinya sejak
1998 dan untuk kedua kalinya di Shanghai.
171 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Gerakan Penyadaran
Menurut David Pirret, Wakil Direktur Utama Shell Lubricants, salah
satu anak perusahaan Petroleum Company Ltd, Challenge Bibendum
merupakan sebuah gerakan penyadaran bersama dari pemain otomotif
dunia. Mereka antara lain pabrik kendaraan, rekan teknis, pemasok energi,
dan lembaga penelitian. Inisiatif gerakan ini datang dari produsen ban
ternama Michelin.
Tujuan gerakan ini antara lain bagaimana menyadarkan warga dunia
agar mau menggunakan teknologi kendaraan dan energi tercanggih agar
tercapai penggunaan bahan bakar yang efsien, ramah lingkungan, dan
aman.
Shell sebagai bagian dari pemain otomotif dunia, khususnya sebagai
pemasok energi dn pelumas, amat menyadari pentingnya pasokan energi
yang berdampak rendah pada emisi gas buang. “Shell menyadari bahwa
perseteruan antara kebutuhan energi untuk mendukung mobilitas dan
bahaya yang ditimbulkannya bakal terjadi di planet ini,” kata David, di
Shanghai.
Apa yang dikatakan David mengenai penggunaan minyak fosil
berdampak pada perubahan iklim global benar adanya. Setidaknya
penelitian dari Intergovernmental Panel on Climate Change (IPCC) yang dirilis
Februari 2007 menunjukkan bahwa Bumi makin memanas.
Sepanjang abad ke-20, suhu bumi naik 0,7 derajat celcius. Apabila
manajemen pengelolaan lingkungan, pencemaran udara, dan emisi gas
buang tidak bisa ditekan, kondisi akan lebih buruk lagi. Setidaknya akan
ada penambahan suhu Bumi 0,2 derajat celcius tiap dasawarsa.
Naiknya suhu Bumi berdampak serius pada iklim global. Iklim amat
dipengaruhi suhu panas Bumi sebagai akibat perubahan tekanan udara,
yang menyebabkan terjadinya arus angin. Iklim yang berubah memengaruhi
produksi pertanian karena sektor pertanian amat bergantung pada kondisi
iklim di suatu kawasan.
Upaya yang paling mungkin dilakukan adalah menjaga populasi warga
dunia menetapkan pilihan yang tepat dalam penggunaan teknologi, seperti
penggunaan bahan bakar batubara, minyak fosil, dan pengembangan
energi nuklir, atau penggunaan energi dari bahan bakar nabati yang dapat
diperbaharui.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 172
Dampak perubahan iklim global akan sangat merepotkan negara-
negara di dunia. Australia misalnya, akan mengalami masa kekeringan,
dan ini mengancam pertanian mereka seperti peternakan sapi perah dan
sapi potong. Dampak kekeringan di Australia tahun 2006 menyebabkan
kenaikan harga susu bubuk hingga lebih dari 10 persen. Harga gandum
melonjak, begitu pula daging sapi.
Negara-negara di Eropa juga akan mengalami masalah serius akibat
berubahnya iklim global. Hujan akan banyak turun di wilayah utara Eropa,
sementara di sebelah selatan akan terjadi kekeringan. Kondisi akan memicu
pencairan es dan berdampak pada kurangnya kunjungan wisatawan pada
musim dingin.
Afrika juga akan mengalami ancaman kelaparan, bencana erosi dan
banjir sehingga kondisi negara-negara di Afrika bakal makin buruk. Amerika
Selatan pun tak lepas dari ancaman banjir, sementara produk pertanian di
kawasan Amerika Utara bakal terganggu.
Indonesia juga tidak bisa menghindar dari pengaruh perubahan
iklim global. Buktinya, pada akhir tahun 2006, kemarau panjang melanda
sebagian besar wilayah Indonesia. Akibatnya, produksi beras jatuh, harga
beras melonjak, dan masyarakat pun menjerit.
Daya beli yang tetap sementara harga komoditas pertanian cenderung
meningkat, akibat permintaan dan penawaraan tidak seimbang secara
permanen dan terus-menerus, akan menyebabkan kualitas hidup warga
Indonesia merosot.
Perubahan iklim global yang ditandai dengan peningkatan suhu Bumi
memiliki dampak ekonomi dunia yang serius. Nicholas Stern, mantan
ekonom dari Bank Dunia seperti dikutip Research Eu, sebuah majalah
penelitian di Eropa, mengungkapkan bahwa perubahan iklim global akan
memekan biaya 5.500 miliar euro pada tahun 2050.
Biaya
Biaya harus ditanggung sebagai dampak perubahannya iklim global itu
melebihi biaya akibat Perang Dunia II. “Dengan catatan, ongkos perubahan
iklim yang besar terjadi bila warga dunia tidak melakukan tindakan
pencegahan apa-apa,” katanya.
Lalu, siapa yang harus menanggung beban biaya yamg amat besar
itu? Jawabannya, seluruh warga dunia. Dampak perubahan iklim akan
mengimbas seluruh negara di dunia. Negara miskin akan makin miskin
173 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
karena kalah bersaing dalam perebutan minyak dunia. Negara berkembang
akan menanggung beban pengangguran yang makin membengkak akibat
lemahnya perputaran roda ekonomi.
Daya beli masyarakat juga bakal merosot tajam karena semua produk
untuk memenuhi kebutuhan hidup sehari-hari menjadi amat mahal.
Untuk mengantisipasi itu, Uni Eropa telah mengalokasikan anggaran
50,5 miliar euro dalam kurun 2007-2013. Mereka berkosentrasi pada
program tujuh kerangka kerja atau Seventh Framework Programme yang
dikenal dengan istilah FP7, yang fokusnya pembangunan, penelitian, dan
teknologi.
Dari anggaran tersebut, 32 miliar euro di antaranya untuk mendukung
penelitian, yang meliputi 10 bidang, yaitu kesehatan; pangan, pertanian,
dan bioteknologi; teknologi informasi dan komunikasi; nanosciences,
nanotechnologies, materials and new production techologies; energi; lingkungan
meliputi perubahan iklim; transportasi; pengetahuan sosial-ekonomi dan
kemanusiaan; ruang; dan masalah keamanan.
Juga disediakan anggaran 7,4 miliar euro untuk pembuatan ide
cemerlang untuk landasan kerja. Selain itu, 4,7 miliar euro untuk kegiatan
ilmiah dan 4,2 miliar euro untuk kegiatan ilmuwan. Sementara 2,4 miliar
euro untuk jaminan energi pada masa pendatang.
China sebagai negara yang sedang tumbuh pesat juga tak mau
ketinggalan. Pekan lalu mereka membangun stasiun bahan bakar hidrogen
sebagai upaya untuk menekan emisi gas buang. Maklum, pembangunan
industri yang pesat di China menyumbang polusi udara yang hebat.
Indonesia tentu saja bergiat menekan pencemaran udara. Misalnya
dengan berkomitmen melakukan revitalisasi kehutanan. Indonesia sebagai
negara yang memiliki hutan terbesar kedua di dunia, selama ini penyumbang
oksigen yang besar untuk dunia.
Bagaimanapun, setiap negara harus berperan aktif untuk menekan
penggunaan energi berbahan bakar minyak fosil. Caranya dengan sedini
mungkin melakukan tindakan nyata dengan mengonversi energi fosil ke
bahan bakar nabati. Kalau tidak, dunia yang sedang lapar energi ini bakal
menyulitkan kita.
(Sumber: Kompas, 24 November 2007)
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 174
A. Diskusi dan Manfaatnya
Untuk mengadakan sebuah diskusi harus dipersiapkan terlebih dahulu
unsur-unsur berikut.
(1) Unsur manusia, yaitu moderator atau pemimpin diskusi, penyaji/nara-
sumber/pemrasaran/pembicara, notulis/sekretaris, dan peserta diskusi
Jika diskusi tidak dihadiri pembicara, orang yang bertugas membahas
masalah adalah moderator selaku pemimpin diskusi.
(2) Unsur materi, seperti topik diskusi atau permasalahan, dan tujuan atau
sasaran.
(3) Unsur fasilitas, seperti ruangan/tempat, perlengkapan, misalnya meja,
kursi, papan tulis, dan kertas.
Diskusi dapat diartikan dengan kegiatan bertukar pikiran secara lisan.
Diskusi biasanya dilakukan karena ada masalah atau persoalan yang perlu
dibahas dan dipecahkan. Diskusi secara umum bertujuan untuk mencari
solusi atau penyelesaian suatu masalah secara teratur dan terarah. Yang
dimaksud teratur dan terarah ialah semua unsur-unsur yang ada di dalam
diskusi berfungsi, baik peserta, pembicara, maupun moderator menjalankan
tugasnya dengan baik, saling bertukar pikiran secara aktif dan santun untuk
mencapai kesepakatan atau penyelesaian yang baik.
Diskusi yang baik akan membawa manfaat yang baik. Manfaat diskusi
ialah:
(1) membiasakan sikap saling menghargai
(2) menanamkan sikap demokrasi
(3) mengembangkan daya berpikir
(4) mengembangkan pengetahuan dan pengalaman
(5) mewujudkan proses kreatif dan analitis
(6) mengembangkan kebebasan pribadi
(7) melatih kemampuan berbicara
B. Tugas dan Peranan Unsur Diskusi
Setiap unsur-unsur di dalam diskusi memiliki tugas dan peranannya
masing-masing. Agar diskusi bisa berjalan dengan lancar maka setiap
unsur diskusi harus menjalankan tugas dan peranannya tersebut dengan
baik. Tugas unsur-unsur diskusi adalah sebagai berikut.
175 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
1. Tugas Moderator/Pemimpin Diskusi
a. Menyiapkan pokok masalah yang akan dibicarakan
b. Membuka diskusi dan menjelaskan topik diskusi
c. Memperkenalkan komponen diskusi terutama pembicara jika ada
unsur pembicara/penyaji
d. Membuat diskusi menjadi hidup atau dinamis
e. Mengatur proses penyampaian gagasan atau tanya jawab
f. Menyimpulkan diskusi dan membacakan simpulan diskusi
g. Menutup diskusi
2. Tugas Pembicara
a. Menyiapkan materi diskusi sesuai topik yang akan dibahas
b. Menyajikan pembahasan materi atau menyampaikan gagasan-
gagasan serta pandangan yang berkaitan dengan topik diskusi
c. Menjawab pertanyaan secara objektif dan argumentatif
d. Menjaga agar pertanyaan tetap pada konteks pembicaraan
3. Tugas dan Peranan Notulis
a. Mencatat topik permasalahan
b. Waktu dan tempat diskusi berlangsung
c. Mencatat jumlah peserta
d. Mencatat segala proses yang langsung dalam diskusi
e. Menuliskan kesimpulan atau hasil diskusi
f. Membuat laporan hasil diskusi
g. Mendokumentasikan catatan tentang diskusi yang telah
dilakukan
4. Peranan atau Tugas Peserta Diskusi
a. Mengikuti tata tertib dan aturan dalam diskusi
b. Mempelajari topik/permasalahan diskusi
c. Mengajukan pertanyaan, pendapat/sanggahan, atau usulan
d. Menunjukkan solidaritas dan partisipasi
e. Bersikap santun dan tidak emosional
f. Memusatkan perhatian
g. Turut serta menjaga kelancaran dan kenyamanan diskusi
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 176
C. Menyampaikan Pendapat dan Gagasan dalam
Diskusi
Saat menyampaikan pendapat atau gagasan di dalam diskusi, gagasan
yang akan disampaikan harus sesuai dengan topik yang sedang dibahas.
Pendapat harus bersifat logis, yaitu dapat diterima oleh akal disertai alasan-
alasan serta bukti dan fakta-fakta sehingga pendapat yang dikemukakan
dapat meyakinkan peserta diskusi yang lain.
Pendapat juga harus bersifat analitis, maksudnya pendapat disam-
paikan secara sistematis, teratur, dan mendalam serta tidak berbelit-belit.
Selain itu, pendapat juga harus disampaikan secara kreatif yaitu, apa yang
disampaikan merupakan hal yang baru dan bernilai tinggi atau berkualitas.
Namun, semua pengungkapan gagasan, ide, atau usulan harus disampaikan
dengan bahasa yang santun, jelas, tepat, dan objektif.
D. Menyampaikan Tanggapan dan Sanggahan di
dalam Diskusi
Adalah wajar dalam setiap diskusi terjadi perbedaan pendapat.
Perbedaan pendapat di dalam diskusi menyebabkan diskusi berkembang
asalkan cara menyampaikan perbedaan tersebut dengan sikap yang toleran
dan saling menghargai. Jika seseorang hendak mengajukan sanggahan atau
penolakan atas pendapat serta usulan peserta diskusi yang lain, sanggahan
dapat diungkapkan dengan memerhatikan hal-hal berikut.
(1) Menyatakan permohonan maaf terlebih dahulu
sebelum menyampaikan sanggahan atau ketidaksetujuan
(2) Memberikan pujian atau penghargaan terhadap pendapat yang
akan ditanggapi
(3) Menyampaikan sanggahan atau tanggapan dengan alasan yang
masuk akal
(4) Sanggahan diusahakan menyempurnakan atau memberikan solusi
alternatif terhadap gagasan yang akan ditanggapi.
(5) Ungkapan-ungkapan yang merendahkan, seperti, tertolak,
tidak masuk akal, pendapat orang kampung, dan lain-lain harus
dihindarkan.
177 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Di bawah ini adalah contoh kata atau ungkapan yang dapat digunakan
untuk memberikan tanggapan atau sanggahan atas pendapat orang lain.
1. Maaf, saya kurang sependapat ....
2. barangkali perlu ditinjau kembali
3. Masih ada yang kurang sesuai dengan topik permasalahan.
4. Saya kira masih ada pilihan lain misalnya ....
5. Maaf, pendapat saya sedikit berbeda ....

Tanggapan bukan hanya memberi sanggahan, tapi juga mendukung
ide, gagasan, atau pendapat orang lain di dalam diskusi. Untuk
menyampaikan persetujuan atau dukungan terhadap pendapat orang lain,
perlu diperhatikan hal-hal berikut.
(1) Pernyataan dukungan diungkapkan dengan jelas, tidak berbelit-
belit serta dengan bahasa yang santun
(2) Persetujuan juga diungkapkan dengan logis berdasarkan fakta dan
alasan yang bisa diterima.
(3) Persetujuan disampaikan dengan wajar dan tidak berlebihan.
(4) Dukungan harus diungkapkan secara objektif.

Di bawah ini adalah contoh ungkapan yang dapat dipergunakan untuk
menyampaikan dukungan atau persetujuan.
1. Pendapat Anda sesuai dengan topik yang dibahas.
2. Saya setuju dengan pendapat Anda.
3. Saya mendukung pendapat Saudara.
4. Apa yang Saudara katakan sama dengan pemikiran saya.
E. Mengambil Simpulan dalam Diskusi
Tujuan diskusi adalah mencapai hasil berupa kesepakatan terhadap
sesuatu atau pemecahan terhadap suatu masalah. Memberikan simpulan
dalam diskusi merupakan tugas moderator. Namun untuk merumuskan
simpulan, peserta diskusi dapat diikutsertakan agar simpulan yang diambil
lebih objektif dan valid.
Secara umum, simpulan dapat diambil dengan melalui penalaran
deduktif maupun induktif. Dalam diskusi, simpulan diambil dengan
berdasarkan hal-hal berikut.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 178
(1) Pendapat yang dapat diterima oleh semua peserta diskusi.
(2) Data-data dan fakta yang benar dan dapat diterima kebenarannya
oleh peserta diskusi.
(3) Segala pendapat atau gagasan yang sama dan sejalan.
(4) Voting atau mengambil suara terbanyak dari peserta diskusi yang
hadir.
(5) Simpulan diupayakan merupakan rumusan yang inovatif, solusif,
dan implementatif.
RANGKUMAN
A. Diskusi dan Manfaatnya
Untuk mengadakan sebuah diskusi harus dipersiapkan terlebih
dahulu unsur-unsur manusia, unsur materi, dan fasilitas.
B. Tugas dan Peranan Unsur Diskusi
Setiap unsur di dalam diskusi memiliki tugas dan peranannya masing-
masing. Agar diskusi dapat berjalan dengan lancar, setiap unsur diskusi
harus menjalankan tugas dan peranannya tersebut dengan baik.
C. Menyampaikan Pendapat dan Gagasan dalam Diskusi
Saat menyampaikan pendapat atau gagasan di dalam diskusi, gagasan
yang akan disampaikan harus sesuai dengan topik yang sedang dibahas.
Pendapat harus bersifat logis, yaitu dapat diterima oleh akal disertai alasan-
alasan serta bukti dan fakta-fakta sehingga pendapat yang dikemukakan
dapat meyakinkan peserta diskusi yang lain.
D. Menyampaikan Tanggapan dan Sanggahan dalam Diskusi
Jika seseorang hendak mengajukan sanggahan atau penolakan atas
pendapat atau usulan peserta diskusi yang lain, dapat diungkapkan
dengan menghargai mitra bicara yang menyampaikan argumen tersebut.
E. Mengambil Simpulan dalam Diskusi
Tujuan diskusi adalah mencapai hasil berupa kesepakatan terhadap
sesuatu atau pemecahan terhadap suatu masalah.
Secara umum simpulan dapat diambil dengan melalui penalaran
deduktif maupun induktif. Dalam diskusi simpulan diambil dengan
berdasarkan pada fakta, data, dan opini yang tepat.
179 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
TUGAS KELOMPOK
Bentuklah kelompok yang terdiri atas 4 – 5 orang. Lalu, buatlah sebuah
diskusi kelompok dengan menentukan topik diskusi, membagi tugas
sesuai unsur diskusi, dan melakukan proses diskusi dengan menerapkan
tata cara menyampaikan pendapat, argumentasi, dan sanggahan hingga
penyusunan simpulan dengan tepat dan santun. Setelah itu, serahkan
simpulan atau hasil pembahasan diskusi kepada guru untuk dinilai!
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Yang dimaksud dengan diskusi adalah
a. obrolan bersama
b. pembahasan masalah
c. kegiatan bertukar pikiran secara lisan
d. memperdebatkan sesuatu
e. tukar pikiran dengan rileks
2. Di bawah ini yang termasuk unsur materi dalam diskusi ialah
a. moderator
b. penyaji
c. dana
d. topik permasalahan
e. perlengkapan
3. Di bawah ini tugas moderator, kecuali
a. membuka diskusi
b. mempersiapkan materi diskusi
c. mengatur jalannya diskusi
d. memperkenal unsur-unsur diskusi yang lain
e. menyimpulkan hasil diskusi
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 180
4. Yang tidak termasuk manfaat diskusi di bawah ini
a. mengembangkan gaya bicara
b. menumbuhkan sikap demokrasi
c. melatih kemampuan berbicara
d. menumbuhkan sikap toleransi
e. menambah wawasan
5. Yang termasuk unsur perlengkapan untuk menyelenggarakan diskusi
di bawah ini, kecuali
a. komputer
b. bangku dan meja
c. alat tulis dan kertas
d. ruangan
e. sound system dan papan tulis
6. Yang bukan termasuk tugas peserta ialah
a. menjaga kelancaran diskusi
b. memperkenalkan diri
c. mengajukan pertanyaan
d. menjaga sikap agar santun
e. mengikuti tata tertib diskusi
7. Yang bukan tugas penyaji adalah
a. menjawab pertanyaan peserta
b. mengajukan pertanyaan
c. menyiapkan materi diskusi
d. membahas materi diskusi
e. menyajikan makalah
8. Yang bukan tugas notulis ialah
a. mencatat proses atau jalannya diskusi
b. mencatat jumlah peserta diskusi
c. mencatat waktu dan tempat berlangsungnya diskusi
d. mencatat hasil diskusi
e. menilai peserta yang aktif dan pasif
9. Yang merupakan ciri gagasan yang kreatif adalah di bawah ini, kecuali
a. memiliki kualitas
181 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
b. merupakan hal yang baru
c. masuk akal
d. dapat menginspirasikan gagasan yang lain
e. berbobot
10. Kalimat yang menggunakan bahasa yang santun dalam diskusi,
kecuali
a. Saya menyarankan agar pembahasan mengarah pada persoalan...
b. Berdasarkan hal-hal yang telah dikemukakan oleh Saudara penyaji,
saya ingin bertanya mengenai...
c. Saya harap diskusi ini jangan diteruskan, sudah percuma dan
tidak akan menghasilkan simpulan yang bermutu.
d. Maaf, jika bisa diskusi ini juga mencari solusi yang tidak
menimbulkan risiko apa-apa.
e. Menurut pendapat saya, sebaiknya kita membatasi masalah kepada
hal...
11. Di bawah ini cara menyelesaikan perbedaan pendapat di dalam diskusi
yang terbaik ada dalam kalimat
a. Mengambil suara terbanyak dari peserta yang hadir.
b. Perbedaan pendapat di antara peserta wajar terjadi.
c. Pilihan kita hanya ini, tak ada lagi yang lainnya.
d. Kita harus mencari alternatif lain karena bukan ini jalan satu-
satunya yang dapat kita tempuh.
e. Pendapat kita harus kita uji cobakan dahulu di lapangan, berhasil
tidaknya urusan nanti.
12. Seni wayang merupakan seni tradisional yang menjadi salah satu ciri
kebudayaan Indonesia. Di dalamnya terdapat pelajaran-pelajaran
berharga yang berkaitan dengan kehidupan manusia. Masyarakat pada
umumnya menyukai seni wayang karena di samping menarik dan
padat ceritanya, juga mengandung nilai hiburan yang tinggi. Bahkan
di dunia modern saat ini, penyajian seni wayang dipadukan dengan
gaya dan cengkok seni modern, misalnya tata lampu, tata musik, dan
tata suara, sekalipun banyak generasi muda yang belum memahami
wayang.
Kalimat sanggahan yang sesuai dengan masalah di atas adalah
a. Sebaiknya seni wayang tidak perlu dikembangkan karena tidak
sesuai dengan zaman modern.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 182
b. Untuk melestarikan seni tradisional, sebaiknya semua seni
tradisional disatukan.
c. Lestarikan seni tradisional sebagai khasanah kebudayaan
Indonesia.
d. Seni wayang merupakan seni asing sebaiknya tidak perlu
dikembangkan.
e. Generasi muda tidak perlu mempelajari seni wayang.
13. Kalimat simpulan yang baik dalam diskusi adalah
a. Mengingat suara terbanyak, diskusi ini saya simpulkan....
b. Simpulan ini adalah milik para peserta diskusi.
c. Kami akan membaca beberapa simpulan sebelum diskusi ini kita
akhiri.
d. Hendaknya kalian paham bahwa ini adalah simpulan diskusi.
e. Saya yakin peserta diskusi menyetujui simpulan diskusi ini.
14. Yang bukan syarat untuk mengungkapkan pendapat dalam diskusi
ialah
a. pendapat yang disampaikan bersifat terbuka
b. pendapat yang digunakan tidak memecahkan masalah
c. kalimat yang digunakan tepat
d. pendapat yang digunakan didukung oleh fakta
e. pendapat yang digunakan berhubungan dengan topik diskusi
15. Penyampaian gagasan yang paling meyakinkan terdapat pada
a. Barangkali Borobudur itu sudah ada sejak abad ke-200 sebelum
Masehi.
b. Menurut saya, penerapan teknologi modern di kalangan pendidikan
menengah dan pesantren harus sudah mulai digalakkan.
c. Sekitar lima puluh kuli tinta dari berbagai media bersedia melawan
perdagangan narkoba konon kabarnya.
d. Saya kira telah terjadi berbagai bencana di Jawa Tengah dan
sekitarnya selama musim hujan.
e. Mungkin beberapa calon kepala desa akan diumumkan minggu
depan.
16. Di bawah ini, kalimat yang berupa sanggahan adalah
a. Sebaiknya diskusi ini tak usah dilanjutkan.
183 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
b. Sudahlah, kita jadi penonton saja dalam diskusi ini.
c. Sanggahan yang kamu kemukakan tadi memang tepat.
d. Maaf, pendapat Saudara memang baik, namun kurang didukung
oleh fakta yang akurat.
e. Gagasanmu memang luar biasa.
17. Kata-kata yang dapat digunakan untuk menyanggah pendapat yang
baik adalah di bawah ini, kecuali
a. kurang sependapat
b. perlu ditinjau kembali
c. sama sekali tidak tepat
d. kurang setuju
e. belum bisa diterima
18. Kalimat berikut menyatakan persetujuan, kecuali
a. Pendapat Anda sama dengan pemikiran saya.
b. Saya sangat setuju dengan gagasan Anda.
c. Tak ada salahnya kalau kita pertimbangkan dulu usulan Saudara.
d. Apa yang Saudara ungkapkan tidak ada salahnya.
e. Pernyataan Anda sangat sesuai dengan keinginan saya.
19. Pendapat: agar pembangunan ekonomi dan peningkatan kesejahteraan
masyarakat dapat terlaksana dengan cepat, perlu dibarengi dengan
pengaturan pertumbuhan penduduk melalui program KB.
Kalimat yang tepat untuk menanggapi pendapat tersebut adalah
a. Pengaturan pertumbuhan penduduk melalui program KB tidak
perlu digalakkan.
b. Menurut saya, apa yang Saudara kemukakan itu tidak selamanya
benar.
c. Hal itu bisa terlaksana apabila penduduk dipaksa mengikuti
program KB.
d. Saya sependapat dengan apa yang dikemukakan penyaji sebab
program KB bertujuan meningkatkan kesejahteraan masyarakat.
e. Mudah-mudahan dengan banyaknya penduduk, negara kita akan
makin makmur.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 184
20. Kalimat sanggahan yang tepat dan santun adalah
a. Pendapat Anda tidak ilmiah sama sekali.
b. Saya sangat tidak setuju dengan pernyataan Saudara tadi.
c. Saya tidak menerima pendapat Saudara, kecuali semua peserta
menyetujuinya.
d. Saya kurang sependapat dengan gagasan Anda, ada hal yang kurang
sesuai dengan topik pembicaraan mohon ditinjau kembali.
e. Saya pikir pendapat Anda sudah tidak relevan lagi dengan situasi
sekarang.
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Apa yang dimaksud dengan diskusi?
2. Sebutkanlah manfaat dari diskusi!
3. Sebutkan peranan moderator!
4. Sebutkan peranan penyaji!
5. Sebutkanlah tugas notulis!
6. Sebutkan tugas atau peranan peserta diskusi!
7. Sebutkan yang termasuk unsur manusia dalam diskusi!
8. Buatlah 2 kalimat yang berisi sanggahan yang santun terhadap
pendapat orang lain!
9. Buatlah 2 kalimat persetujuan yang santun terhadap pendapat orang
lain!
10. Hal apa saja yang harus diperhatikan dalam memberi tanggapan dalam
diskusi?
185 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Indikator
- Mengemukakan gagasan, pendapat, atau komentar
dalam kalimat yang menarik dan santun dengan
memerhatikan butir-butir yang akan dibahas
- Menyanggah pendapat orang lain dalam kalimat yang
santun dengan tetap menghargai pendapat mitra
bicara
- Meyakinkan mitra bicara untuk menyetujui pendapat
pembicara dengan sikap dan kalimat yang cermat,
serta argumentasi yang rasional

Kompetensi
Dasar
- Bernegosiasi yang menghasilkan dalam konteks
bekerja
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Pada pelajaran ini, kita diajarkan tentang bernegosiasi mulai dari pengertian
negosiasi, perlunya negosiasi, persyaratan untuk bernegosiasi yang berhasil,
serta mencermati dialog yang mencerminkan kegiatan negosiasi. Diharapkan
setelah mempelajari bab ini, kita akan memahami hal-hal yang berkaitan
dengan negosiasi yang baik serta mampu menghasilkan dan melakukan
negosiasi.
BAB 10
BERNEGOSIASI YANG MENGHASILKAN
DALAM KONTEKS BEKERJA
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 186
Wacana
Perlu Intensif Pengembangan,
Biodiesel-Gasohol pengganti BBM
Pemakaian energi alternatif perlu diberikan program intensif oleh
pemerintah untuk mengurangi penggunaan bahan bakar minyak (BBM).
Pemakaian energi alternatif baru dan terbarukan sebagai pengganti BBM
perlu dilakukan mengingat cadangan BBM yang makin berkurang. “Saya
harapkan Presiden mau memberikan insentif untuk mengembangkan
energi baru dan terbarukan,” kata Menristek/Kepala Badan Pengkajian
dan Penerapan Teknologi (BPPT) Kusmayanto Kadiman pada peluncuran
perdana Gasohol BE-10 untuk bahan bakar otomotif, di Jakarta, baru-baru
ini.
Di negara lain seperti di Austria, Pemerintah Austria memberikan
keringanan pajak dan pemberian voucher kepada pemilik mobil yang
menggunakan biodesel sebagai bahan bakar kendaraannya.
Berbeda pendapat dengan pakar energi lainnya, Kusmayanto menga-
takan subsidi Pemerintah terhadap BBM dianggap bukan sebagai faktor
penyebab dan energi terbarukan kalah bersaing dengan harga BBM.
Menurut dia, dalam pengolahan biodiesel maupun gasohol tetap
membutuhkan BBM sehingga bila harga BBM naik, akan mempengaruhi
harga biodiesel maupun gasohol juga. Namun, harus diakui bahwa har-
ganya menjadi lebih murah dan persoalan pokoknya bahwa biodiesel
maupun gasohol adalah energi terbarukan, tidak seperti BBM yang makin
habis disedot dari bumi.
Itu sebabnya lebih baik diberikan potongan pajak kendaraan bermotor
misalnya, bagi mereka yang menggunakan bahan bakar biodisel atau
gasohol, katanya. Selain insentif, Pemerintah juga dapat memanfaatkan
lahan-lahan marjinal di sejumlah daerah sebagai lahan untuk ditanami
dengan tanaman sumber energi terbarukan seperti singkong dan tanaman
jarak yang merupakan bahan bakunya, kata Kusmayanto.
Pemakaian gasohol maupun biodiesel mendukung program langit biru
karena dapat menurunkan kadar emisi gas berbahaya seperti CO, Nox, Sox,
senyawa aromatik dalam bensin serta partikel lembut kurang dari 10um,
kata Menristek. Sementara itu, Diputi Bidang Teknologi Agroindustri dan
Bioteknologi BPPT, Wahono Sumaryono, mengatakan, dengan memakai
187 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
energi ramah lingkungan, Indonesia berpeluang mendapatkan insentif
Carbon Credit dari Bank Dunia sebesar 10 dolar AS setiap pengurangan
emisi CO
2
satu meter kubik seperti yang diatur oleh Protocol Kyoto.
Pemanfaatan gasohol, katanya, tidak memerlukan perubahan apa pun
paa jaringan atau infrastruktur distribusi BBM, maupun mesin kendaraan
yang ada. Dari hasil uji konfrmasi yang dilakukan Balai Termodinamika
Motor dan Propulsi BPPT atas unjuk kerja mesin mobil yang berbahan bakar
Gasohol BE-10 dan BE-20, ditemui adanya peningkatan efsiensi pembakaran
nilai kalor FGE hanya dua per tiga nilai kalor bensin, katanya.
“Kinerja mesin menyamai penggunaan pertamax,” kata Wahono.
Bahan baku Gasohol BE-10 adalah singkong yang diproses menjadi ethanol
anhydrous 99% atau bioethanol fuel great (FGE).
Ethanol anhydrous 99% atau bioethanol fuel great (FGE) dapat dicampurkan
ke dalam bensin hingga 20% sebagai aditif (octane enhancer) ataupun
subsitusi bahan bakar otomotif tanpa harus mengubah mesin yang sudah
ada. Bahan bakar campuran ini populer disebut gasohol.
Beberapa negara yang telah lama mengaplikasikan gasohol antara lain
Amerika Serikat (Gasohol-10), Kanada (Gasohol-10), Brasil (ethanol murni
dan Gasohol-20), India (gasohol-10), Cina (Gasohol-10), Thailan (Gasohol-
10). Menurut Wahono, apabila implementasi Gasohol BE-10 (Gasoline 90%,
bioethanol 10%) mencapai seperlima dari total konsumsi bensin, maka
dibutuhkan FGE 0,3 juta KL per tahun. Padahal, kapasitas produksi ethanol
saat ini hanya berkisar 0,18 juta KL sebagai crude alchohol kadar 96%.
Peningkatan jumlah produksi dan kualitasnya menjadi FGE akan
membutuhkan sedikitnya sembilan pabrik ethanol masing-masing
berkapasitas 100 KL per hari, katanya. Agar suplai bahan bakunya (singkong)
dapat terjamin, perlu dikembangkan lahan pertanian seluas 70.000 hektar,
kata Wahono.
Sayangnya, hingga saat ini belum ada satu pun pabrik ethanol di
Indonesia yang mampu memproduksi FGE. Balai Besar Teknologi Pati
BPPT di Lampung telah memproduksi FGE secara dehidradi 50 liter per
hari. Produksi FGE tersebut hanya untuk keperluan uji unjuk kerja otomotif
berbahan bakar Gasohol BE-10 yang akan dimasyarakatkan kembali.
Menurut Wahono, pilot plant Ethanol BPPT berkapasitas 8.000 liter per hari
itu masih dapat ditingkatkan kemampuannya untuk menghasilkan FGE.
Dalam peluncuran perdana Gasohol BE-10 itu, Menristek mencanangkan
pemakaian gasohol sebagai bahan bakar pada kendaraan dinas yang
digunakan sehari-hari di lingkungan kementeriannya.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 188
BBM hampir selalu menjadi masalah di semua pemerintahan di dunia
apabila harus menaikan harganya. Menyakut kenaikan harga BBM dewasa
ini, dalam suatu artikelnya di koran terkemuka di Jakarta, Romo Prof.DR.
Franz Von Magnis Suseno, SJ. Menyatakan pendapatnya bahwa dengan
harga BBM yang rendah tidak menguntungkan bagi upaya mencari bahan
bakar alternatif. Padahal BBM merupakan bahan bakar yang tidak dapat
diperbarui dan cadangannya sangat terbatas di perut bumi.
DR. Magnis Suseno mengakui, menghapus subsidi beberapa jenis
BBM strategis untuk masyarakat banyak seperti bensin, solar, dan minyak
tanah, tentu bukanlah alternatif yang dapat diterima semua pihak. Namun,
dengan itu masyarakat akan mencari alternatif lain pengganti BBM. Batu
bara misalnya, untuk kegiatan perusahaan. Demikian juga menyusul
kebiakan ini, masyarakat akan terdorong menggunakan bahan bakar gas
untuk kendaraan karena harga jual gas lebih murah, yaitu Rp. 1.550. per
liter.
(Sumber: Media Akademika, edisi Mei 2005)
A. Pengertian Negosiasi
Dalam Kamus Besar Bahasa Indonesia (KBBI), negosiasi adalah: Proses
tawar-menawar dengan jalan berunding guna mencapai kesepakatan
bersama antara satu pihak dan pihak lainnya; penyelesaian sengketa secara
damai melalui perundingan antara pihak yang bersengketa.
Dari pengertian tersebut, dapat kita simpulkan bahwa negosiasi
adalah proses yang ditimbulkan oleh adanya unsur dua pihak, perbedaan,
dan keinginan untuk berunding. Negosiasi dapat diartikan pula kegiatan
yang ditimbulkan oleh keinginan untuk memenangkan kemauan atau
kepentingan sendiri karena terhambat oleh kepentingan pihak lain atau
adanya pemikiran yang bertolak belakang. Pihak yang satu merasa konsep,
gagasan, program, atau sesuatu yang diingini dianggap sudah benar,
sementara pihak lain berpikiran sebaliknya. Dengan adanya perbedaan
prinsip tapi berada dalam kepentingan dan tujuan yang sama, terjadilah
negosiasi. Untuk mencapai negosiasi yang menghasilkan, perlu adanya
penyampaian argumentasi yang kuat dan tak terbantahkan dengan
kalimat yang menarik dan santun. Melalui kalimat yang menarik dan
santun, diharapkan pihak lain, selain mengakui kebenaran pendapat yang
189 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
dikemukakan juga tertarik pada penjelasan yang disampaikan sehingga
bersepakat.
Kita harus memiliki kemampuan bernegosiasi untuk berbagai hal yang
mungkin perlu dinegosiasikan. Kemampuan bernegosiasi juga diperlukan
jika suatu saat kita terlibat dalam kegiatan bernegosiasi, seperti untuk
kepentingan organisasipekerjaan, atau yang berhubungan dengan hajat
orang banyak. Untuk dapat bernegosiasi dengan baik dan berhasil, beberapa
hal berikut yang perlu kita perhatikan.
1. Memahami persoalan yang akan dinegosiasikan.
2. Memiliki informasi dan data tentang persoalan yang akan dinego-
siasikan sebagai bahan argumentasi
3. Mengungkapkan gagasan atau pendapat dengan alasan yang rasional
4. Menyampaikan penjelasan dengan kalimat yang menarik, efektif, dan
santun
5. Bersikap sabar dan terbuka menerima pendapat orang lain
6. Berupaya meyakinkan mitra bicara tentang penting dan bergunanya
hal yang kita negosiasikan secara santun
7. Menghindari sikap menjatuhkan pendapat orang lain
8. Memiliki beberapa alternatif konsep lain yang tak jauh beda bila konsep
pertama tak bisa diperjuangkan
Di samping itu, kita harus banyak berlatih mengungkapkan pendapat
melalui diskusi atau dialog. Dengan seringnya berlatih menyampaikan
kalimat yang menarik dan santun, kita akan mudah serta terampil
bernegosiasi. Salah satu pelatihan untuk belajar bernegosiasi ialah seringnya
mengikuti rapat-rapat dalam organisasi sekolah seperti OSIS.
B. Bernegosiasi dalam Menyusun Program Kerja
Sebuah organisasi pasti memiliki program kerja sebagai acuan kegiatan
selama kurun waktu tertentu. Program kerja berisi rencana-rencana kegiatan
yang rutin dan insidental disertai jadwal atau waktu pelaksanaannya.
Semua kegiatan biasanya dirancang berdasarkan tujuan serta visi dan misi
organisasi tersebut.
Di sekolah ada Organisasi Siswa Intra Sekolah (OSIS) yang merupakan
wadah seluruh kegiatan siswa terutama kegiatan ekstrakulikuler (ekskul).
OSIS juga mempunyai program kerja yang berkaitan dengan kegiatan-
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 190
kegiatan yang diindukinya, seperti paskibra, pramuka, keagamaan, PMR,
kesenian, atau olahraga. Setiap bidang kegiatan pada awal tahun membuat
program kegiatan yang selanjutnya akan menjadi agenda/program kerja
tahunan OSIS. Sebuah program kerja tidak serta merta dibuat dan dapat
dilaksanakan, tetapi harus melalui perundingan dan permufakatan di
kalangan pengurus OSIS lainnya. Hal itu perlu sebab sebuah program kegiatan
harus dipahami dulu latar belakang, tujuan, sasaran, tempat pelaksanaan,
orang-orang yang melaksanakan, serta biaya yang dikeluarkan. Tak jarang
sebuah program atau rencana kerja sebelum pembentukan panitia untuk
dilaksanakan, perlu dirundingkan dulu. Singkatnya, sebuah program harus
dipelajari dengan cermat apakah rencana kerja atau kegiatan tersebut layak
dilaksanakan dan tujuannya sesuai dengan visi dan misi organisasi. Selain
itu, program kerja juga harus realistis, logis, dan ekonomis.
Dalam perundingan mengenai program kerja, ada program yang
diterima ada juga yang tertolak atau perlu direvisi bergantung pada
argumentasi pihak pembuat program. Tentunya melalui tawar-menawar
antara pengusul program dan pihak yang menolak. Tawar-menawar dalam
merumuskan sesuatu itu wajar terjadi. Inilah yang disebut negosiasi.
C. Bernegosiasi dengan Santun
Seperti juga dalam diskusi ada yang menyanggah suatu usulan dan
ada yang mendukung, semua itu harus berakhir pada satu titik pertemuan
pandangan yang melahirkan suatu simpulan. Demikian juga dengan
negosiasi. Pada sebuah musyawarah atau perundingan, pada akhirnya harus
menuju suatu keputusan yang damai dan dapat diterima semua pihak. Oleh
sebab itu, proses bernegosasi harus dilakukan dengan bahasa yang santun,
menggunakan ungkapan yang tidak bernuansa konfik. Sanggahan yang
diutarakan juga dengan alasan yang tepat dan dapat menyakinkan orang
lain. Jika butuh sebuah perincian, kemukakan dengan lugas, dan tidak
berputar-putar sehingga tidak membuat orang salah pengertian. Berikut ini
contoh proses berdiskusi dan negosiasi dalam merumuskan suatu program
kerja.
Saat berlangsungnya rapat OSIS SMK Nurul Iman, yang dipimpin
langsung oleh Ketua Umum OSIS dengan topik pembicaran merumuskan
program kerja 1 tahun. Pembicaraan alot terjadi ketika membahas kegiatan
jambore latgab (latihan gabungan) beberapa bidang ekskul yang dimotori
oleh pengurus ekskul pramuka. Ada beberapa ekskul yang dilibatkan,
191 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
seperti Majalah Dinding (Mading) dan KIR (Karya Ilmiah Remaja). Namun,
bidang ekskul, khususnya PMR dan Paskibra, tidak setuju. Mereka
mengganggap kegiatan latgab, khusus untuk bidang ekskul tertentu saja.
Jadi tidak semua bidang ekskul pantas menjadi peserta latgab. Berikut
cuplikan percakapannya.
Ketua OSIS : ”Teman-teman pengurus OSIS, dalam kegiatan latgab
bulan depan, pihak Pramuka mengizinkan seksi
Mading diikutsertakan pada latihan gabungan tersebut.
Sebagaimana seksi KIR. Sebelum kita putuskan, apakah
ada yang ingin menanggapi?”
Anto : ”Mohon maaf, bukannya saya tidak setuju ada
tambahan kelompok peserta latgab yang dalam hal ini
seksi Mading, namun orientasi latihan gabungan ini
kan mengarah pada lebih banyak kegiatan yang bersifat
pelatihan fsik. Jadi, menurut saya, keikutsertaan
seksi Mading menjadi kurang efektif dan tidak pada
tempatnya.”
Tari : ”Saya sependapat dengan Anto, latihan gabungan
ini jika dilihat dari nama kegiatannya, tentu kita
tahu bahwa pada kegiatan ini, kita mengnyinergikan
peranan beberapa ekskul yang pada intinya memiliki
kesamaan materi yang dipelajari di bidang ekskulnya,
yaitu keterampilan psikomotorik. Saya malah
menyarankan untuk latgab tahun ini, peserta ekskul
hanya melibatkan PMR, Paskibra, dan pramuka.”
Dwi : ”Mohon maaf sekali lagi rekan-rekan, jika selama
ini Pramuka yang memotori kegiatan latgab sehing-
ga kami yang merencanakan proses kegiatan ini.
Sebenarnya jika kita cermati tujuan diadakannya
latgab ini, yaitu mengupayakan adanya kebersamaan
di tubuh OSIS dalam bidang apa pun. Sebab, induk
kita adalah sama semua ekskul membawa visi dan misi
sekolah kita dan melibatkan para siswa di SMK kita.
Tak ada salahnya jika kita mengajak semua bidang
ekskul untuk terlibat pada jambore/latgab ini. Kami
malah berkeinginan semua bidang ekskul terlibat.
Masalah butuh pelatihnya, nanti akan kita rumuskan
bersama, kita hendaknya tidak memandang pelatihan
(wakil Paskibra)
(wakil PMR)
(wakil Pramuka)
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 192
ini sebagai bentuk latihan keterampilan untuk fsik saja,
namun juga setiap peserta apa pun bidang ekskulnya,
butuh pelatihan yang bersifat kognitif. Mungkin
rekan-rekan di Mading dan KIR dapat memberikan
konsep dan keterampilan khusus untuk hal ini.”
Anto : ”Semua yang dikemukakan teman Dwi betul. Namun,
bagaimana perencanaan mengenai akomodasi dan
biaya pastilah akan mengalami pembengkakan. Sekali
lagi kami minta maaf, bukannya kami bermaksud
menyepelekan teman-teman di bidang lain. Ini hanya
ingin supaya kegiatan tak harus bernuansa hura-hura,
tapi lebih terfokus dan efektif karena OSIS tetap akan
mengakomodasi semua kegiatan bidang lainnya pada
bentuk kegiatan yang proporsional.”
Tari : ”Apa yang disampaikan Anto tidak salah jika pan-
dangannya lebih mengarah pada proses penyeleng-
garaan. Kami akan mengupayakan semaksimal
mungkin untuk meringankan beban keuangan OSIS.
Tapi, kami mohonkan pengertian semua pihak bahwa
melibatkan banyak pihak bukan berarti berhura-hura.
Kepada Ketua umum OSIS, kami mencoba ingin
adanya kebersamaan yang total di tubuh OSIS. Kami
mohon tawaran kami ini didukung.”
Ketua OSIS : ”Baiklah jika pihak Pramuka yang menjadi ”master of
job” kegiatan ini menjamin pihak OSIS dan sekolah
tidak menjadi susah dalam proses penyelenggarannya,
menurut saya kita coba saja, tak ada salahnya
bukan?”
.....
Akhirnya, OSIS menetapkan kegiatan latgab melibatkan semua bidang
ekskul bukan saja Mading dan KIR.
(wakil Paskibra)
(wakil Pramuka)
193 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
RANGKUMAN
A. Pengertian Negosiasi
Negosiasi adalah proses tawar-menawar dengan jalan berunding guna
mencapai kesepakatan bersama antara satu pihak dengan pihak lainnya.
Dari pengertian tersebut, dapat kita simpulkan bahwa negosiasi adalah
proses yang ditimbulkan oleh adanya unsur dua pihak, perbedaan, dan
keinginan untuk berunding.
B. Bernegosiasi dalam Menyusun Program Kerja
Dalam perundingan mengenai program kerja, ada program yang
diterima ada juga yang tertolak atau perlu direvisi bergantung pada
argumentasi pihak pembuat program. Tentunya melalui tawar-menawar
antara pengusul program dan pihak yang menolak. Tawar-menawar
dalam merumuskan sesuatu itu wajar terjadi. Inilah yang disebut
negosiasi.
C. Bernegosiasi dengan Santun
Sebuah musyawarah atau perundingan pada akhirnya harus menuju
suatu keputusan yang damai dan dapat diterima semua pihak. Oleh
sebab itu, proses bernegosasi harus dilakukan dengan bahasa santun
menggunakan ungkapan yang tidak bernuansa konfik. Sanggahan yang
diutarakan juga dengan alasan yang tepat dan dapat menyakinkan orang
lain. Jika butuh sebuah perincian, kemukakan dengan lugas, dan tidak
berputar-putar sehingga tidak membuat orang salah pengertian.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 194
TUGAS KELOMPOK
Bagilah kelas menjadi 8 kelompok. Setiap kelompok dipasangkan
dengan kelompok lainnya sehingga ada 4 kelompok berpasangan. Setiap
kelompok yang sudah berpasangan, masing-masing akan menjadi pihak
ke- 1 dan pihak ke-2 yang akan bernegosiasi. Lakukanlah kegiatan
negosiasi dengan persoalan berikut ini.
1. Sekolah akan mengadakan pentas seni dalam rangka HUT sekolah.
Untuk mengisi acara, seksi Acara, merencanakan salah satunya
mengundang penyanyi dangdut selain group band. Terjadi pro dan
kontra. Pihak ke-1 setuju, tapi pihak ke-2 tidak setuju dengan alasan
masing-masing.
2. Sekolah akan membuat peraturan bahwa siswa dilarang mem-
bawa HP ke sekolah. Hal ini lalu diserahkan ke siswa untuk
dimusyawarahkan. Pihak ke-1 setuju, tapi pihak ke-2 tak setuju
dengan argumentasi masing-masing.
3. Pihak pertama setuju acara pelepasan kelas XII diadakan di luar
sekolah, pihak kedua berpendapat di dalam sekolah saja dengan
bentuk acara hiburan atau panggung.
4. Mengenai keterlibatan kelas XII dalam ekskul dan perlombaan antar-
sekolah, pihak pertama setuju karena punya pengalaman, tapi pihak
kedua tak setuju karena akan menggangu persiapan menghadapi
ujian.
Setiap kelompok yang berpasangan memilih permasalahan di
atas dan dikembangkan menjadi sebuah persoalan yang menuntut
negosiasi. Seluruh siswa dalam kelompok diharapkan berlatih untuk
mengemukakan pendapat dan menghargai pendapat pihak lain dengan
santun. Guru dapat menilai keaktifan siswa dalam kegiatan ini.
195 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Jika dalam suatu negosiasi, pihak Anda tidak memenangkan negosiasi,
yang tidak selayaknya Anda lakukan adalah
a. menerima dengan sikap positif
a. memperjuangkannya lagi di lain kesempatan
b. menghargai keputusan yang telah disepakati
c. menyadari bahwa pihak Anda memang masih banyak
kekurangan
d. mengusahakan jalan pintas yang licik
2. Berikut ini pernyataan yang tidak benar dalam bernegosiasi
adalah
a. Sebelum bernegosiasi, orang yang bernegosiasi harus melakukan
persiapan.
b. Pakailah segala cara untuk memenangkan negosiasi.
c. Orang yang bernegosiasi harus saling menghormati.
d. Orang yang bernegosiasi harus mematuhi aturan.
e. Usaha berdiskusi, tidak berdebat dan hindari pula konfrontasi,
percekcokan, dan perseteruan.
3. Pernyataan yang tidak tepat dalam penyampaian pendapat dalam
negosiasi adalah
a. menyampaikan pendapat yang dapat menyakinkan mitra bicara.
b. menyampaikan pendapat dengan kalimat yang menarik
c. menyampaikan pendapat dengan kalimat yang santun
d. menyampaikan pendapat dengan ucapan-ucapan licik
e. menyampaikan pendapat dengan argumentasi yang benar
4. Penyampaian negosiasi memenuhi kriteria berikut, kecuali
a. logis d. lugas
b. sistematis e. subjektif
c. mendalam
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 196
5. Seorang negosiator harus mempunyai sifat berikut, kecuali
a. supel
b. pemurah
c. terpecaya
d. terampil bicara
e. luwes
6. Kata negosiasi berasal dari bentukan
a. negasi + asi
b. negasi + iasi
c. negoi + asi
d. nego + siasi
e. negoi + iasi
7. Program kerja harus bersifat realistis, maksudnya
a. sesuai dengan keadaan
b. sesuai dengan harapan
c. dapat dipertanggungjawabkan
d. dapat diwujudkan secara nyata
e. dapat menghasilkan uang
8. Program kerja harus bersifat logis, maksudnya
a. dapat dicerna akal
b. mudah dicerna akal
c. uraiannya tidak berbelit-belit
d. mudah dipahami
e. tidak bertentangan dengan kenyataan
9. Program kerja harus bersifat ekonomis, maksudnya
a. membutuhkan biaya banyak
b. tidak memerlukan biaya besar
c. tidak membutuhkan anggaran
d. tidak sulit dilakukan
e. membutuhkan banyak pihak yang terlibat
10. Ungkapan bernuansa konfik yang harus dihindari adalah di bawah
ini, kecuali
a. tidak masuk akal
197 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
b. tidak benar sama sekali
c. boleh–boleh saja
d. mustahil dilakukan
e. banyak negatif
11. Kesatuan sebuah ungkapan harus didasarkan pada pertimbangan di
bawah ini, kecuali
a. menghargai mitra bicara
b. memilih kata yang baik
c. menyusun perencanaan lain
d. menyanggah pendapat lain
e. mencabut hak bicara bagi yang menolak
12. Kesimpulan rapat dari panitia pelepasan siswa kelas 3 SMK Jaya Bakti …
a. Menolak pertunjukan dangdut.
b. Menyetujui diadakan pertunjukan dangdut.
c. Ragu-ragu dalam mengadakan pertunjukan dangdut.
d. Tidak boleh diadakannya pertunjukan dangdut sebab terlalu
vulgar.
e. Alasan saudara Joni, dangdut merupakan khas Indonesia.
13. Contoh tanggapan yang santun dalam kalimat diskusi
a. Saya tidak terima dengan tanggapan Saudara, bahwa musik
dangdut itu murahan.
b. Saya sependapat bahwa musik dangdut itu vulgar.
c. Maaf Saudara Dini, tanggapan lagu dangdut saya terima. Tetapi,
lagu dangdut sangat merakyat dan syairnya pun diambil dari
kehidupan sehari-hari.
d. Saya menolak pendapat Saudara Joni tentang musik dangdut.
e. Maaf saudara Nita, saya menolak pendapat Saudara Nita tentang
lagu dangdut yang terkesan kampungan.
14. Urutan acara sambutan
a. Pembukaan oleh panitia, sambutan kepala sekolah, acara hiburan
sekaligus penutupan.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 198
b. Sambutan kepala sekolah, pembukaan oleh panitia, acara
hiburan.
c. Pembukaan oleh panitia, berdoa, acara hiburan, dan penutup.
d. Berdoa yang dibawakan oleh guru agama, sambutan kepala
sekolah, acara hiburan, dan penutup.
e. Pembukaan oleh kepala sekolah, sambutan oleh panitia, hiburan,
dan penutup.
15. Program kegiatan biasanya dibuat untuk hal–hal yang berkaitan
dengan
a. pentas seni, paskibraka, pramuka, dan keagamaaan
b. kebersihan sekolah, tata tertib sekolah, dan pembayaran uang
sekolah
c. upacara bendera, keamanan sekolah, dan tata tertib sekolah
d. pentas seni, kebersihan sekolah, dan latihan upacara bendera
e. kelompok belajar dan paduan suara
16. Negosiasi mengupayakan agar sebuah program kerja atau usulan tidak
dibuat seperti di bawah ini, kecuali
a. diterima
b. direvisi
c. diganti
d. ditolak
e. ditinjau ulang
17. Dalam menyampaikan alasan bernegosiasi, diperlukan sikap-sikap ini,
kecuali
a. arif
b. sabar
c. tak mau kalah
d. semangat
e. penuh pengertian
18. Dalam diskusi “Narkoba”, seseorang peseta mempertahankan penda-
patnya. Ungkapan yang santun adalah
a. Saudara-saudara semua, tahukah narkoba sangat merugikan. Oleh
199 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
sebab itu, harus dicegah.
b. Saudara-saudara harus paham, dong, kegiatan narkoba oke banget!
c. Saudara-saudara harus maklum, narkoba mesti kita berantas!
d. Saudara-saudara, kegiatan penyuluhan narkoba perlu kita lakukan
sebab memiliki efek yang positif untuk penyalahgunaan
e. Narkoba. Saudara-saudara, kalau kegiatan ini ditolak, berarti
Saudara semua bandar narkoba.
19. Sebuah rumusan yang merupakan acuan untuk pelaksanaan sebuah
pekerjaan/kegiatan disebut
a. jadwal kerja
b. agenda kerja
c. program kerja
d. pedoman kerja
e. hasil kerja
20. Proses tawar-menawar dengan jalan berunding guna mencapai
kesepakatan bersama antara satu pihak (kelompok atau organisasi)
dan pihak (kelompok atau organisasi) yang lain disebut …
a. tanya jawab
b. bercakap-cakap
c. diskusi
d. negosiasi
e. debat
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Jelaskan apa yang dimaksud negosiasi!
2. Syarat apa yang harus dimiliki oleh seorang negosiator?
3. Apa yang dimaksud dengan program kerja?
4. Bagaimana cara menyanggah yang santun?
5. Mengapa kita harus bernegosiasi dengan santun?
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 200
Amatilah perbincangan rapat OSIS SMK Nurul Iman pada materi
pelajaran ini. Lalu jawablah soal-soal di bawah ini!
6. Apakah inti permasalahan dalam rapat tersebut?
7. Apakah bahasa yang digunakan cukup santun dan tidak menyinggung
perasaan orang lain?
8. Apakah gagasan/ide disampaikan secara logis?
9. Apakah alasan diikutsertakannya ekskul Mading dan KIR dalam
latihan gabungan?
10. Bagaimana hasil keputusan rapat tersebut?
201 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

Indikator
- Menyampaikan fakta (dalam tuturan deskriptif, naratif,
dan ekspositoris) yang berkenaan dengan keadaan atau
peristiwa yang dilaporkan
- Menyampaikan keadaan atau peristiwa secara kronologis
(dalam tuturan deskriptif/naratif/ekspositoris) sesuai
dengan tuntutan keadaan atau peristiwa yang dilaporkan
secara lisan
- Menyampaikan rangkuman (kategorisasi) atau simpulan
(analisis/sintesis) dengan benar
Kompetensi
Dasar
- Menyampaikan laporan atau presentasi lisan dalam
konteks bekerja
Standar
Kompetensi
- Berkomunikasi dengan bahasa Indonesia setara tingkat
madya
Pada bab ini, kita akan belajar tentang laporan dan cara menyajikannya secara
lisan. Sebelumnya, akan dibahas mengenai sistematika laporan, pola dan
contoh laporan deskripsi, narasi, dan eksposisi. Dengan mempelajari materi
ini, kita diharapkan dapat membuat laporan dan dapat menyajikannya secara
lisan sesuai dengan sifat laporan. Selain itu, kita juga diharapkan mampu
membuat rangkuman dan simpulan laporan dengan benar.
BAB 11
MENYAMPAIKAN LAPORAN ATAU PRESENTASI
LISAN DALAM KONTEKS BEKERJA
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 202
Wacana
Makanan Unik dari Yogyakarta
Yogyakarta sebagai daerah istimewa memang selalu menjadi salah
satu tujuan wisata yang ramai dikunjungi oleh para wisatawan baik lokal
maupun luar negeri. Di samping memiliki ciri khas kebudayaan keraton
yang masih kental, banyak hal yang bisa diamati di Yogyakarta yang
belum tentu ada di wilayah lain, misalnya keanekaragaman jenis makanan
daerahnya. Jika kita ke Yogyakarta, yang biasanya teringat di benak kita
adalah gudeg yogya, bakpia patok, atau makanan lesehan yang terdapat di
sepanjang Jalan Malioboro. Sebenarnya selain dari dua makanan khas yang
terkenal dari Yogya dan penyajian ala lesehan itu, ada juga makanan lain
yang terasa unik didengar dan masih asing di telinga kebanyakan orang
yang bukan penduduk Yogyakarta. Makanan itu disebut dengan “sego
kucing” atau nasi kucing.
Mendengar nasi kucing, yang terbayang adalah nasi yang biasa
diberikan untuk kucing. Lalu mengapa diual? Siapa yang mau makan
nasi buat kucing? Rupanya ini hanya istilah. Bagi yang pernah tinggal di
Yogyakarta, sudah tak asing lagi dengan yang namanya nasi kucing. Nasi
bungkus dengan lauk-pauk sambal teri, oseng-oseng tempe, dan bandeng
goreng ini biasanya disantap dengan tambahan lauk sate atau makanan
gorengan seperti tahu susur (tahu isi), tempe goreng tepung, bakwan tauge,
dan tahu atau tempe bacem.
Di Yogya, nasi kucing merupakan santapan ‘wajib’ mahasiswa sebab
harganya yang murah. Umumnya, mahasiswa yang sering terlambat
menerima kiriman uang dari orang tuanya harus hidup berhemat. Salah
satu pos penghematan adalah biaya konsumsi atau makan. Maka, nasi
kucing pun sering menjadi pilihan. Karena porsinya kecil, nasi kucing
ini cukup mengenyangkan dan sangat cocok disantap pada malam hari.
Biasanya malam hari jarang orang yang makan banyak. Sebungkus nasi
kucing ditambah sate dan minumannya hanya dihargai Rp 3.000. Lauk sate
yang tersedia bermacam-macam, yaitu sate babat, sate kepala, sate sayap,
sate telur puyuh, sate ati, sate ampela, sate usus, dan sate daging sapi.
Semua sate tersebut diberi bumbu bacem sehingga terasa manis.
Minuman yang tersedia untuk mengiringi santapan nasi kucing juga
bermacam-macam seperti es jerman (jeruk manis), es tehquila (es teh manis),
es tarik (es teh susu), dan kopi jos. Jenis minuman terakhir ini cukup unik,
203 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
baik rasa maupun cara membuatnya. Segelas kopi panas disiapkan lalu
dimasukkan sebongkah bara arang. Kabarnya, minuman ini berkhasiat
menghilangkan racun di dalam tubuh.
Selain nasi kucing, ada lagi makanan unik di kawasan Pasar Tradisional
Jejeran, Plered, Yogyakarta, jalan raya arah Yogyakarta ke Imogiri. Di
tempat itu, terdapat warung makan tradisional yang sangat terkenal.
Warung tersebut hanya berukuran 3 x 4 meter, namun pengunjungnya
sangat banyak, apalagi jika malam hari. Mobil-mobil plat B dan L berderet
memenuhi marka jalan di depan Pasar Jejeran.
Di pasar ini, ada warung makan yang menjual sate klatak, yaitu sate
kambing yang dibakar dengan arang pohon asam, tanpa dibumbui kecap
atau bumbu kacang layaknya sate yang kita kenal selama ini. Sate klatak
dibakar tanpa bumbu, namun memiliki aroma rasa yang natural dan gurih.
Untuk menciptakan rasa gurih, sebelum dibakar, daging terlebih dahulu
dicelup ke dalam kuah kaldu daging kambing. Selain itu, sate klatak harus
dibuat dari daging kambing muda.
Makanan khas dan unik juga terdapat di Klebengan, Selokan Mataram,
sebelah utara Kampus Fakultas Kedokteran Hewan UGM. Tepatnya di
sebuah resto yang dulunya kantin kampus dan sekarang bernama Resto
SGPC Bu Wiryo. SGPC singkatan dari Sego Pecel khas Bu Wiryo yang begitu
sangat terkenal di kalangan mahasiswa UGM. Bahkan saking terkenalnya,
banyak alumni UGM dari berbagai daerah yang kini sudah banyak yang
menjadi pejabat, saat bertandang ke Yogyakarta, menyempatkan mampir
bersama keluarganya ke Resto SGPC Bu Wiryo. Resto ini tetap mempunyai
rasa yang khas seperti saat menjadi kantin kampus dulu, tak pernah berubah
dengan harga yang tetap murah dan menu yang unik. Ada menu SDSB (Sop
Daging Sayur Bayem), Sop Tanpa Kawat (Sop Tanpa So’un), Sop Bubrah
(sop yang diberi bumbu kacang pecel), Sop Tanpa Truk (sop tanpa kubis/
Kol), Pecel Keramas (nasi pecel diberi kuah sop), Pecel Pancasila (Pecel
dengan telur puyuh lima buah), Pecel Diuwel-uwel (pecel dibungkus), dan
yang agak baru ada menu SBY (sop bayem). Demikian juga minumannya,
ada Teh Mrengut (teh kental), Teh Kemulan (teh hangat), dan Teh Sengkuni
(teh dicampur jeruk). Anda tertarik untuk mencobanya?

(Sumber: Berita Kota, Januari 2008 dan Majalah
Kewirausahaan & Keuangan, Desember 2007)
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 204
A. Pengertian Laporan
Laporan adalah suatu cara komunikasi yang berisi informasi sebagai
hasil dari sebuah tanggung jawab yang dibebankan kepada pembuatnya.
Dengan kata lain, sebuah dokumentasi yang berisi fakta-fakta dari hasil
penyelidikan suatu masalah sebagai bahan acuan pemikiran, penilaian
serta tindakan. Laporan lebih banyak disampaikan dalam bentuk tertulis
dan juga bisa disampaikan secara lisan. Laporan berguna untuk:
(1) alat pertanggungjawaban secara tertulis
(2) pendokumentasian data
(3) bahan pertimbangan
(4) acuan pengambilan keputusan
(5) alat merumuskan suatu penilaian
(6) bahan evaluasi
(7) melatih berpikir sistematis
Baik berbentuk tulisan maupun lisan, kriteria penyampaian laporan
yang baik dilihat dari tiga hal berikut.
(1) Isi laporan mencakup kelengkapan fakta, data yang akurat, faktual,
dan objektif.
(2) Penyajian mencakup penggunaan bahasa yang baik, jelas dan tepat,
sistematik serta menarik
(3) Penyajian lisan harus disampaikan dengan vokal yang jelas,
pengucapan, lafal, intonasi yang tepat dan gaya ekspresif yang
sesuai.
Sebelum laporan disajikan secara lisan, laporan terlebih dahulu disusun
dalam bentuk tertulis secara sistematis sehingga mudah dipahami.
Dari segi bentuk tertulis, laporan terbagi menjadi seperti berikut.
(1) Laporan berbentuk formulir, yaitu laporan yang tinggal mengisi pada
blangko yang disediakan.
(2) Laporan berbentuk memorandum, yaitu laporan yang diuraikan secara
singkat. Laporan ini dibuat dalam rangka proses hubungan kerja antara
atasan dan bawahan atau antar-unsur-unsur dalam suatu instansi.
3. Laporan berbentuk surat, yaitu laporan yang diuraikan lebih panjang
dari memorandum sebagaimana uraian dalam bentuk surat biasa. Jenis
laporan ini dapat dipergunakan untuk bermacam-macam topik.
205 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
(4) Laporan berbentuk naskah, yaitu laporan yang panjang, biasanya disusun
seperti makalah. Materi laporan dibagi menjadi beberapa topik dan
subtopik.
(5) Laporan berbentuk buku, yaitu laporan yang disusun dalam bentuk
buku.
Dari segi struktur penulisan, laporan terbagi seperti berikut
(1) Laporan formal, yaitu laporan yang struktur penulisannya lengkap,
terdiri atas:
a. halaman judul
b. halaman pengesahan
c. kata pengantar
d. dafar isi
e. dafar tabel (jika ada)
f. dafar grafk (jika ada)
g. pendahuluan, berisi latar belakang, tujuan, ruang lingkup
masalah/objek, pembatasan masalah/objek, dan sebagainya
h. bagian isi, berisi uraian pembahasan tentang masalah atau
objek yang dilaporkan serta hasil yang dicapai
i. simpulan dan saran, berisi hal-hal pokok atau intisari dari
pembahasan laporan serta penyampaian keinginan pelapor
terhadap hal-hal yang berkaitan dengan laporan yang belum
atau seharusnya ada.
Laporan formal sangat terikat dengan struktur penulisan. Laporan
formal biasanya dibuat untuk keperluan formal seperti dalam
ruang lingkup pekerjaan atau pendidikan, dan umumnya bersifat
berkala. Contoh laporan formal ialah laporan tentang keadaan
dan perkembangan proyek yang sedang dilaksanakan, laporan
penelitian ilmiah, dan laporan percobaan.
(2) Laporan informal, yaitu jika laporan tidak memenuhi persyaratan
sistematika di atas.. Sistematika atau struktur penulisannya lebih
sederhana atau memiliki model sistematika sendiri dan tidak
bersifat standar. Pembuatannya lebih cenderung memenuhi
kebutuhan informasi atau untuk mendapatkan data lapangan.
Yang termasuk laporan informal, ialah laporan perjalanan, laporan
pengamatan, dan laporan kunjungan.

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 206
B. Pola Penyajian Laporan secara Lisan
Baik laporan formal maupun informal disusun dengan menggunakan
bahasa yang baku. Laporan yang telah disusun bisa juga disampaikan
secara lisan. Oleh sebab itu, bentuk uraian laporan dapat disajikan dengan
pola penyajian narasi, deskripsi, dan ekspositoris.
Pola penyajian laporan bersifat narasi lebih menekankan uraian
secara kronologis, yaitu berdasarkan rangkaian waktu. Isi laporan bersifat
penceritaan atau pemaparan peristiwa tentang objek yang dilaporkan.
Yang termasuk laporan ini misalnya, laporan perjalanan, laporan
peliputan peristiwa, dan laporan berita (reportase). Laporan ini bersifat
pengungkapan fakta pada sebuah peristiwa atau keadaan. Oleh sebab
itu, laporan ini dituntut harus faktual (berdasarkan yang ada), aktual
berkaitan realita dengan kejadian yang baru terjadi, akurat berdasarkan
bukti-bukti yang dapat dipertanggungjawabkan dan objektif (apa adanya).
Sebagaimana sebuah berita, pengungkapan informasinya bermuatan 5 W +
I H (what: apa, who: siapa, where: dimana, when: kapan, why: mengapa dan
how: bagaimana).
Lain lagi dengan pola penyajian laporan bersifat deskripsi. Laporan ini
lebih terfokus pada penggambaran mengenai lokasi, tempat, dan bentuk
fsik serta ciri-ciri objek yang dilaporkan. Yang termasuk laporan deskripsi
ialah laporan pengamatan, laporan kunjungan, laporan observasi, dan
sebagainya.
Pola penyajian laporan bersifat ekspositoris berupa uraian yang berisi
langkah-langkah kerja, proses kejadian, atau pemaparan mengenai tahapan-
tahapan perkembangan objek yang dilaporkan. Yang termasuk laporan
bersifat ekspositoris adalah laporan penelitian, laporan percobaan, laporan
pertanggungjawaban uraian pekerjaan yang menggunakan tahapan, dan
sebagainya.
Berikut adalah contoh-contoh laporan berbentuk narasi, deskripsi, dan
ekspositoris
Contoh laporan narasi berupa laporan perjalanan
Sibetan, Kabupaten Karang Asem, 78 kilometer sebelah timur
Denpasar adalah desa tempat asal salak bali. Terletak di ketinggian 350-
550 m dari permukaan laut. Desa ini dapat dicapai dari Denpasar dalam
waktu 2,5 jam melalui Padang Bai-Amlapura dengan ongkos Rp 2.000.
Kendaraan umum dari Denpasar memang hanya sampai Amlapura. Sisa
207 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
perjalanan sejauh 14 kilometer ke Sibetan diteruskan dengan angkutan
umum Isuzu hiau dengan ongkos Rp 5.000.
Sebenarnya, Sibetan bisa dicapai dalam waktu lebih singkat kalau
kita mengambil jalur Denpasar-Klungkung-Besakih. Di Kota Rendang,
kita turun dan menyambung perjalanan ke selat. Sayang kan, kendaraan
umum Rendang-Selat hampir tidak ada sehingga memang lebih mudah
datang ke Sibetan melalui Padang Bai-Amlapura.
Hari Senin, setelah menempuh perjalanan selama tiga jam melalui
Padang Bai-Amlapura, Trubus tiba di Sibetan pukul 14.00 WITA. Udara
terasa sejuk meskipun siang itu matahari bersinar terik. Di kiri kanan
jalan yang menanjak dan berkelok-kelok terlihat hamparan kebun salak
dan di tengah-tengah kebun, terlihat rumah para petani.
Kondisi lingkungan Sibetan memang cocok untuk salak. Iklimnya
termasuk basah dengan curah hujan rata-rata 2.145 mm/tahun dan jumlah
hari hujan 84 hari. Dalam situasi normal, setahun ada tujuh bulan basah
(Oktober-April) dan lima bulan kering (Mei-September). Topografnya
berbukit-bukit. Jenis tanahnya latosol cokelat kemerah-merahan. Tanah
seperti ini kalau disiram air, menjadi licin dan lengket. Waktu Trubus ke
sana, kebetulan hujan tidak turun sehingga walaupun jalan tanah di desa
itu naik-turun, tetapi tidak licin.
Contoh laporan narasi berupa laporan liputan peristiwa
Ratusan civitas akademika Universitas Trisakti kemarin memperingati
sembilan tahun Tragedi Trisakti. Para mahasiswa, karyawan, dosen,
dan pimpinan kampus melakukan pengibaran bendera setengah tiang
sebagai bentuk berkabung masyarakat Trisakti atas meninggalnya empat
mahasiswa pada 12 Mei 1998 itu.
Dihadiri seluruh masyarakat Trisakti, acara dimulai dengan
pengibaran bendera setengah tiang, tepat pukul 07.30 WIB. Upacara
tersebut bertempat di pelataran parkir depan Gedung Sjarif Thajeb yang
berada di depan Monumen Tragedi 12 Mei.
Rektor Universitas Trisakti, Thoby Mutis, pada kesempatan itu
meminta agar pemerintah menetapkan tanggal 12 Mei sebagai hari
antikekerasan. Selain itu, dia juga berharap nama besar yang disandang
empat mahasiswa Trisakti sebagai tokoh reformasi dapat dipertahankan
oleh mahasiswa Trisakti lain. ”Saya ingin setiap tanggal 12 Mei diadikan
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 208
sebagai Hari Antikekerasan,” ujar Thoby.
Presiden BEM Trisakti, Ahmad Gauzul Alam mengatakan upacara
yang dilakukan kemarin sebagai bentuk seremonial belaka. Adapun inti
peringatan sudah dilakukan sejak Rabu (09/5) lalu. ”Ini hanya seremonial
saja, kita sejak Rabu kemarin telah melakukan peringatan, ” ujarnya.
Seluruh masyarakat Trisakti yang hadir dalam upacara berpakaian
hitam-putih. Sementara para mahasiswa dilengkapi juga dengan jaket
almamater biru tua. Setelah selesai upacara, tepat pukul 09.00 WIB,
dilakukan acara tabur bunga di depan Monumen Tragedi 12 Mei dan
napak tilas tragedi 12 Mei 1998 dengan dilanjutkan acara sarasehan
nasional.
(Dari: Seputar Indonesia, Minggu 13 Mei 2007)
Contoh laporan deskripsi pengamatan terhadap lokasi wisata
Mandi dan Berobat di Alam Perawan Cisolok
Cipanas berciri khas air panas yang memancar setinggi kira-kira 3
meter. Air panas ini berada di jalur Sungai Cikampak. Selain pancarannya
yang tinggi itu, di beberapa tempat juga ada air panas memancar tetapi
lebih rendah. Untuk mencapai tempat itu, kita harus berjalan kaki
menyeberangi sungai dengan panjatan batu-batu besar. Sungai itu tidak
dalam, tetapi arusnya deras karena berbatu. Ada pula jembatan bambu
dibangun yang biasa digunakan untuk menyeberang orang per orang.
Dulu, pernah dibangun jembatan, tetapi hanyut dilanda banjir. Di tempat
itu, ada bangunan permanen yang dapat digunakan menginap tanpa biaya
jika misalnya kebetulan banjir.
Di Sungai Cikampak yang deras arusnya, tetapi tak membahayakan
dan panas airnya, kita bisa mandi secara bebas. Ada bagian-bagian tertentu
yang sudah bebas dari batu yang dapat dipergunakan untuk mandi bagai
di kolam renang. Yang agak terlindung pun ada, yakni di bawah pohon
besar yang cukup rimbun.
Tempat rekreasi di Cipanas memang ramah terhadap alam. Mandi
dengan bebas tanpa rasa sungkan. Lihatlah anak-anak bermain dengan air
sangat ceria. Gadis-gadis dengan kain melilit di tubuhnya bercanda dengan
sesama atau rombongan keluarga turun bersama-sama ke air panas. Asal
jangan di tempat yang terlalu dekat dengan sumber air panas karena bila
kita lakukan, kulit bisa mengelupas.
209 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Di sini, orang bisa memasak air di atas air. Kita tinggal menaruh panci
di atas batu yang di bawahnya memancar air panas atau kalau mau kita
juga bisa merebus telur di atas air panas itu dalam waktu singkat. Demikian
keterangan salah penunggu warung di sana.
Menurut penduduk setempat, air panas Cipanas, Cisolok itu mengan-
dung belerang atau setidaknya dianggap berkhasiat bisa menyembuhkan
penyakit. Banyak orang sakit ke sini untuk mandi dan mereka sembuh.
Ada yang datang pertama digendong, dua bulan kemudian sudah bisa
datang sendiri. Penyakit mereka biasanya rematik, gatal-gatal, dan
sejenisnya.
Melihat kadar panasnya air, memang memungkinkan kawasan itu
selain untuk rekreasi juga untuk berobat. Banyak orang Jakarta atau
Bandung datang kemari hanya untuk berobat. Bahkan, yang datang
kemari juga dukun atau tabib yang mengobati pasiennya. Dukun yang
ke sini dengan membawa rombongan pasien.
Di sudut lokasi dekat tempat parkir, dibangun sebuah rumah
sederhana terbuat dari papan. Di dalamnya ada bak-bak air panas. Di
sana juga untuk mandi orang yang berobat. Juga bisa digunakan untuk
ruang ganti pakaian.
Hari Minggu di Cipanas adalah hari ceria sambil berobat, mandi air
hangat di alam yang bebas terbuka. ”Sayang belum pernah diselidiki
apakah air itu bisa lebih berfungsi sebagai sarana pengobatan,” kata
Bustal Nawawi, produser flm Nagabonar yang selam tiga bulan syuting
di sana. Bustal sendiri sering tinggal di rumah yang dibangun khusus
untuk flm di kawasan itu. Kawasan wisata ini menarik karena alamnya
murni dan benar-benar masih pedesaan.
Memang itulah yang terkesan, pedesaan. Masih ada monyet-monyet
bergelantungan di pohon di atas bukit. Kadang ada juga babi yang nyasar
lalu diburu oleh penduduk.
Cisolok memang layak mengundang kita. Di sana ada kesegaran,
keceriaan, dan udara nyaman alam tropis yang masih perawan. Bila
kembali ke Jakarta, ketika siang sudah berlalu atau sore sudah tiba, di
tengah perjalanan kita bisa beli oleh-oleh: pisang atau durian, bila musim
kebetulan datang. (Aklis/Ami).
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 210
Contoh laporan ekspositoris tahapan (proses)
Tembakau sebagai bahan baku rokok termasuk tanaman perkebunan.
Tanaman tembakau ditanam pada tanah ladang/sawah kering. Pihak PT.
Perkebunan menyewa sawah petani setelah masa panen padi. Penyewaan
sawah dilakukan selama satu kali tanam tembakau.
Pengolahan dari sawah menjadi ladang mengalami beberapa tahap.
Setelah sawah bersih dari jerami, dibuatlah got, saluran air yang berfungsi
untuk menyiram tanaman. Tahap selanjutnya tanah harus digemburkan
dengan traktor atau cangkul sementara membuat bibit tembakau mulai
dilakukan. Tanah yang sudah ditraktor harus digemburkan lagi dengan
cangkul.
Contoh laporan ekspositoris berupa percobaan (eksperimen)
Bahan bakar minyak (BBM) termasuk jenis energi yang tidak bisa
diperbaharui. Oleh sebab itu, Pemerintah dalam berbagai kesempatan
selalu mengampanyekan program hemat energi. Salah satu program
kampanye hemat energi itu ialah mencari sumber energi alternatif yang
sebanyak-banyaknya. Untuk itu perlu digalakkan berbagai percobaan
untuk menemukan energi alternatif itu. Maka, kemudian diteliti dan
diadakan percobaan pemakaian bahan bakar briket.
Briket terbuat dari batu bara. Apakah briket dapat menjadi energi
alternatif sebagai pengganti bahan bakar khususnya untuk memasak?
Kemudian, diujicobalah bahan bakar briket tersebut. Percobaannya
adalah sebagai berikut
Pertama-tama, kita siapkan tungku yang terbuat dari tanah liat.
Tungku itu dapat kita buat dalam bentuk seperti sarang tawon, kotak,
atau multi tungku yang dapat dipakai untuk memasak beberapa panci
sekaligus.
Akan lebih baik apabila tungku tersebut dilengkapi dengan
alat pengukur panas sehingga kita dapat memantau suhu setiap saat.
Selanjutnya, briket batu bara yang sudah kita siapkan dimasukkan ke
dalam tungku tersebut. Sebaiknya gumpalan-gumpalan briket itu jangan
terlalu besar supaya mudah menyala. Siapkan bahan-bahan yang akan
kita masak, kemudian tungku tersebut dinyalakan dan kita tinggal
menunggu sampai masak.
211 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Berdasarkan hasil beberapa kali percobaan memasak dengan briket
batu bara ini, diperoleh kesimpulan bahwa satu kilogram briket dapat
dipakai untuk memasak 4,5 liter air. Ini berarti kita bisa menghemat
lebih dari 75% apabila dibandingkan dengan menggunakan bahan bakar
minyak.
Sebelum menyajikan laporan secara lisan, laporan dapat disusun terlebih
dahulu secara tertulis. Laporan yang sudah disusun dapat disampaikan
secara lisan atau dipresentasikan. Untuk menyampaikan laporan secara
lisan, hal-hal yang perlu diperhatikan, yaitu seperti berikut.
1. Memberi tahu jenis laporan yang akan disampaikan.
2. Menyampaikan pengantar sekilas tentang latar belakang pem-
buatan laporan
3. Menyampaikan proses memperoleh bahan laporan
4. Memberikan gambaran secara umum tentang sistematika laporan
5. Menyampaikan isi laporan dengan bahasa yang baik, formal, dan
efektif
6. Memberikan penekanan pada uraian mengenai fakta jika berbentuk
laporan naratif dan deskriptif
7. Memberikan penekanan pada alur proses atau tahapan jika laporan
berbentuk ekspositoris
C. Menyampaikan Rangkuman dan Simpulan Laporan
Di dalam setiap laporan, ada penjelasan tentang hasil yang dicapai.
Seberapa besar hasil itu harus disampaikan? Penjelasan tentang hasil masih
merupakan bagian isi laporan. Dari pembahasan atau uraian yang ada pada
isi laporan, dibuatlah suatu rangkuman dan simpulan mengenai hal yang
dilaporkan.
Penyajian dalam bentuk rangkuman berupa uraian hal-hal pokok saja
atau bentuk garis besarnya saja namun tetap tersusun secara sistematis.
Selain menyajikan rangkuman sebuah laporan dapat pula membuat
simpulannya.
Berbeda dengan rangkuman, simpulan merupakan uraian singkat yang
diwarnai oleh pandangan dan penilaian dari si pembuat laporan. Simpulan
dapat dibuat berdasarkan suatu analisis dari materi laporan, perpaduan
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 212
(sintesis) dari beberapa aspek yang dilaporkan, dan dapat juga berbentuk
kategori (pengelompokan) unsur-unsur yang dilaporkan yang memiliki ciri
yang sama. Namun, itu semua tetap mengacu pada tujuan dan apa yang
harus dicapai oleh pembuat laporan serta tuntutan dari yang menerima
laporan.
Laporan dapat pula disampaikan hanya berbentuk rangkuman atau
simpulannya. Semua itu bergantung pada permintaan dan kebutuhan.
Tentunya sebelum menyampaian laporan, terlebih dahulu laporan disusun
dalam bentuk rangkuman atau simpulan.
Contoh simpulan sebuah laporan
Berdasarkan hasil penelitian ini, dapat disimpulkan bahwa ada
beberapa faktor yang menyebabkan para petani melakukan mobilisasi
sosial menjadi perajin. Jika tidak ada suatu program penyadaran baik
dari pemerintah maupun masyarakat setempat, dapat dipastikan hasil
produkdi pertanian akan makin berkurang sehingga negara pun akan
mengimpor beras.
Akhirnya, diharapkan penelitian ini mampu memberikan penyadaran
pada masyarakat dan dapat menjadi masukan untuk pihak-pihak yang
berwenang memberikan kebiakan. Pihak-pihak tersebut misalnya para
dewan legislatif dan eksekutif supaya memberikan arahan dan rencana
pembangunan yang lebih berpihak pada sektor pertanian, terutama
masyarakat miskin pedesaan.
RANGKUMAN
A. Pengertian Laporan
Laporan adalah suatu cara komunikasi yang berisi informasi sebagai
hasil dari sebuah tanggung jawab yang dibebankan kepada pembuatnya.
Untuk membuat sebuah laporan yang baik, si pembuat laporan harus
memahami beberapa hal berikut.
(1) guna laporan
(2) kriteria penyampaian laporan
(3) jenis/bentuk-bentuk laporan
213 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
B. Pola Penyajian Laporan Secara Lisan
Baik laporan formal maupun informal disusun dengan menggunakan
bahasa yang baku. Laporan yang telah disusun bisa juga disampaikan
secara lisan. Oleh sebab itu, bentuk uraian laporan dapat disajikan dengan
pola penyajian narasi, deskripsi, dan ekspositoris.
C. Menyampaikan Rangkuman dan Simpulan Laporan
Penjelasan tentang hasil masih merupakan bagian isi laporan. Dari
pembahasan atau uraian yang ada pada isi laporan, dibuatlah suatu
rangkuman dan simpulan mengenai hal yang dilaporkan.

TUGAS KELOMPOK
Bentuklah kelompok terdiri atas 4 orang, lalu lakukan perjalanan ke
tempat tertentu yang dianggap berkesan, dapat berbentuk objek wisata,
tempat pembuatan kerajinan tangan, industri kecil, museum, dan lain-
lain. Kemudian, susunlah laporannya dalam bentuk narasi, deskripsi,
atau eksposisi. Buat pula rangkuman atau simpulannya. Presentasikanlah
di depan kelas! Kelompok lain diminta mengomentari atau memberi
tanggapan.
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Keterangan atau informasi yang dikumpulkan, diolah, dan disajikan
secara tertulis disebut
a. notula d. simpulan
b. laporan e. artikel
c. rangkuman
2. Berikut ini hal–hal yang berkaitan dengan laporan, kecuali
a. dibuat dalam jangka waktu tertentu
b. menggunakan peralatan tertentu
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 214
c. mencatat sumbe –sumber informasi
d. membanding–bandingkan sumber informasi
e. dibuat dalam jangka waktu yang lama
3. Suatu laporan yang baik harus memenuhi mutu berikut ini, kecuali
a. cermat
b. tepat waktu
c. populer
d. jelas
e. sederhana
4. Berikut ini yang bukan merupakan kegunaan membuat laporan
adalah
a. melatih kita untuk berbuat cermat
b. menciptakan dokumen yang dapat diadikan bahan studi
c. melatih kita untuk selalu bertujuan
d. memudahkan kita dalam berpikir
e. menciptakan bahan diskusi kemasyarakatan
5. Tulisan yang bertujuan menceritakan peristiwa atau pengalaman
manusia berdasarkan perkembangannya dari waktu ke waktu agar
pembaca terkesan disebut karangan
a. deskripsi
d. argumentasi
b. eksposisi
e. persuasi
c. narasi
6. Tulisan yang bertujuan menggambarkan sejelas–jelasnya suatu objek
sehingga pembaca seolaholah mengalami sendiri suatu yang di
gambarkan itu disebut karangan
a. deskripsi
b. eksposisi
c. narasi
d. argumentasi
e. persuasi
215 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
7. Menyajikan bagian-bagian yang dianggap penting dan penyajian tidak
perlu mempertahankan urutan karangan yang asli, melainkan langsung
menyajikan inti masalah serta berbagai pemecahannya.
Uraian di atas menjelaskan ciri-ciri
a. notula
b. laporan
c. karangan
d. simpulan
e. artikel
8. Laporan dapat dibuat atau disampaikan secara
a. lisan
b. tulisan
c. ringkasan
d. a dan b benar
e. a, b, c benar
9. Laporan dapat diadikan bahan acuan membuat hal di bawah ini,
kecuali
a. kebiakan
b. tulisan
c. ringkasan
d. pemikiran
e. penilaian
10. Dari segi materi laporan bersifat berikut ini, kecuali
a. lengkap
b. akurat
c. persuasif
d. faktual
e. penilaian
11. Salah satu bentuk laporan lisan ialah
a. laporan kunjungan
b. laporan berita
c. laporan tugas
d. laporan perjalanan
e. laporan observasi
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 216
12. Laporan deskriptif terdapat pada laporan
a. perjalanan
b. pengamatan
c. audit
d. kegiatan
e. proses
13. Perbedaan laporan bentuk tulisan dan lisan adalah berikut ini, kecuali
a. tulisan lengkap dan lisan pokoknya saja
b. tulisan terstruktur dan lisan sederhana
c. tulisan dapat berbentuk surat dan lisan reportase
d. tulisan menyajikan fakta nonverbal lisan verbal
e. tulisan memuat perincian dan lisan dapat berupa rangkuman
14. Ciri-ciri kalimat deduktif ialah
a. umum-khusus
b. khusus-umum
c. naratif
d. umum khusus dan khusus-umum
e. naratif dan khusus-umum
15. Hal-hal yang dinilai dalam penyampaikan secara lisan ialah di bawah
ini, kecuali
a. lafal
b. intonasi
c. vokal
d. dokumentasi
e. elespresi
16. Di bawah ini yang tergolong laporan berupa fakta ialah
a. Di Aceh telah terjadi bencana alam Tsunami.
b. Kapan Bapak ke luar negeri?
c. Tahun 2009, akan dilaksanakan pemilihan umum.
d. Kita diharapkan berperan aktif memberantas penyebaran virus fu
burung.
e. Dalam mengahadapi ujian nasional, siswa diajak mengikuti acara
istighosah.
217 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
17. Urutan bagian-bagian karya tulis berupa laporan yang menggunakan
sistematika yang benar adalah
a. Judul–bab pendahuluan–kata pengantar–dafar isi bab
penutup–kesimpulan
b. Judul–kata pengantar–dafar isi–bab pendahuluan–bab
penutup–kesimpulan
c. Judul–kata pengantar–dafar isi–bab pendahuluan–bab
pembahasan–bab–penutup
d. Judul–dafar isi–kata pengantar–bab pendahuluan– bab
pembahasan–kesimpulan
e. Judul–dafar isi–bab pendahuluan–bab pembahasan–bab
penutup–kesimpulan
18. Di bawah ini hal yang disampaikan pada laporan tentang banjir,
kecuali
a. lokasi
b. pelaku
c. korban
d. gambaran suasana
e. proses evakuasi korban
19. Teknik pengumpulan data dimulai dengan cara
a. menyebarkan angket, wawancara, majalah, dan surat kabar
b. sistematika, pengunaan bahasa yang aktif,
c. kata-katanya bermakna denotasi, dan ragam bahasa resmi
d. menarik, sistematika, dan bahasa baku
e. cermat, menarik, sistematika, dan ragam resmi
20. Makna denotasi adalah makna
a. makna sebenarnya
b. makna bukan sebenarnya
c. makna rancu
d. makna konotasi
e. makna mengandung dua arti
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 218
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Apakah yang dimaksud dengan laporan?
2. Bagaimanakah syarat menyampaikan laporan secara lisan?
3. Jelaskan pengertian laporan deskriptif!
4. Sebutkan hal-hal yang harus diperhatikan ketika menyusun laporan!
5. Jelaskan apa yang dimaksud dengan kesimpulan!
6. Buatlah contoh kalimat induktif!
7. Apa perbedaan induktif dan deduktif?
8. Buatlah contoh kalimat deduktif!
9. Sebutkan cara menyusun laporan yang baik!
10. Kapan laporan dibuat?

219 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Standar
Kompetensi
- Berkomunikasi dengan bahasa indonesia setara tingkat
madya
Kompetensi
Dasar
- Menulis wacana bercorak naratif, deskriptif,
ekspositoris, dan argumentatif
Bab ini membahas materi tentang wacana bercorak narasi, deskripsi, eksposisi,
dan argumentasi termasuk pengertian, ciri-ciri, unsur-unsur, tahapan
penulisan, serta contoh tulisan. Setelah pembelajaran, diharapkan kita dapat
membuat tulisan bercorak narasi, deskripsi, eksposisi, dan argumentasi
dengan tepat.
Indikator
- Menulis suatu kejadian dalam bentuk narasi serta
memuat unsur-unsur yang melingkupinya secara
kronologis
- Membuat deskripsi dari gambar/bagan/tabel/grafk/
diagram/matriks yang dilihat atau didengar sepanjang
150-200 kata dalam waktu 30 menit
- Membuat eksposisi dari suatu peristiwa
- Menyusun argumentasi dengan tujuan untuk
meyakinkan pembaca tentang suatu peristiwa kerja
agar menerima suatu sikap dan opini secara logis

BAB 12
MEMBUAT WACANA BERCORAK NARATIF,
DESKRIPTIF, EKSPOSITORIS DAN ARGUMENTATIF
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 220
Wacana
Menghisap Khasiat Buah Naga
Warga keturunan Tionghoa beranggapan bahwa buah naga membawa
berkah. Tidak mengherankan jika buah ini diletakkan di antara dua ekor
patung naga hiau yang diletakkan di atas meja altar.
Buah naga yang sudah matang warnanya merah menyala. Di Vietnam,
thang loy (buah naga) atau dragon fruit memiliki khasiat untuk kesehatan.
Dalam berbagai pameran buah-buahan pada tahun 1999, buah naga
dipromosikan sebagai penyeimbang kadar gula darah, pencegah kolesterol
tinggi, dan pencegah kanker usus.
Tanaman nopalitos ini dapat menurunkan kadar gula darah pada
penderita diabetes yang tidak bergantung pada insulin. Selain itu, nopalitos
juga menurunkan kadar lemak dan kolesterol darah.
Nopalitos adalah pucuk tunas cabang kaktus prickly pear, opuntia
fcus-indica yang masih pipih seperti daun. Setelah dibuang duri dan tunas
daunnya yang, sayur nopalitos bisa dimasak termasuk sebagai salad dan
sop daging.
Walaupun nilai gizinya sama dengan jenis-jenis sayuran lain, seperti
daun selada (90% air, 3-7% karbohidrat, dan 1,3% mineral, terutama
kalsium), ia merupakan sumber vitamin beta karoten (18-30 mg tiap 100
g bobot sayuran) dan vitamin C (10-18 mg tiap 100 g bobot sayur). Inilah
yang menjaga kesehatan orang Indian Amerika Selatan dan Meksiko.
Pada tahun 1979, dunia kedokteran tahu, bahwa nopalitos berkhasiat
menurunkan kadar gula, sejak Ibanez-Camacho dari Meksiko melakukan
penelitian.
Di Indonesia, buah naga berasal dari Meksiko, terkenal mujarab
menurunkan kadar gula darah dan kolesterol. Dan kini mulai dikembangkan
di tanah air, serta memiliki peluang besar untuk disebarluaskan.
Buah naga atau biasa disebut dragon fruit, di Indonesia, khususnya
diperkampungan di Pulau Jawa, mulai dibudidayakan. Namun masih
sebatas hiasan, disandingkan dengan kaktus. Selain masih sedikit yang
menanamnya, juga disebabkan tanaman ini masih tergolong jenis baru.
Konon disebut buah naga karena seluruh batangnya yang menjulur
panjang seperti ular naga. Dalam perkembangannya, tanaman ini kemudian
dikembangkan di Israel, Thailand, dan Australia.
221 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Jenis buah naga ada empat macam, pertama buah naga daging putih
(Hylocereus undatus), buah naga daging merah (Hylocereus polyrhizus), buah
naga daging supermerah (Hylocereus costaricensis), dan buah naga kulit
kuning daging putih (Selenicerius megalanthus).
Khasiat Buah Naga:
1. Mujarab menurunkan kolesterol, menurunkan kadar lemak.
2. Untuk penyeimbang kadar gula darah, pencegah kanker, pelindung
kesehatan mulut.
3. Pencegah pendarahan, dan obat keluhan keputihan.
4. Mencegah kanker usus, menguatkan fungsi ginjal dan tulang,
menguatkan daya kerja otak, meningkatkan ketajaman mata, serta
sebagai bahan kosmetik.
5. Mengobati sembelit, mengobati hypertensi, memperhalus kulit wajah.
6. Meningkatkan daya tahan.
Cara Menanam Buah Naga di Pot
Bagaimana cara menciptakan tabulampot buah naga? Langkah pertama,
sediakan pot. Pilih pot dari tanah liat berdiameter sekitar 40-50 cm. Setelah
itu, sediakan tiang panjatan. Pilih yang kuat dari besi beton berdiameter
8-10 cm. Buatlah tiang setinggi 200 cm. Seluruh tiang panjatan diberi sabut
kelapa yang diikatkan.
Bagian bawah tiang dibuatkan kaki-kaki tiang. Panjang kaki tiang 35 cm,
dibentuk trapesium dengan ukuran 30 cm. Setelah itu, pulas dengan aspal
agar tak gampang keropos. Bagian atas tiang dibuatkan piringan diameter
40 cm, sementara bagian tengahnya diberi besi dipasang bersilang. Pada
pertemuan silangan, beri besi tegak lurus sepanjang 30 cm, yang nantinya
dimasukkan pada bagian ujung tiang.
Seperti biasa, sediakan pula media tanam berupa campuran tanah,
pasir, bubuk bata merah, pupuk kandang, dan kompos (1 : 2 : 2 : 3 : 1).
Campur merata, masukkan ke dalam pot hingga 80% volumenya. Tambah
dolomit 100 gram/pot dan pupuk hortigo 20 gram/pot. Siram sampai basah,
biarkan semalam.
Sebaiknya, beli bibit dari penangkar tanaman buah naga. Pilih bibit stek
batang sepanjang 60 cm dengan diameter 7 cm. Setelah itu, buat 3 lubang
tanam dalam pot dengan kedalaman 10 cm dan diameter 6 cm. Setelah
ditanam, tekan media di sekitar bibit agar padat. Berilah air, dan ikat bibit
tersebut agar tidak mudah roboh. Basahi permukaan media dengan sedikit
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 222
air. Usahakan jangan sampai air menggenangi pangkal batang. Sebab,
pangkal batang peka terhadap genangan air, dan bisa mematikan.
Langkah terakhir, letakkan buah naga di pot di lokasi yang mendapat
sinar matahari, terutama pada pagi hari. Tak lama, Anda pun akan menikmati
indahnya tabulampot buah naga. Mungkin itu yang membuatnya jadi
makin dicari orang.
(Sumber : Tunas, Edisi 05, 17-30 November 2007)
A. Pengertian Wacana
Wacana berasal dari bahasa Inggris discourse, yang artinya antara
lain ”Kemampuan untuk maju menurut urutan-urutan yang teratur dan
semestinya.” Pengertian lain, yaitu ”Komunikasi buah pikiran, baik lisan
maupun tulisan, yang resmi dan teratur.” Jadi, wacana dapat diartikan
adalah sebuah tulisan yang teratur menurut urut-urutan yang semestinya
atau logis. Dalam wacan,a setiap unsurnya harus memiliki kesatuan dan
kepaduan.
Setiap wacana memiliki tema sebab tema merupakan hal yang
diceritakan atau diuraikan sepanjang isi wacana. Tema menjadi acuan atau
ruang lingkup agar isi wacana teratur, terarah dan tidak menyimpang ke
mana-mana. Sebelum menulis wacana, seseorang harus terlebih dahulu
menentukan tema, setelah itu baru tujuan. Tujuan ini berkaitan dengan
bentuk atau model isi wacana. Tema wacana akan diungkapkan dalam corak
atau jenis tulisan seperti apa itu bergantung pada tujuan dan keinginan
si penulis. Setelah menetapkan tujuan, penulis akan membuat kerangka
karangan yang terdiri atas topik-topik yang merupakan penjabaran dari
tema. Topik-topik itu disusun secara sistematis. Hal itu dibuat sebagai
pedoman agar karangan dapat terarah dengan memperlihatkan pembagian
unsur-unsur karangan yang berkaitan dengan tema. Dengan itu, penulis
dapat mengadakan berbagai perubahan susunan menuju ke pola yang
sempurna. Membuat kerangka karangan sangat dianjurkan sebelum
penulisan, terutama bagi pengarang pemula.
Kerangka karangan bermanfaat sebagai berikut.
1. Pedoman agar penulisan dapat teratur dan terarah.
2. Penggambaran pola susunan dan kaitan antara ide-ide pokok/topik.
3. Membantu pengarang melihat adanya pokok bahasan yang
menyimpang dari topik dan adanya ide pokok yang sama.
223 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
4. Menjadi gambaran secara umum struktur ide karangan sehingga
membantu pengumpulan bahan-bahan pustaka yang diperlukan.
Agar penyusunan kerangka karangan dapat efektif menjadi acuan
pembuatan karangan, langkah yang mesti ditempuh oleh pengarang untuk
menyusun kerangka karangan adalah seperti berikut.
(1) Menentukan tema/topik karangan
(2) Menjabarkan tema ke dalam topik-topik/subtema
(3) Mengembangkan topik-topik menjadi subtopik
(4) Menginvestaris sub-sub topik
(5) Menyeleksi topik dan sub-subtopik yang cocok
(6) Menentukan pola pengembangan karangan
Kerangka karangan dapat ditulis dalam dua bentuk, berikut.
1. Kerangka kalimat, ialah kerangka karangan yang disusun dalam bentuk
kalimat-kalimat lengkap yang menjabarkan ide-ide pokok karangan.
2. Kerangka topik, ialah kerangka karangan yang dituangkan dalam
bentuk frasa dan klausa sehingga tampak lebih praktis.
Penyusunan kerangka karangan dapat berbentuk kalimat dan frasa
atau klausa sekaligus, meskipun yang lebih banyak digunakan adalah
kerangka topik. Berikut contoh kedua bentuk penyusunan kerangka
karangan tersebut.
Contoh kerangka kalimat:
Membuka usaha warnet di tengah perkembangan teknologi informasi.
1. Masuknya ajaran komputer di sekolah-sekolah menambah pengetahuan
tentang teknologi informasi.
2. Perkembangan sarana komputer menjadi sarana jaringan informasi
melalui internet.
3. Penggunaan internet menjadi kebutuhan remaja dan anak sekolah.
4. Memanfaatkan minat remaja dan anak sekolah dengan membuka
warnet.
Contoh kerangka topik
Antisipasi lonjakan arus mudik lebaran :
1. Jumlah Pemudik Lebaran
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 224
a. perkiraan lonjakan jumlah pemudik
b. sarana angkutan yang dipersiapkan
c. sarana angkutan yang diandalkan
2. Pengaturan jalur Jakarta-Surabaya
a. jalur utara
b. jalur selatan
c. kemacetan lalu lintas dan usaha pencegahannya
3. Petunjuk pemanfaatan jalur
a. dari DLLAJR
b. dari instansi terkait
B. Jenis-Jenis Wacana
Berdasarkan bentuk atau jenisnya, wacana dibedakan menjadi
wacana narasi, deskripsi, eksposisi, argumentatif, dan persuasi.
1. Narasi
Narasi adalah cerita yang didasarkan pada urut-urutan suatu kejadian
atau peristiwa. Narasi dapat berisi fakta, misalnya biograf (riwayat
seseorang), otobiograf/riwayat hidup seseorang yang ditulisnya sendiri,
atau kisah pengalaman. Narasi seperti ini disebut dengan narasi ekspositoris.
Narasi bisa juga berisi cerita khayal/fksi atau rekaan seperti yang biasanya
terdapat pada cerita novel atau cerpen. Narasi ini disebut dengan narasi
imajinatif.
Unsur-unsur penting dalam sebuah narasi adalah:
(1) kejadian,
(2) tokoh,
(3) konfik,
(4) alur/plot.
(5) latar yang terdiri atas latar waktu, tempat, dan suasana.
Narasi diuraikan dalam bentuk penceritaan yang ditandai oleh adanya
uraian secara kronologis (urutan waktu). Penggunaan kata hubung yang
menyatakan waktu atau urutan, seperti lalu, selanjutnya, keesokan harinya,
atau setahun kemudian kerap dipergunakan.
225 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Tahapan menulis narasi, yaitu sebagai berikut.
(1) menentukan tema cerita
(2) menentukan tujuan
(3) mendafarkan topik atau gagasan pokok
(4) menyusun gagasan pokok menjadi kerangka karangan secara
kronologis atau urutan waktu.
(5) mengembangkan kerangka menjadi karangan.
Kerangka karangan yang bersifat naratif dapat dikembangkan dengan
pola urutan waktu. Penyajian berdasarkan urutan waktu adalah urutan
yang didasarkan pada tahapan-tahapan peristiwa atau kejadian. Pola urutan
waktu ini sering digunakan pada cerpen, novel, roman, kisah perjalanan,
cerita sejarah, dan sebagainya.
Contoh:
Kunjungan ke Museum Fatahillah
1. persiapan keberangkatan
2. perjalanan menuju stasiun Kota
3. tiba di tempat tujuan
4. mengamati peninggalan zaman penjajahan Belanda
5. berkumpul kembali di depan ”Meriam Jagur”
6. persiapan pulang
Contoh narasi ekspositoris:
Minta Tolong Malah Dikira Hantu Pocong
Kejadian yang menggelikan sekaligus menegangkan ini terjadi pada
pertengahan bulan Juli 1993, ketika saya baru masuk bekerja di sebuah
klinik yang terletak di daerah Lemabang, dekat dengan PT Pupuk Sriwiaya
(Pusri). Rumah saya berada di daerah Bukit Besar sehingga membutuhkan
waktu lebih kurang 45 menit untuk pergi dari rumah ataupun pulang dari
dinas.
Saat itu, rumah saya belum dilewati oleh bus kota jurusan Bukit
Besar, karena rute bus kota pada waktu itu hanya sampai di dekat wilayah
Kembang Manis. Jadi, terpaksa saya turun di simpang empat lampu merah
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 226
Jl. Kapten Arivai, cukup jauh dari rumah untuk berjalan pulang.
Malam itu, jalanan sangat sepi dan gelap karena wilayah yang saya
lewati adalah TPU (Tempat Pemakaman Umum) dan wilayahnya juga
masih banyak hutan serta lampu jalan belum dipasang. Akibatnya, saya
sangat takut berjalan pulang ke rumah sendirian. Apalagi kawasan yang
saya lewati merupakan daerah rawan dan angker. Orang-orang yang lewat
sering diganggu kuntilanak, pocong, serta suara wanita menangis.
Tetapi, kekhawatiran saya agaknya terobati karena dari kejauhan saya
melihat tiga orang lelaki yang tampaknya juga baru pulang dari kerja
dan jalannya searah denganku. Tanpa pikir panjang langsung saja saya
berlari mendekati dan memanggil mereka, ”Mas ..., Mas ... tunggu, Mas!”
Tapi bukannya mendekat, mereka malah berlari dan berteriak ketakutan,
”Tolooong ... ada pocong ..., ada pocong ...!” Karena saya orang yang
agak telmi (telat mikir), setelah mendengar itu saya sendiri malah tambah
ketakutan. Sebab, saya juga sangat takut dengan yang namanya setan atau
semacamnya.
Tetapi, makin saya mendekat, tiga lelaki itu tambah kencang sehingga
tidak terkejar lagi oleh saya. Bahkan satu orang dari mereka nekat memanjat
pagar rumah orang lain untuk menyelamatkan diri.
Setelah melihat baju dinas berwarna putih yang saya kenakan, saya
baru sadar ternyata yang mereka kira pocong adalah saya. Dalam hati
saya berkata, ”Sialan, kirain ada pocong beneran. Ternyata yang disangka
pocong itu aku. Jangankan mendapat kawan, mendekat saja orang takut
kepada saya.”
Setelah saya sampai di rumah dan menceritakan semuanya kepada
anggota keluarga, spontan mereka tertawa terbahak-bahak. Bahkan seorang
keponakan saya memanggil saya dengan sebutan ’Tante Pocong’.
Sejak kejadian itu, tiap kebagian jadwal dinas siang lagi, saat pulang
malam saya tidak pernah memakai baju putih lagi.
(Dikutip dari Republika, Ahad, 25 Maret 2007)
227 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Contoh narasi imajinatif :
NAMAKU EDELWEISS
Namaku Edelwiss alias Anaphalis javanica. Biasanya aku tumbuh
di dataran tinggi atau puncak-puncak gunung. Oleh kalangan Botani,
aku sering disebut tanaman sejenis perdu, dan termasuk anggota famili
Compositae atau disebut juga Asteraceae (sambung-sambungan).
Bungaku kecil sebesar bunga rumput. Orang lebih mengenalku dengan
warna putih daripada warna lainnya. Hidupku bergerombolan di ujung
dahan dengan harum yang khas.
Tinggi batangku dapat mencapai lima meter dengan daun-daun runcing
dan lurus. Bungaku istimewa, tak pernah layu, mekarku abadi sehingga
diuluki ”bunga abadi”. Sungguh julukan inilah yang menjadi ’beban’
bagiku karena banyak orang menyalahgunakan ’arti’ keabadianku selama
ini! Keabadianku mereka samakan dengan ’cinta abadi’, cinta sepasang
manusia yang tidak memiliki ikatan resmi. Ah ... apalah arti protesku? Toh,
siapa yang perduli dengan rintihanku.
*****
Aku berada di kamar Rieska. Tersusun rapi di atas lemari belajarnya.
Di sampingku ada diktat kuliah, novel, majalah remaja dan ... bunga-bunga
koleksi Rieska!
Tempatnya sengaja disimpan Rieska. Yap! Untuk mengenang siapa
yang memberikannya! Aku memang lebih beruntung dari bunga mawar
yang menjadi pendatang baru di kamar ini. Wajahnya pucat karena air di
dalam vasnya tak pernah diganti Rieska. Sama halnya dengan nasib suplir
yang telah mengering menjadi pembatas buku, lengkap dengan spora yang
masih menempel di tubuhnya, dan anggrek yang merana karena sebagian
kelopak bunganya telah mengering.
Ya ... di antara bunga-bunga milik Rieska, ternyata aku memang
diperlakukan ’istimewa’ oleh majikanku, Rieska! Aku ditaruh di dalam
kotak berwarna biru muda, berlapiskan plastik transparan. Aku sangat
senang dengan perlakuan baik Rieska. Tapi, aku sangat resah dengan label
hitam yang bertulisakan ”Cinta Abadi” yang melekat manis di atas plastik
kotak ini.
*****
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 228
”Kamu beruntung, ya, Weis tempatmu terempuk!” komentar mawar
suatu hari saat Rieska berngkat kuliah
”Iya ... Weis, kamu tidak perlu ganti-ganti air seperti aku!” ujar
anggrek.
”Ah, kalian bisa saja,” ujarku pelan.
”Tapi, benar kan memang kamu anak emas! Apa karena kamu
pemberian Ari pacar Rieska anak gunung itu?! Kali ini suara supir dari
balik buku angkat bicara.
Ya, benar aku memang anak emas Reiska. Ia mangambilku ketika dia
mendaki gunung gunung Ceremai, Jawa barat. Aku diberikan kepada
Reiska tepat pada ulang tahun ke-22, enam bulan lalu.”
”Ah ... itu kan pikiran kalian saja kalau aku bahagia ada di sini,
sebenarnya aku nggak terlalu bahagia kok tinggal di sini!” ujarku.
”Kok bisa? Mengapa?” tanya mawar keheranan.
”Aku ingin sekali Reiska menyadari keberadaan kita. Reiska seharusnya
berpikir ada apa di balik kekuasaan Allah yang telah menciptakan kita.
Mereka seharusnya menjaga kita dengan baik. Bukankah Allah menciptakan
mereka untuk menjadi Khalifah di muka bumi ini? Manusia seharusnya
menyayangi dan merawat kita. Mereka seharusnya berpikir andai tidak ada
mawar, anggrek, suplir, atau bunga lainnya, bagaimana? Dunia pasti suram
tanpa penyejuk mata. Beda kalau ada kita, mereka akan merasa senang dan
tenteram bila memandang si mawar yang sedang mekar, suplir yang segar
atau anggrek yang ..... dan seharusnya manusia yang melihat ’keabadianku’
sebagai contoh bagaimana mengabadikan hatinya sebagai rasa syukur ke
hadirat Illahi,” suaraku pelan, mataku mulai berkaca-kaca menahan air
mata yang hampir tertumpah.
”Kamu benar, Weis. seharusnya manusia belajar dari fenomena alam
seperti kita. Lihat bungaku, berwarna merah menawan, wangi yang
merebak. Allah sengaja menciptakan duri-duri kecil di batangku untuk
menjaga kehormatanku dari serangan makhluk yang jahil agar tidak
mudah dipetik begitu saja. Dan kamu juga hidup di tepi jurang sehingga
diperlukan perjuangan bagi yang ingin memetikmu. Seharusnya manusia
menyadari hal itu, mencontohkan kita! Indah tapi tak mudah diraih.
”Ah sudahlah ..... sekarang memang zaman edan, yang pria berjas rapi
menutup seluruh aurat, eh ..... wanitanya berpakaian seksi minim bahan.
Apa itu namanya dunia nggak terbalik ?” sahut suplir yang dulunya tinggal
di teras depan rumah Bayu pacar Reiska yang ketiga.
*****
229 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
”Arif ... ada yang ingin kukatakan,” terdengar suara Reiska di ruang
tamu. Malam itu hanya mereka berdua yang ada di rumah, mama dan papa
serta kedua kakaknya, Rina dan Shanti pergi ke pesta pernikahan relasi
papanya.
”Ada apa?” tanya Arif, mereka berdua duduk di kursi sofa empuk.
”Aku ..... aku ..... Telat ..... aku .... ha ..... mil, Ari!”
”Hah? Kamu hamil?” tanya Arif kaget, ini di luar dugaannya.
”I ..... ya, kita harus segera menikah, Arif aku takut papa dan mama
akan marah!” ujar Reiska gusar.
”Tidak! Aku tidak mau menikah sekarang! Kamu harus menggugurkan
kandunganmu!”
”Arif, aku nggak mau, ini anak kita! Kamu harus bertanggung jawab!”
teriak Reiska bercampur tangis.
”Nggak, aku nggak mau, mungkin saja ini anakmu dengan pacar kamu
yang lain!”cibir Arif.
”Arif ..... teganya kamu bicara begitu, ini anak kamu, Arif anak kita!”
”Pokoknya tidak! Kamu harus menggugurkan, harus! Titik!”
”Eh ..... kawan-kawan, Reiska kenapa yah?” tanyaku pada mereka.
”Nggak tahu, tidak seperti biasanya yah? Mungkin ..... Reiska ribut
dengan Arif, atau berantem sama papa dan mamanya,”tebak anggrek.
Tiba-tiba, Reiska berjalan dengan tergesa menuju meja belajarnya,
meraih kotak mungil yang disimpannya dengan penuh kasih sayang selama
ini.
”Percuma kamu berikan itu, dulu bunga Edelweis kalau cintamu
bukan cinta abadi, tapi cinta murahan! Ngakunya cinta, tapi mengapa
kamu tinggalkan aku dalam keadaan ini?” tangis Reiska sambil membuka
kotak mungil itu lalu membuang seluruh bunga Edelweis ke dalam tempat
sampah yang berada tepat di samping meja belajar. Bunga lainnya, mawar,
suplir, dan anggrek menjerit histeris !
”Ja..ngan...!!” teriak mawar, suplier dan anggrek serempak. Tapi
terlambat! Edelweis telah dibuang ke dalam tong sampah dan bercampur
dengan sampai lainnya.
******
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 230
Namaku Edelwies alias Anaphalis javanica. Biasanya aku tumbuh di
dataran tinggi atau puncak-puncak gunung. Kali ini aku berada dalam
genggaman seorang pemuda bernama Rahman. Ia mengamatiku dari tadi
sambil terus berzikir memuji asma Allah.
”Ya...Rabb yang Maha Kuasa, satu lagi telah Kau-tunjukkan kebesaran-
Mu menciptakan bunga Edelweis yang tahan layu dan tak lelah diterpa
angin, tanpa memudar dan tanpa kekeringan. Ya...Rabb, seperti inikah
semangat Saudara-saudaraku di Palestina dalam menghadapi serangan
Tentara Yahudi demi merebut kembali hak mereka atas masjid Al-Aqsa? Ya
... Allah, kuatkanlah hati-hati kami untuk merebut itu semua,” lirih suara
Rahman menyejukkan hatiku.
Aku hanya tumbuhan tanpa nyawa, tapi aku merasakan betapa ia
seorang pemuda yang berhasil mengenali alamnya dan terus berzikir
melihat keesaan Penciptanya. Aku, Edelweis, tersenyum bahagia dalam
genggamannya.
(Sumber: Majalah Sabili, 10 April 2003)

2. Deskripsi
Kata deskripsi berasal dari bahasa latin discribere yang berarti gambaran,
perincian, atau pembeberan. Deskripsi adalah karangan yang menggambarkan
suatu objek berdasarkan hasil pengamatan, perasaan dan pengalaman
penulisnya. Tujuannya adalah pembaca memperoleh kesan atau citraan
sesuai dengan pengamatan, perasaan, dan pengalaman penulis sehingga
seolah-olah pembaca yang melihat, merasakan, dan mengalami sendiri
obyek tersebut. Untuk mencapai kesan yang sempurna, penulis deskripsi
merinci objek dengan kesan, fakta, dan citraan.
Dilihat dari sifat objeknya, deskripsi dibedakan atas 2 macam, yaitu
sebagai berikut.
a. Deskripsi Imajinatif/Impresionis ialah deskripsi yang menggam-
barkan objek benda sesuai kesan/imajinasi si penulis.

231 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Contoh deskripsi Impresionistis dalam sebuah cerita:
Jam dinding kamar menunjukkan pukul sepuluh lewat
sembilan belas menit. Di luar hujan masih saja turun dengan
derasnya. Angin yang menerobos masuk melalui kisi-kisi terasa
dingin menusuk kulit. Piama yang melekat di tubuhku tidak
banyak membantu menahan dingin sehingga agar lebih hangat
kepakai lagi jaket tebal. Agak menolong, memang.
Akan tetapi, kantuk hebat datang. Padahal besok aku harus
bangun lebih pagi. Akhirnya, daripada melamun tidak menentu,
kuputuskan akan melanjutkan membaca. Aku kembali ke meja
belajar, kunyalakan kembali lampu belajar dan mulai membaca
sambil duduk bersandar di kursi.
Tiba-tiba kantuk hebat datang menyerang. Belum lagi selesai
kalimat yang sedang kubaca, buku yang kupegang terlepas dari
tangan.
******
Aku tidak lagi berada di kamarku, tetapi di suatu ruangan
bersama-sama dengan sekelompok orang yang sama sekali belum
pernah kulihat sebelumnya. Bau asap tembakau memenuhi
ruangan itu, tapi tak seorang pun yang kelihatan peduli.
Kami semua duduk di kursi yang diatur membentuk sebuah
lingkaran, mirip dengan ruangan diskusi. Semua tampak duduk
tenang, semua kelihatan sedang menulis, dan tidak seorang pun
yang kelihatan peduli pada orang lain di ruangan itu.
******
Tidak ada yang ganjil terlihat. Malah terasa suasana persis
seperti di ruang kuliah. Di sebelah kananku ada sebuah pintu,
di dekatnya beberapa jendela kaca. Ada dua baris jendela kaca,
masing-masing terdiri atas empat jendela, yang menyebabkan
ruangan ini cukup terang. Di atas ruangan, tergantung di langit-
langit, ada empat pasang lampu neon 40 wat.
Dinding sebelah kiri kosong, tidak ada apa-apa di sana. Warna
hiau muda dinding itu sudah perlu dilebur kembali, di sana-sini
kelihatan coret-coretan tangan-tangan jahil.
(Dikutip dari wacana berjudul Banjir, oleh. Ramadhan Syukur dalam
buku: Menulis secara Populer, karya Ismail Marahimin, 2001)
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 232
b. Deskripsi faktual/ekspositoris ialah deskripsi yang menggambar
kan objek berdasarkan urutan logika atau fakta-fakta yang dilihat.
Contoh deskripsi faktual dalam sebuah cerita:
Lantai tiga kamar nomor tiga-nol-lima. Benar, ini dia kamar
yang kucari; tanda pengenalnya tertera di pintu, agak ke atas.
Tepat di depan mataku, masih di pintu itu, ada sebuah kotak
kecil warna merah jambu. Sebuah note book kecil diepitkan pada
kotak itu, dengan sebuah perintah dalam bahasa Inggris, Write
Your Massage! Pada note book itu kubaca pesan untukku, ”Masuk
saja, Rat, kunci dalam kotak ini. Tunggu aku!”
******
Di sebelah kiri pintu tergantung sebuah penanggalan dan sebuah
cermin yang bertuliskan ”Anda manis, Nona.” Di bawahnya
merapat sebuah meja belajar yang diberi alas kertas berbunga-
bunga merah jambu, dan dilapisi lagi dengan plastik bening.
Di atas meja ada sebuah tape recorder kecil, sebuah mesin ketik,
jam weker, alat-alat tulis, beberapa helai kertas berserakan dan
buku-buku dalam keadaan terbuka. Pasti semalam dia habis
mengerjakan paper, pikirku.
******
(Sumber: “Kamar Sebuah Asrama,” oleh Ni Made Tuti Marhaeni,
dalam buku Menulis Secara Populer, karya Ismail Marahimin,
2001)
Kita dapat membuat karangan deskripsi secara tidak langsung,
yaitu dengan mengamati informasi dalam bentuk nonverbal
berupa gambar, grafk, diagram, dan lain-lain. Apa saja yang
tergambarkan dalam bentuk visual tersebut dapat menjadi
bahan atau fakta yang akurat untuk dipaparkan dalam karangan
deskripsi karena unsur dasar karangan ini adalah pengamatan
terhadap suatu objek yang dapat dilihat atau dirasakan.
Tahapan menulis karangan deskripsi, yaitu:
(1) menentukan objek pengamatan
(2) menentukan tujuan
(3) mengadakan pengamatan dan mengumpulkan bahan
(4) menyusun kerangka karangan
(5) mengembangkan kerangka menjadi karangan.
233 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Pengembangan kerangka karangan bercorak deskriptif dapat berupa
penyajian parsial atau tempat. Penyajian urutan ini digunakan bagi karangan
yang mempunyai pertalian sangat erat dengan ruang atau tempat. Biasanya
bentuk karangannya deskriptif. Pola uraiannya berangkat dari satu titik
lalu bergerak ke tempat lain, umpamanya dari kiri ke kanan, atas ke bawah,
atau depan ke belakang.
Contoh:
Laporan lokasi banjir di DKI Jakarta
1. Banjir di wilayah Jakarta Timur
a. Duren sawit
b. Klender
c. Kampung Melayu
2. Banjir di wilayah Jakarta Pusat
a. Pramuka
b. Salemba
c. Tanah Abang
3. Banjir di wilayah Jakarta Barat
Karangan deskripsi dapat juga dibuat dengan mengamati bentuk
informasi nonverbal seperti grafk, tabel, atau bagan.
Contoh karangan deskripsi dari tabel.
Data Kasus Pelanggaran Izin Bangunan di DKI Jakarta
No. Tahun Kasus Pemutihan Dibongkar Residu
1. 2006 5.112 1.051 749 3.312
2. 2007 4.630 712 1.742 2.888
(Sumber: Republika, Jumat, 25 April 2008)
Dari tabel data kasus pelanggaran izin bangunan di atas, dapat kita lihat
bahwa pada tahun 2006, terdapat 5.112 kasus pelanggaran izin bangunan.
Di antaranya 749 bangunan dibongkar, 3.312 bangunan berstatus residu, dan
1.051 bangunan diarahkan untuk mengurus izin bangunan (pemutihan).
Pada tahun 2007, terdapat 4.630 bangunan yang tidak memiliki izin
mendirikan bangunan. Dari jumlah tersebut, yang diarahkan mengurus
perizinan sebanyak 712 unit, yang berstatus residu 2.888, sedangkan sisanya
sebanyak 1.742 bangunan terpaksa dibongkar.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 234
3. Eksposisi
Kita eksposisi berasal dari bahasa Latin exponere yang berarti:
memamerkan, menjelaskan, atau menguraikan. Karangan eksposisi adalah
karangan yang memaparkan atau menjelaskan secara terperinci
(memaparkan) sesuatu dengan tujuan memberikan informasi dan
memperluas pengetahuan kepada pembacanya. Karangan eksposisi
biasanya digunakan pada karya-karya ilmiah seperti artikel ilmiah, makalah-
makalah untuk seminar, simposium, atau penataran.
Untuk mendukung akurasi pemaparannya, sering pengarang
eksposisi menyertakan bentuk-bentuk nonverbal seperti grafk, diagram,
tabel, atau bagan dalam karangannya. Pemaparan dalam eksposisi dapat
berbentuk uraian proses, tahapan, cara kerja, dan sebagainya dengan pola
pengembangan ilustrasi, defnisi, dan klasifkasi.
Berikut contoh-contoh pengembangan karangan eksposisi:
a. Contoh eksposisi dengan pengembangan ilustrasi
Kepemimpinan seorang Bapak dalam rumah tangga bak
nakhoda mengemudikan kapal. Bapak menjadi kepala keluarga
yang bertanggung jawab terhadap istri dan keluarganya. Sama
seperti nakhoda yang mampu memimpin dan melaksanakan tugas
dan tanggung jawabnya. Bila kepemimpinan kepala keluarga
baik, akan baiklah keluarga tersebut, sama halnya dengan kapal
yang dikemudikan nakhoda.
b. Contoh eksposisi dengan pengembangan defnisi.
Telepon genggam yang lebih dikenal dengan sebutan ponsel
(telepon seluler) atau HP (hand phone) merupakan alat komunikasi
yang berbentuk kecil serta ringan. Selain mudah digenggam serta
dibawa ke mana-mana, bentuknya yang mungil memudahkan
orang untuk berkomunikasi di mana saja berada. Telepon genggam
adalah produk canggih era komunikasi nirkabel, telepon tanpa
kabel. Dengan variasi bentuk, merek, dan model yang selalu baru,
jenis telepon ini banyak diminati berbagai kalangan masyarakat.
c. Contoh eksposisi dengan pengembangan klasifkasi.
Ada dua jenis tanaman mini. Pertama, tanaman mini
yang bukan asli mini. Bila ditanam di tanah, ia akan tumbuh
besar dan normal seperti biasa. Bila ditempatkan di pot kecil,
pertumbuhannya jadi lambat. Tanaman jenis ini misalnya,
235 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
tanaman palem udang, pohon rhapis, pohon asem, beringin,
dan jambu kerikil. Jenis kedua tanaman mini asli yang aslinya
memang kecil. Tanaman ini kalau ditanam di tanah tidak dapat
besar seperti ukuran biasa (normal). Jika ditanam di pot kecil, ia
akan makin kecil, mungil, dan cantik. Tanaman ini antara lain
agave, chriptanthus panseviera, dan anthurium chrystallium.
Karangan eksposisi juga dapat ditulis berdasarkan fakta suatu
peristiwa, misalnya, kejadian bencana alam, kecelakaan, atau sejenis liputan
berita. Meskipun bentuk karangannya cenderung narasi, namun kita dapat
membuatnya menjadi bentuk paparan dengan memusatkan uraian pada
tahapan, atau cara kerja, misalnya cara menanggulangi penyebaran virus
fu furung, mengantisipasi wabah DBD dengan 3 M, atau evakuasi korban
banjir.
Contoh karangan eksposisi dari suatu peristiwa.
Dua pekerja yang tertimbun tanah longsor akhirnya ditemukan oleh
petugas kepolisian setelah sejak kemarin mereka menggali gundukan pasir
setinggi sepuluh meter. Dari sejak subuh kemarin hingga pukul 03.00 WIB
penggalian terus dilakukan dengan menggunakan backhoe. Penggalian
yang memakan waktu hampir 20 jam itu berakhir saat dua korban
berhasil ditemukan. Mundari ditemukan dalam keadaan tubuh melingkar.
Sementara Itok ditemukan dalam kondisi mengenaskan.
Tahapan menulis karangan eksposisi, yaitu sebagai berikut.
(1) menentukan objek pengamatan,
(2) menentukan tujuan dan pola penyajian eksposisi,
(3) mengumpulkan data atau bahan,
(4) menyusun kerangka karangan, dan
(5) mengembangkan kerangka menjadi karangan.
Pengembangan kerangka karangan berbentuk eksposisi dapat berpola
penyajian berikut:
1). Urutan topik yang ada
Pola urutan ini berkaitan dengan penyebutan bagian-bagian suatu
benda, hal atau peristiwa tanpa memproritaskan bagian mana
yang terpenting. Semua bagian dianggap bernilai sama.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 236
2). Urutan klimaks dan antiklimaks
Pola penyajian dimulai dari hal yang mudah/yang sederhana
menuju ke hal yang makin penting atau puncak peristiwa dan
sebaliknya untuk anti-klimaks.

4. Argumentasi
Karangan argumentasi ialah karangan yang berisi pendapat, sikap, atau
penilaian terhadap suatu hal yang disertai dengan alasan, bukti-bukti, dan
pernyataan-pernyataan yang logis. Tujuan karangan argumentasi adalah
berusaha meyakinkan pembaca akan kebenaran pendapat pengarang.
Karangan argumentasi dapat juga berisi tanggapan atau sanggahan
terhadap suatu pendapat dengan memaparkan alasan-alasan yang rasional
dan logis.
Tahapan menulis karangan argumentasi, sebagai berikut.
(1) menentukan tema atau topik permasalahan,
(2) merumuskan tujuan penulisan,
(3) mengumpulkan data atau bahan berupa: bukti-bukti, fakta, atau
pernyataan yang mendukung,
(4) menyusun kerangka karangan, dan
(5) mengembangkan kerangka menjadi karangan.
Pengembangan kerangka karangan argumentasi dapat berpola sebab-
akibat, akibat-sebab, atau pola pemecahan masalah.
1). Sebab-akibat
Pola urutan ini bermula dari topik/gagasan yang menjadi sebab
berlanjut topik/gagasan yang menjadi akibat.
Contoh:
a. Sebab-sebab kemacetan di DKI Jakarta
a) Jumlah penggunaan kendaraan
b) Ruas jalan yang makin sempit
c) Pembangunan jalur busway
b. Akibat-akibat kemacetan
a) Terlambat sampai di kantor
b) Waktu habis di jalan
237 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
2). Akibat-sebab
Pola urutan ini dimulai dari pernyataan yang merupakan akibat
dan dilanjutkan dengan hal-hal yang menjadi sebabnya.
Contoh : Menjaga kelestarian hutan
1. Keadaan hutan kita
2. Fungsi hutan
3. Akibat-akibat kerusakan hutan
3). Urutan Pemecahan Masalah
Pola urutan ini bermula dari aspek-aspek yang menggambarkan
masalah kemudian mengarah pada pemecahan masalah.
Contoh : Bahaya narkoba dan upaya mengatasinya
1. Pengertian narkoba
2. Bahaya kecanduan narkoba
a. pengaruh terhadap kesehatan
b. pengaruh terhadap moral
c. ancaman hukumannya
3. Upaya mengatasi kecanduan narkoba
4. Kesimpulan dan saran
Contoh karangan argumentasi:
Salah Urus Kereta Api
Lagi-lagi kecelakaan kereta api terjadi. Kereta api Citra Jaya terguling
di Cibatu, Jawa Barat, Sabtu lalu. Pada hari yang sama, sepur eksekutif
Argo Lawu juga anjlok di Banyumas, Jawa Tengah. Ini makin menunjukkan
perkeretaapian kita dalam kondisi gawat. Pemerintah mesti segera
membenahinya sebelum korban jatuh lebih banyak akibat kecelakaan.
Musibah kereta api Argo Lawu tak memakan korban. Tapi kecelakaan
kereta Citra Jaya menyebabkan puluhan orang terluka. Dafar kecelakaan
pun bertambah panjang. Dalam kurun waktu empat bulan terakhir sudah
terjadi 10 kali kecelakaan kereta api. Angka ini naik hampir tiga kali lipat
dibanding periode yang sama tahun lalu.
Tidaklah salah pernyataan Menteri Perhubungan Hata Rajasa kemarin
bahwa anjloknya dua sepur itu seharusnya bisa dideteksi. Tanda-tanda
amblesnya tanah di bawah bantalan rel kereta tentu bisa diamati jauh
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 238
hari. Dengan kata lain, semestinya manajemen PT Kereta Api lebih serius
mengawasi jalur kereta api.
Persoalannya, Pak Menteri Cuma melihat sisi ketidakberesan PT Kereta
Api. Yang terjadi sebenarnya pemerintah juga salah urus perusahaan ini
sehingga terus merugi. Jumlahnya tidak tanggung-tanggung, Rp 1,4 triliun
per tahun. Inilah yang menyebabkan perusahaan milik negara tersebut tak
sanggup memberikan layanan yang baik.
Kerugian besar muncul karena PT Kereta Api diwajibkan memelihara
jaringan rel di Indonesia. Total duit yang dikeluarkan untuk perawatan
reguler per tahun mencapai Rp 2,1 triliun. Sementara itu, anggaran dari
pemerintah hanya Rp 750 miliar.
Di luar perawatan rutin, PT Kereta Api jelas tak mampu lagi
menanggungnya. Padahal sebagian besar bantalan rel itu perlu diganti.
Dari total panjang lintasan rel kereta api 4.676 kilometer, separuh lebih
berusia di atas 50 tahun. Jangan heran jika banyak bantalan rel yang sudah
lapuk. Kondisi ini sangat mudah membuat kereta api anjlok. Faktanya,
sebagian besar kecelakaan kereta api yang terjadi pada 2001-2006 akibat
kurang beresnya rel.
Badan Perencanaan Pembangunan Nasional tahun lalu menghitung
dibutuhkan Rp 6 triliun untuk menyehatkan kereta api dan jaringan rel.
Dalam keadaan anggaran negara yang sedang tekor, angka itu memang
tampak besar. Tapi, kalau pemerintah bisa menalangi Lapindo Brantas Inc.
Sekitar Rp 7,5 triliun buat membangun infrastruktur di Porong Sidoarjo,
kenapa untuk urusan yang ini tidak?
Pemerintah tak perlu ragu mengucurkan dana untuk pembenahan
perkeretaapian. Jika dikelola dengan benar, kereta api sebetulnya berpotensi
menunjang perekonomian. Dengan pengelolaan di bawah standar pun,
setiap tahun kereta api mampu mengangkut 150 juta penumpang dan 5 juta
ton barang. Kalau ditangani lebih baik, jumlah penumpangnya tentu akan
jauh meningkat. Pendapatan PT Kereta Api pun akan bertambah.
Membiarkan kereta api berlari di atas bantalan rel yang lapuk atau tak
terurus sungguh berbahaya. Jika pemerintah peduli keselamatan warganya,
kondisi perkeretaapian yang amburadul harus segera dibenahi.
(Dikutip dari Koran Tempo, 24 April 2007)
239 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
RANGKUMAN
A. Pengertian wacana
Wacana adalah sebuah tulisan yang teratur menurut urut-urutan
yang semestinya atau logis. Dalam wacana setiap unsur-unsurnya harus
memiliki kesatuan dan kepaduan.
Sebelum menulis wacana, seseorang harus menentukan tema, tujuan
yang sesuai dengan bentuk wacana, dan menyusun kerangka karangan.
Membuat kerangka karangan sangat dianjurkan sebelum penulisan,
terutama bagi pengarang pemula. Agar penyusunan kerangka karangan
menjadi acuan pembuatan karangan, calon penulis sebaiknya mengetahui
langkah-langkah menyusun kerangka karangan. Kerangka karangan
dapat di tulis dalam dua bentuk, yaitu kerangka kalimat dan kerangka
topik.
B. Jenis-Jenis Wacana
Berdasarkan bentuk atau jenisnya, wacana dibedakan menjadi
wacana narasi, deskripsi, eksposisi, argumentatif, dan persuasi.
1. Narasi
Narasi adalah cerita yang didasarkan pada urut-urutan suatu kejadian
atau peristiwa. Narasi dapat berbentuk narasi ekspositoris dan narasi
imajinatif. Unsur-unsur penting dalam sebuah narasi adalah kejadian,
tokoh, konfik, alur/plot, serta latar yang terdiri atas latar waktu, tempat,
dan suasana.
2. Deskripsi
Deskripsi adalah karangan yang menggambarkan/suatu objek
berdasarkan hasil pengamatan, perasaan, dan pengalaman penulisnya.
Untuk mencapai kesan yang sempurna bagi pembaca, penulis
merinci objek dengan kesan, fakta, dan citraan. Dilihat dari sifat objeknya,
deskripsi dibedakan atas 2 macam, yaitu deskripsi Imajinatif/Impresionis
dan deskripsi faktual/ekspositoris.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 240
3. Eksposisi
Karangan eksposisi adalah karangan yang memaparkan atau
menjelaskan secara terperinci (memaparkan) sesuatu dengan tujuan
memberikan informasi dan memperluas pengetahuan kepada
pembacanya. Karangan eksposisi biasanya digunakan pada karya-
karya ilmiah seperti artikel ilmiah, makalah-makalah untuk seminar,
simposium, atau penataran.
Tahapan menulis karangan eksposisi, yaitu menentukan objek
pengamatan, menentukan tujuan dan pola penyajian eksposisi,
mengumpulkan data atau bahan, menyusun kerangka karangan, dan
mengembangkan kerangka menjadi karangan.
Pengembangan kerangka karangan berbentuk eksposisi dapat
berpola penyajian urutan topik yang ada dan urutan klimaks dan
antiklimaks.

4. Argumentasi
Karangan argumentasi ialah karangan yang berisi pendapat,
sikap, atau penilaian terhadap suatu hal yang disertai dengan alasan,
bukti-bukti, dan pernyataan-pernyataan yang logis. Tujuan karangan
argumentasi adalah berusaha meyakinkan pembaca akan kebenaran
pendapat pengarang.
Tahapan menulis karangan argumentasi, yaitu menentukan tema atau
topik permasalahan, merumuskan tujuan penulisan, mengumpulkan data
atau bahan berupa: bukti-bukti, fakta, atau pernyataan yang mendukung,
menyusun kerangka karangan, dan mengembangkan kerangka menjadi
karangan.
Pengembangan kerangka karangan argumentasi dapat berpola
sebab-akibat, akibat-sebab, atau pola pemecahan masalah.
241 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
TUGAS MANDIRI
Agar lebih memahami dan terampil menulis wacana bercorak narasi,
deskripsi, eksposisi, dan argumentasi, kerjakanlah tugas berikut.
1. Bacalah wacana di awal bab. Tulislah paragraf berbentuk deskripsi
dan eksposisi.
2. Carilah di koran atau majalah contoh tulisan berbentuk narasi,
deskripsi, eksposisi, atau argumentasi. Jelaskan perbedaannya dari
segi tema, tujuan, dan sifat uraiannya.
3. Tulislah wacana bercorak:
a. narasi yang berisi uraian secara kronologis.
b. deskripsi dengan mengamati gambar atau ilustrasi. Panjang
karangan 150 – 200 kata dalam waktu 30 menit.
c. eksposisi mengenai suatu peristiwa,
d. argumentasi tentang prinsip atau sikap kerja.
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Dibandingkan menanam tanaman lain, tanaman hidroponik dapat di-
letakkan dalam rumah atau bangunan. Tumbuhan ini mudah tumbuh
asal kebersihannya terjaga ……
Paragraf ini berisi hal tentang
a. tanaman hidroponik d. manfaat hidroponik
b. keuntungan hidroponik e. cara menanam tanaman
c. tanaman dalam bangunan
2. Di belakang bukit di sebelah selatan, padang ilalang terbentang luas.
Ketika itu, bunga-bunganya sudah bermunculan. Putih tipis, terumbai-
umbai bergerak ditiup angin, seperti busa air di arus yang deras.
Uraian di atas merupakan paragraf jenis ……
a. narasi
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 242
b. deskripsi
c. argumentasi
d. persuasi
e. ekposisi
3.

Buang sampah di sungai
Banjir Hutan ditebang
Saluran air tidak tepat
Bagan di atas merupakan laporan secara
a. induktif
b. deduktif
c. induktif-deduktif
d. deduktif-induktif
e. campuran
4. Di bawah ini yang merupakan pengertian wacana adalah
a. sebuah tulisan yang teratur dan logis
b. sebuah uraian singkat
c. teks yang berisi data dan fakta
d. naskah pidato
e. cerita berbentuk narasi ukpositos
5. Unsur terpenting dalam sebuah wacana adalah
a. alinea atau paragraf
b. alur
c. tema
d. kalimat utama
e. judul
6. Hal-hal di bawah ini termasuk tahapan membuat karangan eksposisi,
kecuali
a. menentukan objek pengamatan
b. menentukan tujuan dan pola penyajian eksposisi
c. mengadakan pengamatan terhadap objek
243 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
d. menyusun kerangka karangan
e. mengembangkan kerangka menjadi karangan
7. Keterangan yang berisi penggambaran atas suatu objek disebut
a. narasi
b. deskripsi
c. argumentasi
d. eksposisi
e. persuasi
8. Karangan yang isinya menjelaskan dengan tujuan memberi tambahan
informasi atau pengetahuan bagi pembacanya disebut
a. narasi
b. deskripsi
c. argumentasi
d. eksposisi
e. persuasi
9. Karangan deskripsi yang menggambarkan objek sesuai kesan atau
imajinasi si penulis disebut
a. narasi
b. deskripsi
c. narasi faktual
d. deskripsi impresionistis
e. argumentasi
10. Hal berikut adalah manfaat kerangka dalam pembuatan karangan,
kecuali
a. agar tulisan sistematis
b. menggambarkan pola susunan ide-ide pokok
c. menggambarkan pola penalaran karangan
d. menggambarkan secara umum ide karangan
e. mengoreksi ide pokok yang timpa tindih
11. 1. Pendahuluan
2. Langkah-langkah berbisnis lewat internet
3. Keuntungan berbisnis lewat internet
4. Manfaat internet
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 244
5. Teknologi informasi yang namanya internet
Susunan topik-topik di atas agar menjadi kerangka karangan yang baik
ialah
a. (1), (2), (3), (4), (5)
b. (5), (4), (2), (1)
c. (1), (5), (4), (3), (2)
d. (1), (4), (5), (2), (3)
e. (5), (4), (3), (1), (2)
12. Perhatikan kerangka karangan berikut:
(1) teknologi sudah diketahui, tetapi belum dimanfaatkan
(2) turbin yang berputar akan mengalirkan energi listrik besar 60 Mega
wat
(3) uap panas itu disalurkan ke turbin
(4) itu yang terjadi di Amerika serikat dan lain lagi di Indonesia.
Kerangka karangan di atas termasuk berbentuk
a. kerangka karangan kalimat
a. kerangka karangan topik
b. kerangka karangan ide pokok
c. kerangka karangan imajinatif
d. kerangka karangan naratif
13. Dalam kehidupan pribadi, disiplin berarti peraturan yang dibuat untuk
diri sendiri yang tidak bertentangan dengan peraturan umum. Bangun
dan melakukan suatu tepat pada waktunya. Hadir dalam suatu acara
pada waktu yang ditetapkan atau melakukan tugas dan kewajiban
dengan tepat dan tertib dapat tercapai kalau ada disiplin pribadi.
Pengembangan paragraf di atas menggunakan pola.
a. persuasi
b. eksposisi
c. narasi
d. argumentasi
e. deskripsi
245 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
14. (1) perdagangan setelah berlakunya pasar bebas
(2) pengertian pasar bebas
(3) strategi menghadapi pasar bebas
(4) dampak pasar bebas terhadap satu negara
(5) eksis di era pasar bebas
Urutan kerangka yang tepat ialah
a. (1), (2), (3), (4), (5)
b. (2), (3), (4), (1), (5)
c. (2), (1), (4), (3), (5)
d. (5), (4), (2), (3), (1)
e. (3), (2), (4), (5), (1)
15. Sejalan dengan industrialisasi, peran sektor pertanian di dalam
produksi nasional menunjukkan trend yang terus menurun. Meskipun
demikian, perannya di dalam perekonomian sangat penting, yakni
sebagai sumber produksi pangan, bahan baku industri, dan juga
sebagai sumber penghasilan berjuta-juta petani.
Koherensi (hubungan antar kalimat) dalam paragraf di atas di wujudkan
dengan menggunakan penghubung yang menyatakan
a. sebab-akibat
b. berurutan
c. ringkasan
d. pertentangan
e. perbandingan
16. Kalimat yang bersifat deskriptif ialah
a. Merokok merupakan kebiasaan yang kurang selaras dengan
kampanye hidup sehat.
b. Polusi udara yang makin meningkat harus diatasi dengan
sungguh-sungguh.
c. Asap tebal membubung tinggi di atas gunung api yang aktif.
d. Persoalan yang melilit para pengusaha kecil ialah kurangnya
modal.
e. Perolehan devisa dari sektor pariwisata menurun tajam sejak
tragedi bom Bali.
17. Indonesia pernah ketempatan kutup air hangat di atas atmosfernya,
yaitu pada tahun 1988. Akibatnya, curah hujan di Jawa waktu itu
sangat tinggi, meski tidak mengakibatkan banjir sungai yang dahsyat.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 246
Dari situ jelaslah bahwa penyebab banjir di negeri kita tidak mutlak
karena tingginya curah hujan, tetapi juga karena ulah manusia seperti
perusakan hutan dan keengganan mengadakan reboisasi.
Kesimpulan yang diperoleh setelah membaca paragraf di atas
ialah
a. Kutup air hangat di atas atmosfer dapat meningkatkan curah
hujan.
b. Banjir bukan karena curah hujan yang tinggi, tetapi peran ulah
manusia juga.
c. Banyak sungai yang banjir akibat dari hujan deras dan kutup air
hangat.
d. Curah hujan yang tinggi terutama di Jawa mengakibatkan sungai–
sungai banjir.
e. Perusakan hutan dan keengganan mengadakan reboisasi
mengakibatkan banjir.
18. Kerangka argumentasi dengan penalaran yang menyatakan hubungan
akibat – sebab terdapat pada
a. Apabila siswa patuh, kelas akan menjadi tertib dan proses belajar
berjalan lancar.
b. Makin banyak jumlah pengganguran, persaingan mencari
pekerjaan makin ketat.
c. Di mana terjadi kebakaran hutan karena panjang dan mungkin
juga ulah manusia.
d. Keluarga aman menjadi akseptor KB Lestari tentu saja kehidupan
rumah tangga sejahtera.
e. Hasan seorang remaja yang cerdas, terampil, dan disiplin, sehingga
ia diterima sebagai karyawan bank.
19. Sembilan bocah berkerumun di atas petak tanah yang berlumpur. Baju,
kaki, tangan bahkan wajah mereka terlihat kotor. Sementara di langit
matahari memancarkan cahayanya yang garang. Tiba-tiba seorang
anak yang bertelanjang dada berteriak, ”Awas! Ular!” Teman-temannya
berlarian menghindar sambil berkata, ” Mana? Mana?”
Pola pengembangan paragraf tersebut adalah
a. narasi d. argumentasi
b. deskripsi e. persuasi
c. eksposisi
247 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
20. Di bawah ini yang sesuai judul karangan persuatif adalah
a. Dari Ave Maria ke Jalan Lain Ke Roma
b. Dian Tak Kunjung Padam
c. Layar Terkembang
d. Langkah-langkah Membina Hubungan Bisnis
e. Lemak Yang Berlebihan Mengakibatkan Jantung Koroner.
II. Jawablah pertanyaan di bawah ini dengan tepat dan benar!
1. Jelaskan pengertian wacana argumentasi!
2. Sebutkan dan jelaskan cara membuat karangan yang baik!
3. Jelaskan pengertian kerangka karangan!
4. Sebutkan syarat-syarat paragraf yang baik!
5. Apa yang dimaksud dengan narasi?
6. Jelaskan fungsi dari kerangka karangan!
7. Jelaskan apa yang dimaksud dengan teknik menyimpulkan secara
induktif dan deduktif!
8. Buatlah contoh paragraf yang menggunakan koherensi dengan kata
ganti orang!
9. Buatlah contoh satu paragraf dengan pola hubungan sebab-akibat!
10. Buatlah kerangka karangan berurutan pada urutan umum-khusus!
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 248
249 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Standar
Kompetensi
- Berkomunikasi dengan bahasa indonesia setara tingkat
madya
Kompetensi
Dasar
- Meringkas dan menyimpulkan teks tertulis dalam
konteks bekerja
Bab ini membahas materi tentang cara membuat ringkasan dari teks tertulis
dalam bentuk uraian dalam bahasa yang baik dan benar serta ringkasan
berbentuk skema atau bagan dengan bahasa yang lugas. Pada bab ini pun,
kita belajar membuat simpulan. Setelah pembelajaran ini, kita diharapkan
mampu menyusun ringkasan dengan bahasa yang baik dan benar serta dapat
menyimpulkan teks dengan jelas dan benar.
Indikator
- Mencatat butir-butir informasi yang akan diringkas
dalam bentuk skema atau bagan dalam bahasa yang
lugas dan jelas
- Menghitung jumlah kalimat yang menjadi isi ringkasan
sesuai dengan rumus meringkas yang baku
- Menyusun ringkasan teks secara jelas dalam bahasa
yang baik dan benar
- Menyimpulkan suatu teks dengan menggunakan
kalimat yang tidak ambigu, jelas, lugas, dan bernalar
sesuai dengan informasi yang diperoleh

BAB 13
MERINGKAS DAN MENYIMPULKAN TEKS
TERTULIS DALAM KONTEKS BEKERJA
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 250
Wacanan
Jawara Olahraga dari Desa
yang Mengharumkan Nama Bangsa
Triyatno, Anak Emas Petani Susah
Betapa girangnya Triyatno, Minggu (9/12) siang itu. Sebagai anak
petani, dia menyumbangkan mendali emas bagi bangsa dan negara.
Kebahagiaannya bertambah karena hadiah uang Rp 200 juta akan
diserahkan kepada ibunya, yang telah membesarkan dan mendidiknya
dalam kesusahan.
“Hadiah uang dari pemerintah akan saya berikan kepada Ibu, terserah
mau digunakan untuk apa,” ujar Triyatno, yang murah senyum dan rendah
hati itu.
Lifer Triyatno, yang 20 Desember mendatang genap 20 tahun, pada fnal
kelas 62 kg angkat besi SEA Games XXIV di provinsi Nakhon Ratchasima,
Thailand, mengumpulkan angkatan Snatch 130 kg dan clean and jerk 160 kg.
Dengan demikian, total angkatan emasnya 290 kg. Prestasi yang ia raih itu
menyamai rekor SEA Games yang ditorehkan oleh lifer Indonesia, Gustar
Junianto, pada SEA Games tahun 2003 di Hanoi (clean and jerk dan total
angkatan) dan lifer Thailand, Com Singnoi (snatch), yang diukir pada SEA
Games 2001 di Johor Bahru, Malaysia.
Menekuni dunia angkat besi sejak usia 14 tahun, ketika itu kelas
II SMP di Metro, Lampung, banyak suka duka dialami Triyatno dalam
meraih prestasi. Di Metro, ia dilatih Yono Haryono. Karena padepokannya
kemudian dilarang dan dibongkar, Triyatno pindah latihan di Parung-
Panjang, Bogor.
Enam tahun terakhir, prestasi Triyatno terus meningkat. Tahun 2001, ia
meraih perunggu di kejuaraan nasional angkat besi. Tiga tahun kemudian,
ia meraih medali emas.
Di pra-PON, prestasi Triyatno berada di peringkat enam. Namun, di
kompetisi internasional setelah itu, angkatannya terus bertambah. Pada
kejuaraan angkat besi dunia yunior di Ceko tahun 2006, Triyatno meraih
medali perak. Di Asian Games Doha, ia berada di peringkat empat. Saat
mengikuti kejuaraan dunia angkat besi, Triyatno berada di peringkat empat.
Tahun 2007, ia mengikuti kejuaraan dunia yunior dan meraih perunggu.
Pada kejuaraan dunia senior di Chiang Mai, ia berada di peringkat delapan.
“Sekarang, ikut SEA Games dan meraih emas. Saya bangga dan senang jadi
251 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
duta bangsa dan persembahkan prestasi buat negara tercinta,” ujar Triyatno,
yang anak ketiga dari pasangan petani Suparno (50) dan Sukartinah (49).
“Bagi saya, target bukan beban, tetapi lebih dari sekadar motivasi
dan saya punya cita-cita, bagaikan bisa turun di ajang Olimpiade Beiing,”
kilah Triyatno. Cita-cita lainnya adalah bekerja, jadi pegawai negeri sipil,
walau baru mengantongi iazah SMU, lulusan SMU Paruh Panjang, Bogor.
“Karena sudah tamat SMU, saya ingin langsung kerja.”
Si Jago Dayung dari Gunung
Namanya mungkin terbilang baru di kancah olahraga dayung. Namun,
jangan salah, Siti Maryam (19), pendayung dari nomor traditional boat ini,
sudah mengantongi sejumlah emas pada pertandingan tradisional boat
tingkat Asia Tenggara.
Terlahir di Gunung Halu, Cililin, Bandung, 2 September 1988, Siti selalu
dipandang aneh oleh orang yang pertama kali berkenalan dengannya. “Kok
orang gunung bisa ngedayung? Ketemu airnya di mana?” ujarnya terkekeh-
kekeh menirukan pertanyaan orang-orang.
Perkenalan Siti dengan dunia mendayung dimulai tahun 2003 ketika ia
duduk di kelas 3 SMP Gunung Halu, Bandung. Sepupunya, yang juga atlet
nasional cabang olahraga dayung nomor kayak, sering mengajaknya ke
Situ Ciburuy di Padalarang, Bandung, untuk menonton latihan dayung.
“Dari nonton, eeh malah iseng pengen coba, sampai ketagihan,” ujarnya.
Ia lantas memberanikan diri mendafar di asrama atlet yunior Pusat
Pendidikan dan Latihan Pelajar, Bandung, untuk didik menjadi atlet cabang
olahraga dayung.
Awalnya ia tertarik di nomor kayak. “Lebih ringan dan mendayungnya
menggunakan dua tangan,” tutur gadis yang duduk di semester satu
Jurusan Olahraga Universitas Pendidikan Indonesia, Bandung. Namun,
pada seleksi pelatnas 2005, ia tidak berhasil menduduki peringkat empat
teratas yang akan dipertandingkan untuk nomor kayak.
Siti kemudian dialihkan ke nomor traditional boat, sebagai pendayung di
sisi kanan. “Besar sebelah deh tangannya.....,” ujarnya terpingkal-pingkal.
Meski berotot hanya sebelah tangan, Siti mengaku tetap percaya diri. “Yang
penting saya berkesempatan membawa nama negara dan berprestasi,”
tuturnya bangga.
SEA Games XXIV mendatang di Nakhon Ratchasima, Thailand, menjadi
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 252
SEA Games ke-2 yang diikuti Siti. Pada SEA Games XXIII di Filipina, Siti
bersama rekan-rekannya meraih dua perunggu di jarak 1.000 meter dan
500 meter. Awal tahun 2007, pada Kejuaraan Traditional Boat di Penang,
Malaysia, dan Thailand, timnya berhasil meraih emas di jarak 500 meter.
“Tahun ini latihannya jauh lebih berat dari yang dua tahun lalu. Saya
optimistis tim traditional boat putri berhasil meraih emas, setidaknya di jarak
500 meter,” ujar Siti penuh harap.
(Sumber: Kompas, 2 Desember 2007)
A. Pengertian Ringkasan
Ringkasan (precis) adalah suatu cara yang efektif untuk menyajikan
karangan yang panjang dalam sajian yang singkat. ”Precis” berarti
”memotong” atau ”memangkas”. Sebuah ringkasan bermula dari karangan
sumber yang panjang, yang kemudian dipangkas dengan mengambil hal-
hal atau bagian yang pokok dengan membuang perincian serta ilustrasi.
Meskipun begitu, sebuah ringkasan tetap mempertahankan pikiran
pengarang serta pendekatannya yang asli. Jadi, ringkasan merupakan
keterampilan mereproduksi hasil karya yang sudah ada dalam bentuk yang
singkat.
Ringkasan berbeda dengan ikhtisar. Walaupun kedua istilah itu sering
disamakan, tapi sesungguhnya keduanya berbeda. Ringkasan merupakan
penyajian singkat dari suatu karangan asli namun tetap mempertahankan
urutan isi dan sudut pandang pengarang asli. Ikhtisar sebaliknya, tidak perlu
mempertahankan sistematika penulisan sesuai dengan aslinya dan tidak
perlu menyajikan isi dari seluruh karangan itu secara proporsional. Dalam
ikhtisar, penulis dapat langsung mengemukakan pokok uraian, sementara
bagian yang dianggap kurang penting dapat dibuang.
B. Cara Membuat Ringkasan
Ada beberapa cara yang dapat diadikan pegangan dalam membuat
ringkasan yang baik dan teratur, yaitu sebagai beriku.
253 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
1. Membaca Naskah Asli
Penulis ringkasan harus membaca naskah asli secara keseluruhan
beberapa kali untuk mengetahui kesan umum, maksud pengarang,
serta sudut pandangnya.
2. Mencatat Gagasan Utama
Semua hal yang menjadi gagasan utama atau gagasan penting digaris-
bawahi atau dicatat.
3. Membuat Reproduksi
Menyusun kembali suatu karangan singkat berdasarkan gagasan-
gagasan penting yang dicatat tadi.
4. Ketentuan Tambahan
Ada ketentuan tambahan selain ketiga cara di atas, yaitu sebagai
berikut.
a. Lebih baik menggunakan kalimat tunggal daripada kalimat
majemuk.
b. Ringkaslah kalimat menjadi frasa, frasa menjadi kata, gagasan
panjang menjadi gagasan sentral saja. Bahkan, jika tidak diperlukan
sebuah paragraf dapat dipangkas atau dibuang.
c. Semua paragraf ilustrasi yang dianggap penting harus
dipersingkat atau digeneralisasi.
d. Bila mungkin, semua keterangan atau kata sifat dibuang.
e. Dalam ringkasan, tidak ada pemikiran atau interpretasi baru dari
penulis ringkasan.
f. Ringkasan dari sumber asli yang berupa naskah pidato atau pidato
langsung, penggunaan kata ganti orang pertama tunggal atau
jamak harus ditulis dengan sudut pandang orang ketiga.
g. Sebuah ringkasan umumnya ditentukan dari panjang ringkasan
fnalnya, misalnya 150 atau 200 kata bergantung pada
permintaannya.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 254
C. Beberapa Contoh Bentuk Ringkasan
Ringkasan dapat disusun dalam dua bentuk, yaitu bentuk verbal uraian
(paragraf) dan bentuk nonverbal berupa bagan atau skema. Meskipun
ringkasan berbentuk bagan atau skema, tetapi harus mencerminkan gagasan
atau seperti yang diungkapkan oleh teks sumbernya. Sebelum membuat
bagan atau skema, harus dicatat terlebih dulu butir-butir informasi yang
akan diadikan unsur-unsur bagan atau skema.
Perhatikan beberapa contoh teks dan ringkasannya di bawah ini!
Contoh 1:
Jumlah pemudik lebaran diperkirakan sama dengan tahun-tahun
sebelumnya. Meski demikian, lonjakan arus penumpang lebaran diantisipasi
naik 10-15% agar jangan sampai kekurangan sarana angkutan. Untuk itu,
diharapkan arus pulang mudik lebaran sudah mulai berlangsung jauh
sebelum puncak lebaran. Kalau semua ramai-ramai pulang menjelang
lebaran, bisa-bisa pemudik akan menumpuk di terminal. Meskipun
akhirnya terangkat juga, hal itu memberi kesan seolah-olah kekurangan
sarana. Padahal, sebetulnya cukup memadai.
Sarana angkutan dari jauh-jauh hari sudah dipersiapkan. Angkutan
bus betul-betul menjadi tulang punggung di saat-saat seperti ini karena
lebih dari separuh calon pemudik diperkirakan akan terangkut oleh bus.
Sementara hanya 1/3 dari seluruh pemudik dari Jakarta dan sekitarnya
diperkirakan menggunakan jasa KA
Angkutan bus jarak jauh tidak ada masalah. Perusahan angkutan bus
sudah mampu menyediakan dalam jumlah bsar. Mesti begitu pemerintah
tetap mempersiapkan juga. Tinggal masalah lancar dan tidaknya saja di
perjalanan . Masalah yang satu ini jelas sangat ditentukan oleh disiplin
bersama. Baik disiplin aparat, penyelenggara, maupun pemakai jalan meski
fasilitasnya cukup, kalau lalu lintas macet, apalah artinya.
255 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Ringkasan teks di atas adalah sebagai berikut:
Jumlah pemudik lebaran diperkirakan sama dengan tahun-tahun
sebelumnya meskipun diantisipasi akan naik 10–15%. Diharapkan proses
mudik berlangsung jauh sebelum lebaran agar tidak terjadi penumpukan
di terminal dan terkesan kekurangan sarana.
Separuh calon pemudik diperkirakan akan menggunakan bus.
Dan 1/3 dari seluruh pemudik Jakarta dan sekitarnya diperkirakan
menggunakan kereta api. Perusahaan bus sudah mempersiapkan seluruh
armadanya. Demikan pula dengan pemerintah. Selanjutnya lancar dan
tidaknya ditentukan oleh kedisiplinan bersama.
Contoh 2:
Puskesmas sangat menguntungkan bagi masyarakat, terutama bagi
masyarakat di pedesaan dan bagi masyarakat yang kurang mampu. Biaya
pengobatan di puskesmas sangat murah. Prosesnya pun mudah. Asalkan
sudah mendafarkan diri, pasien tinggal menunggu panggilan untuk
diperiksa. Pasien yang dapat ditangani di puskesmas dapat langsung pulang
setelah diperiksa dan diberi obat. Jika puskesmas tidak dapat menangani,
pasien akan dirujuk ke Rumah Sakit Daerah. Ia akan diberi pengantar atau
surat rujukan untuk diperiksa di Rumah Sakit Daerah.
Ringkasan teks di atas dapat berbentuk bagan, seperti di bawah ini.
Pelayanan di Puskesmas
- 115 -
Jumlah pemudik lebaran diperkirakan sama dengan tahun-tahun sebelumnya. Meski
demikian, lonjakan arus penumpang lebaran diantisipasi naik 10-15% agar jangan sampai
kekurangan sarana angkutan. Untuk itu, diharapkan arus pulang mudik lebaran sudah mulai
berlangsung jauh sebelum puncak lebaran. Kalau semua ramai-ramai pulang menjelang
lebaran, bisa-bisa pemudik akan menumpuk di terminal. Meskipun akhirnya terangkat juga,
halitu memberi kesan seolah-olah kekurangan sarana. Padahal, sebetulnya cukup memadai.
Sarana angkutan dari jauh-jauh hari sudah dipersiapkan. Angkutan bus betul-betul
menjadi tulang punggung di saat-saat seperti ini karena lebih dari separuh calon pemudik
diperkirakan akan terangkut oleh bus. Sementara hanya 1/3 dari seluruh pemudik dari Jakarta
dan sekitarnya diperkirakan menggunakan jasa KA
Angkutan bus jarak jauh tidak ada masalah. Perusahan angkutan bus sudah mampu
menyediakan dalam jumlah bsar. Mesti begitu pemerintah tetap mempersiapkan juga. Tinggal
masalah lancar dan tidaknya saja di perjalanan . Masalah yang satu ini jelas sangat ditentukan
oleh disiplin bersama. Baik disiplin aparat, penyelenggara, maupun pemakai jalan mesti
fasilitasnya cukup, kalau lalu lintas macet, apalah artinya.
Ringkasan teks di atas adalah sebagai berikut:
Jumlah pemudik lebaran diperkirakan sama dengan tahun-tahun sebelumnya meskipun
diantisipasi akan naik 10 – 15 %. Diharapkan proses mudik berlangsung jauh sebelum lebaran
agar tidak terjadi penumpukan di terminal dan terkesan kekurangan sarana.
Separuh calon pemudik diperkirakan akan menggunakan bus.Dan 1/3 dari seluruh
pemudik Jakarta an sekitarnya diperkirakan menggunakan kereta api. Perusahaan bus sudah
mempersiapkan seluruh armadanya. Demikan pula dengan pemerintah. Selanjutnya lancar dan
tidaknya ditentukan oleh kedisiplinan bersama.
Contoh 2:
Puskesmas sangat menguntungkan bagi masyarakat, terutama bagi masyarakat di
pedesaan dan bagi masyarakat yang kurang mampu. Biaya pengobatan di puskesmas sangat
murah. Prosesnya pun mudah. Asalkan sudah mendaftarkan diri, pasien tinggal menunggu
panggilan untuk diperiksa. Pasien yang dapat ditangani di puskesmas bisa langsung pulang
setelah diperiksa dan diberi obat. Jika puskesmas tidak bisa menangani, pasien akan dirujuk
ke Rumah Sakit Daerah. Ia akan diberi pengantar atau surat rujukan untuk diperiksa di Rumah
Sakit Daerah.
Ringkasan teks di atas dapat berbentuk bagan, seperti di bawah ini.
Pelayanan di Puskesmas
Pasien datang Antri Obat pulang
Loket pendaftar
Rujukan ke Rumah
Ruang tunggu Ruang Periksa Sakit Daerah R.S. Daerah

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 256
Contoh 3:
Teks Pidato.

Bapak/Ibu guru yang saya hormati,
Dan teman-teman yang saya cintai.
Salam sejahtera,
Marilah kita memanjatkan puji syukur ke hadirat Tuhan Yang
Mahakuasa atas limpahan rahmat dan karunia-Nya kepada kita. Saya
sampaikan selamat datang dan terima kasih atas kehadiran teman-teman
dalam acara seminar pada pagi hari ini.
Seminar pada kesempatan ini mengambil tema masalah ketenaga
kerjaan. Penentuan tema ini dilatarbelakangi oleh makin maraknya sorotan
masyarakat terhadap masalah ketenagakerjaan. Sempitnya lapangan
kerja, meningkatnya pengangguran, dan masalah pekerja anak merupakan
contoh masalah ketenagakerjaan. Masalah ketenagakerjaan terebut dapat
menimbulkan dampak sosial yang negatif. Bahkan, dapat memunculkan
konfik-konfik sosial. Misalnya, masalah tingginya pengangguran yang
berdampak pada tingginya angka kriminalitas.
Masalah yang tidak kalah penting adalah masalah pekerja anak. Pekerja
anak sangat rentan terhadap eksploitasi. Banyaknya anak yang putus
sekolah menyebabkan meningkatnya jumlah anak yang terpaksa bekerja
membantu orang tua memenuhi kebutuhan hidup. Kondisi ekonomi yang
tidak baik mengharuskan mereka bekerja walaupun usia mereka belum
masuk usia kerja. Hal yang sangat memprihatinkan adalah adanya orang-
orang yang tidak bertanggung jawab yang memanfaatkan mereka sebagai
objek eksploitasi. Anak-anak itu disuruh bekerja dengan aturan yang tidak
tentu. Banyak pekerja anak yang tidak mendapatkan haknya selama bekerja.
Bahkan, ada juga yang mengalami kekerasan.
Tentu saja masalah tersebut menjadi keprihatinan kita bersama. Kita
harus melakukan suatu tindakan walaupun tindakan itu sangat sederhana.
Kita harus turut berupaya menghentikan eksploitasi anak mulai dari
lingkungan terdekat kita.
Semoga hasil seminar ini dapat menambah wawasan atau pengetahuan
kita mengenai masalah ketenagakerjaan, terutama masalah pekerja
anak. Saya berharap kita dapat termotivasi melakukan sesuatu untuk
257 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
meminimalisasi eksploitasi pekerja anak.
Demikianlah sambutan yang saya sampaikan. Saya mohon maaf jika
ada kesalahan. Atas perhatian teman-teman pada acara seminar ini, saya
ucapkan terima kasih.
Ringkasannya adalah sebagai berikut:
Pemberi sambutan menjelaskan bahwa tema seminar menyoroti
masalah ketenagakerjaan dari sempitnya lapangan kerja, pengangguran
hingga eksploitasi pekerja anak. Semua itu dapat menimbulkan dampak
sosial yang negatif termasuk tingginya angka kriminalitas.
Banyak penyebab yang menimbulkan adanya pekerja anak. Anak
dieksploitasi tanpa aturan yang tetap oleh orang yang tak bertanggung
jawab. Ada yang mendapat haknya, ada yang tidak.
Pemberi sambutan mengajak kita untuk melakukan tindakan untuk
meminimalisasi eksploitasi pekerja anak mulai dari lingkungan yang
terdekat.
D. Pengertian Simpulan
Menurut Kamus Besar Bahasa Indonesia, simpulan adalah sesuatu
yang disimpulkan; hasil menyimpulkan; kesimpulan. Simpulan juga
berarti kesudahan pendapat (pendapat terakhir yang berdasarkan uraian
sebelumnya) atau keputusan yang diperoleh berdasarkan metode berpikir
induktif dan deduktif.
Simpulan berbeda dengan ringkasan. Jika pada ringkasan penulis
tetap mempertahankan isi, sudut pandang, serta sistematika karya aslinya,
sedangkan dalam simpulan terdapat penilaian atau pendapat pembuat
simpulan. Oleh sebab itu, simpulan dapat dinyatakan benar, kurang benar,
atau salah.
Untuk dapat menarik simpulan yang benar, kita harus menggunakan
data, fakta, atau asumsi yang benar. Jika data, fakta, atau asumsinya tidak
akurat, hasil simpulannya juga tidak akan akurat.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 258
E. Pola Penalaran dalam Mengambil Simpulan
Dalam mengambil simpulan, digunakan pola penalaran deduktif dan
induktif.
1. Penalaran Deduktif
Pola ini diawali dengan mengemukakan pernyataan yang umum lalu
diikuti dengan pernyataan-pernyataan khusus. Penalaran deduktif
terdiri atas, tiga bentuk berikut.
a. Silogisme
Silogisme adalah proses pengambilan simpulan dengan mengungkap-
kan terlebih dahulu pernyataan yang bersifat umum (premis umum)
disusul dengan pernyataan khusus (premis khusus).
Contoh:
PU : Semua peserta ujian diwajibkan mengenakan atribut dan
seragam dari sekolah asalnya.
PK : Susi adalah salah seorang peserta ujian.
K : Susi wajib mengenakan atribut dan seragam sekolah asal.
b. Sebab-Akibat-Akibat
Pola ini diawali dengan pengungkapan fakta yang merupakan sebab,
lalu disusul dengan simpulan yang berupa akibat.
Contoh :
Masyarakat kita masih rendah tingkat kedisiplinannya. Dapat dilihat dari
kurang sadarnya menjaga kebersihan lingkungan. Masih banyak
penduduk yang membuang sampah di selokan dan di kali. Saat datang
musim hujan, aliran air di selokan dan kali tersumbat, tidak lancar.
Akhirnya, banjir melanda di mana-mana.
c. Akibat-Sebab-Sebab
Pola ini dimulai dengan pernyataan yang merupakan akibat, kemudian
ditelusuri penyebabnya.
Contoh:
Dua dari tiga remaja di kota-kota besar di Indonesia menurut penelitian,
pernah berpacaran. Separuh di antaranya telah terlibat pergaulan bebas.
Kebanyakan dari mereka terpengaruh oleh budaya Barat yang bebas.
259 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Mereka dengan serta-merta mengadopsinya dari tayangan-tayangan
flm di media elektronik. Ditambah lagi, pembinaan agama di rumah
maupun di sekolah sangat kurang.
2. Penalaran Induktif
Pola penalaran ini bermula dari pengungkapan hal-hal yang khusus,
kemudian ditarik suatu simpulan yang bersifat umum. Berikut adalah
pola-pola penalaran induktif.
a. Generalisasi
Generalisasi ialah pengambilan simpulan umum berdasarkan fakta dan
data yang bersifat khusus. Data dan fakta diperoleh melalui penilaian,
pengamatan, atau hasil survei.
Contoh:
Berdasarkan pengamatan yang dilakukan kepada SMA Teladan saat
mereka melaksanakan upacara, semua siswa memakai sepatu hitam dan
kaos kaki putih. Pakaian mereka putih-putih dan kemeja dimasukkan
ke dalam celana dan ke dalam rok, memakai ikat pinggang warna
hitam. Pakaian mereka dilengkapi dengan dasi dan topi abu-abu. Jadi
dapat dikatakan siswa SMA Teladan, pakaiannya seragam dan tertib sewaktu
mengikuti upacara.
b. Sebab-Sebab-Akibat
Pola ini dimulai dengan mengemukakan fakta-fakta yang menjadi
sebab, lalu ditarik simpulan yang merupakan akibat.
Contoh:
Hutan banyak ditebangi secara ilegal oleh oknum pengelola hutan.
Terjadi kebakaran hutan di mana-mana. Pengawasan terhadap hutan
lindung sangat lemah. Penduduk sekitar pun ikut-ikutan sampai
membuka ladang dengan menebangi hutan. Akibatnya, setiap datang
musim hujan , bencana longsor terjadi.
c. Akibat-Akibat-Sebab
Pola ini dimulai dengan mengungkapkan fakta-fakta yang merupakan
akibat lalu dikemukakan peristiwa yang menjadi penyebabnya.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 260
Contoh:
Ketika hujan, banjir melanda di mana-mana. Para penduduk mengungsi
di tempat yang tinggi. Mereka harus menunggu air surut kembali.
Ini disebabkan saluran air tersumbat oleh sampah yang dibuang warga
sembarangan.
d. Analogi
Analogi ialah pengambilan simpulan dengan mengambil kesamaan
dari suatu hal yang diperbandingkan. Biasanya dua hal atau lebih yang
dibandingkan dianggap memiliki kesamaan sifat dasarnya.
Contoh:
Seorang yang menuntut ilmu sama halnya dengan mendaki gunung. Sewaktu
mendaki, ada saja rintangan seperti jalan yang licin yang membuat
seseorang jatuh. Ada pula semak belukar yang sukar dilalui. Dapatkah
seseorang melaluinya? Begitu pula bila menuntut ilmu seseorang akan
mengalami rintangan seperti kesulitan ekonomi, kesulitan memahami
pelajaran, dan sebagainya. Apakah dia sanggup melaluinya ? Jadi,
menuntut ilmu sama saja halnya dengan mendaki gunung untuk mencapai
puncaknya.
RANGKUMAN
A. Pengertian Ringkasan
Ringkasan (precis) adalah suatu cara yang efektif untuk menyajikan
karangan yang panjang dalam sajian yang singkat. ”Precis” berarti
”memotong” atau ”memangkas”.
Ringkasan berbeda dengan ikhtisar, walaupun kedua istilah itu sering
disamakan, tapi sesungguhnya keduanya berbeda. Ringkasan merupakan
penyajian singkat dari suatu karangan asli namun tetap mempertahankan
urutan isi dan sudut pandang pengarang asli. Sedangkan ikhtisar sebaliknya,
tidak perlu mempertahankan sistematika penulisan sesuai dengan aslinya
dan tidak perlu menyajikan isi dari seluruh karangan itu secara proporsional.
Dalam ikhtisar, penulis dapat langsung mengemukakan pokok uraian,
sementara bagian yang dianggap kurang penting dapat dibuang.
261 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
B. Cara Membuat Ringkasan
Ada beberapa cara yang dapat diadikan pegangan dalam membuat
ringkasan yang baik dan teratur, yaitu membaca naskah asli, mencatat
gagasan utama, membuat reproduksi, dan ketentuan tambahan.
C. Beberapa Contoh Bentuk Ringkasan
Ringkasan dapat disusun dalam dua bentuk, yaitu bentuk verbal
atau uraian (paragraf) dan bentuk nonverbal berupa bagan atau skema.
Meskipun ringkasan dalam bentuk bagan atau skema tetapi harus
mencerminkan gagasan seperti yang diungkapkan oleh teks sumbernya.
Sebelum membuat bagan atau skema, harus dicatat terlebih dulu butir-
butir informasi yang akan diadikan unsur-unsur bagan atau skema.
D. Pengertian Simpulan
Menurut Kamus Besar Bahasa Indonesia, simpulan adalah sesuatu
yang disimpulkan ; hasil menyimpulkan ; kesimpulan. Simpulan juga
berarti kesudahan pendapat (pendapat terakhir yang berdasarkan
uraian sebelumnya) atau keputusan yang diperoleh berdasarkan metode
berpikir induktif dan deduktif.]
E. Pola Penalaran dalam Mengambil Simpulan
Dalam mengambil simpulan digunakan pola penalaran deduktif dan
induktif. Penalaran deduktif terdiri atas silogisme, sebab-akibat-akibat,
dan akibat-sebab-sebab.
Pola penalaran
Bermula dari pengungkapan hal-hal yang khusus, kemudian ditarik
suatu simpulan yang bersifat umum. Yang termasuk pola penalaran
induktif ialah generalisasi, sebab-sebab-akibat, akibat-akibat-sebab, dan
analogi.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 262
TUGAS MANDIRI
1. Bacalah wacana berikut, kemudian buatlah ringkasannya!
Angka mengulang kelas di tingkat SMA relatif kecil, dari tahun
ke tahun mengalami perbaikan. Pada tahun 2004, angka tersebut
0,88% untuk SMA swasta dan 0,85% untuk SMA negeri, berkurang
menjadi 0,36% untuk SMA swasta dan 0,23% untuk SMA negeri pada
2005. Besar dan trend angka mengulang kelas antara SMA negeri dan
swasta relatif sama. Ini menunjukkan mutu pelayanan yang relatif
seimbang antara SMA negeri dengan swasta.
Berbeda halnya dengan apa yang terjadi di SMK. Walaupun
angka ini relatif kecil, pada tahun 2004 ada 756 atau 1,41% siswa
SMK swasta mengulang. Sementara di tahun yang sama, siswa
SMK negeri yang mengulang hanya 0,49% atau 575 orang.. Berkat
kegigihan semua pihak khususnya jajaran pengelola SMK swasta, di
tahun 2005 kesenjangan tersebut dapat ditekan menjadi 0,36% untuk
SMK swasta dan 0,22% untuk SMK negeri. Walaupun demikian dari
angka tersebut, masih memperlihatkan kesenjengan mutu antara
SMK negeri dan swasta yang harus dikikis.
2. Bacalah paragraf di atas, kemudian buatlah ringkasannya dalam
bentuk skema atau bagan!
3. Buatlah simpulan paragraf tersebut secara induktif!
4. Buatlah contoh simpulan dengan pola penalaran deduktif :
a. silogisme
b. sebab-akibat-akibat
c. akibat-sebab-sebab
5. Buatlah contoh simpulan dengan pola penalaran induktif:
a. generalisasi
b. sebab-sebab-akibat
c. akibat-akibat-sebab

263 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Di bawah ini pernyataan yang berkaitan dengan ringkasan, kecuali
a. Ringkasan berasal dari kata precis yang artinya memotong.
b. Ringkasan berisi hal-hal pokok dari karangan panjang.
c. Ringkasan berbeda dengan ikhtisar.
d. Ringkasan tidak perlu mengikuti urutan isi sumber aslinya.
e. Ringkasan merupakan suatu penyajian singkat dan suatu karangan
aslinya.
2. Di bawah ini pernyataan yang berkaitan dengan ikhtisari, ialah
a. Ikhtisar berarti memangkas.
b. Ikhtisar tetap mempertahankan urutan isi wacana aslinya.
c. Ikhtisar tidak perlu mempertahankan urutan isi karangan asli.
d. Ikhtisar merupakan penyajuan berisi pandangan pembuat
ikhtisar.
e. Ikhtisar pada prinsipnya sama dengan ringkasan.
3. Yang bukan merupakan cara membuat ringkasan yang baik adalah
a. membaca naskah asli
b. menggunakan interpretrasi pengarang
c. mencatat gagasan pokok
d. membuat reproduksi
e. menggunakan kalimat tunggal daripada kalimat majemuk
4. Hal yang perlu dilakukan oleh pembuat ringkasan ialah membaca
naskah asli secara keseluruhan, maksudnya adalah berikut ini, kecuali
a. mendapatkan kesan umum
b. menangkap maksud pengarang
c. memahami sudut pandang
d. menghafal beberapa kalimatnya
e. menangkap gagasan pokoknya
5. Penulis ringkasan setelah mencatat gagasan pokok, akan melakukan
reproduksi, maksudnya
a. menulis kembali naskah drama
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 264
b. menyusun kembali karangan singkat berdasarkan gagasan yang
diperoleh
c. membuat kerangka karangan
d. menyusun karangan dari kerangka yang dibuat
e. mencatat ide-ide pokok naskah asli
6. Ketika rumah tetangganya terbakar, ia sedang tertidur pulas.
Kalimat singkat dari kalimat majemuk di atas adalah
a. rumahnya terbakar saat ia tidur
b. ia tidur pulas dan tetangganya terbakar
c. ia tidur pulas di tengah kebakaran
d. ia tertidur ketika kebakaran terjadi
e. tetangganya terbakar tetapi ia tertidur pulas
7. Di bawah ini yang bukan kalimat majemuk adalah
a. Anita remaja yang sukses karena pandai dan disiplin.
b. Perusahaan itu maju karena seluruh karyawannya rajin bekerja.
c. Air Sungai Ciliwung itu meluap setelah Kota Bogor diguyur
hujan.
d. Karena tidak pernah disiram, bunga itu mati.
e. Siswa SMK wajib mengikuti ujian praktik.
8. Kalimat berikut yang merupakan kalimat tunggal ialah
a. Amin tidak mengikuti praktik bahasa hari ini.
b. Bapak pergi haji setelah tanahnya di kampung terjual.
c. Adi dihukum Pak Guru ketika teman-temannya mengikuti
pelajaran olahraga.
d. Presiden melakukan reshufe kabinet agar kinerja menteri bisa
lebih efektif.
e. Pilkada itu rusuh karena seorang profokator membakar emosi
massa.
9. Di bawah ini adalah hal-hal yang perlu dilakukan dalam membuat
ringkasan, kecuali
a. kalimat dirigkas menjadi frasa
b. frasa disingkat menjadi kata
c. gagasan panjang menjadi gagasan sentral saja
d. bila perlu kata keterangan atau kata sifat dibuang
e. mengubah kata menjadi imbuhan
265 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
10. Sebelum melakukan wawancara perlu disiapkan pokok-pokok
pertanyaan, buku catatan, alat tulis dan alat perekam.
Untuk meringkas kalimat di atas yang perlu diringkas adalah
a. kata sebelum
b. kata pokok-pokok menjadi pokok
c. kata buku catatan sampai alat perekam menjadi berbagai
perlengkapan yang diperlukan
d. kata alat perekam dihilangkan
e. kata buku catatan menjadi buku tulis
11. Kalangan partai politik mengusulkan agar menteri-menteri yang
bermasalah diganti dalam perombakan kabinet yang dilakukan awal
Mei mendatang.
Kalimat di atas dapat diringkas dengan menghilangkan kata-kata di
bawah ini, kecuali
a. kalangan
b. politik
c. awal
d. yang dilakukan
e. menteri jadi para menteri
12. Kalimat di bawah ini yang menggunakan kata-kata berlebihan ialah
a. Bapak dan Ibu harap berdiri.
b. Para siswa-siswa mendafar ke sekolah baru.
c. Petani di desa Kulonprogo memprotes kenaikan harga gabah.
d. Pelajaran matematika dimulai pukul tujuh.
e. Manajemen perusahaan itu memang rapi.
13. Kepolisian Resor Aceh Timur membenkuk enam anggota kelompok
bersenjata di rumah milik Andi Wahyudi di Desa Kabu, Kecamatan
Peireulak Barat, pada Sabtu malam lalu. Penggerebekan itu diwarnai
aksi saling tembak menembak antara polisi dan anggota-anggota
kelompok bersenjata tersebut.
Kata yang harus dihilangkan pada kalimat kedua adalah
a. itu
b. aksi
c. saling
d. anggota
e. c dan d
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 266
14. Ide pokok paragraf soal nomor 13 di atas ialah
a. penggerebekan polisi di Aceh
b. polisi membekuk kelompok bersenjata
c. polisi terlihat aksi tembak-menembak
d. polisi melawan kelompok bersenjata
e. peristiwa bersenjata di Aceh
15. Untuk meringkas kalimat pertama pada soal nomor 13 yang perlu
dilakukan adalah
a. kata bilangan
b. kata depan
c. keterangan tempat disingkat
d. nama orang dihilangkan
e. keterangan waktu dihilangkan
16. Yang merupakan keterangan tempat pada paragraf di atas adalah
a. Kecamatan Pereulak Barat
b. Andi Wahyudi
c. membekuk
d. Sabtu malam lalu
e. kelompok bersenjata
17. Yang merupakan keterangan waktu pada paragraf di atas adalah
a. Kecamatan Pereulak Barat
b. Andi Wahyudi
c. membekuk
d. Sabtu malam lalu
e. kelompok bersenjata
18. Ringkasan paragraf di atas adalah
a. Polisi bertarung dengan enam kelompok bersenjata di Aceh
Timur.
b. Enam anggota bersenjata dibekuk polisi Aceh timur.
c. Polisi membekuk kelompok bersenjata di Aceh Timur malam Sabtu
lalu.
d. Polisi tembak-menembak dengan kelompok bersenjata di Aceh
Timur, malam lalu.
267 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
e. Kepolisian Aceh Timur, Sabtu lalu membekuk kelompok bersenjata
setelah aksi saling tembak.
19. Saudara-saudara,
Pada pertemuan ini saya mengajak Anda semua untuk membantu
korban bencana alam di daerah kita.
Yang perlu diubah pada penggalan pidato di atas dalam rangka
meringkas ialah
a. menghilangkan kata Saudara
b. mengganti membantu jadi memberi bantuan
c. menghilangkan kata korban
d. mengganti kata “saya” dengan kata ganti orang ketiga
e. mengajak menjadi meminta
20. Ringkasan pidato di atas adalah
a. Pemberi pidato mengajak hadirin untuk membantu beban korban
bencana di daerahnya.
b. Ria mengajak orang-orang untuk membantu korban bencana.
c. Pemberi pidato membantu korban bencana alam.
d. Dia akan membantu korban bencana alam bersama hadirin.
e. Hadirin diajak olehnya untuk membantunya dari bencana alam.
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Jelaskan pengertian ringkasan?
2. Apa perbedaan ringkasan dengan ikhtisar?
3. Buatlah ringkasan dari wacana di atas!
4. Sebutkan aturan tambahan dalam membuat ringkasan!
5. Hal apa saja yang harus dipangkas dalam membuat ringkasan!
6. Apa yang dimaksud dengan reproduksi?
7. Buatlah ringkasan dari sebuah pidato sambutan!
8. Berikan contoh menjadikan kalimat majemuk menjadi kalimat tunggal!
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 268
9. “Semua siswa-siswi diwajibkan membawa alat kebersihan besok.”
Perbaikilah kalimat ini sehingga menjadi efektif!
10. Carilah sebuah paragraf ekspositoris, lalu buatlah ringkasannya!

269 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini!
1. Sebuah komunikasi dapat efektif bergantung pada beberapa hal di
bawah ini, kecuali
a. situasi pembicaraan
b. usia penuturnya
c. hubungan antarpelaku bicara
d. waktu pembicaraan
e. tempat dilakukan komunikasi
2. Di bawah ini contoh ungkapan memulai percakapan formal, kecuali
a. Assalamu’alaikum
b. Selamat pagi pemirsa
c. Sampai nanti dalam acara yang sama
d. Selamat malam di mana saja Anda berada
e. Salam sejahtera untuk semua

3. Ucapan membalas acara dalam situasi formal ialah
a. Setelah ini kita dengarkan beberapa sambutan
b. Acara selanjutnya yaitu .....
c. Bapak dan Ibu kami minta duduk kembali
d. Para hadirin yang dimulaikan, selamat siang.
e. Halo, apa kabar semua?
4. Membuka acara pada situasi semiformal di bawah ini, kecuali
a. Halo teman-teman semua
b. Selamat datang para undangan
c. Hai semuanya apa kabar?
d. Buat kamu-kamu, selamat pagi .....
e. Selamat jumpa di mana saja kamu berada
5. Di bawah ini yang merupakan pembuka percakapan melalui telepon,
yaitu
a. Halo semua, apa kabar?
b. Gimana nih kabarnya elu-elu pada?
c. Halo Rina, gimana kabarnya?
TES SEMESTER GENAP
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 270
d. Selamat pagi para pemirsa semua!
e. Di mana saja Anda berada salam jumpa !
6. Yang bukan tugas notulis ialah
a. mencacat jalannya diskusi
b. mencacat hasil diskusi
c. mencacat jumlah peserta
d. mencatat waktu dan tempat berlangsungnya diskusi
e. menilai peserta aktif dan pasif
7. Yang merupakan tugas peserta ialah berikut ini, kecuali
a. mengikuti tata tertib diskusi
b. mengajukan pertanyaan
c. turut menjaga kelancaran diskusi
d. memperkenalkan diri
e. menjaga sikap agar tidak emosional
8. Kalimat simpulan diskusi yang baik adalah
a. Para peserta diskusi hendaknya menyetujui simpulan ini.
b. Mengingat suara terbanyak, diskusi ini saya simpulkan.
c. Sebaiknya para peserta diskusi menyadari bahwa simpulan ini
adalah milik bersama.
d. Hendaknya Saudara paham bahwa setiap ceklis diskusi ada
simpulan.
e. Sebelum diskusi ini berakhir, akan kami bacakan beberapa
simpulan.
9. Kalimat sanggahan yang tepat sesuai dengan santun diskusi terdapat
pada kalimat
a. Saya tidak sependapat dengan jalan pikiran Saudara dan itu semua
tedak perlu diwujudkan.
b. Pendapat Saudara belum jelas, mohon diulang kembali dan
dielaskan sekali lagi.
c. Saya tidak menyetujui pendapat apalagi Saudara sendiri tidak
bersedia diadikan pengurus.
d. Saya kurang sependapat dengan jalan pikiran Saudara dan apa
yang dikemukakan tadi mohon ditinjau kembali.
e. Saya tidak menerima pendapat yang Saudara ajukan itu, kecuali
semua peserta dapat menerima usulan Saudara.
271 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
10. Di bawah ini ciri gagasan yang kreatif, kecuali
a. sebuah hal yang baru
b. sesuai realita
c. memiliki kualitas arti
d. berbobot
e. menginspirasikan gagasan lain
11. Sebuah rumusan yang merupakan acuan untuk pelaksanaan sebuah
pekerjaan/kegiatan disebut
a. jadwal kerja
b. agenda kerja
c. program kerja
d. pedoman kerja
e. hasil kerja
12. Program kerja harus memiliki sifat di bawah ini, kecuali
a. realitas
b. sensatif
c. iplementatif
d. ekonomis
e. logis
13. Sebuah program kerja harus bersifat realitis, maksudnya
a. sesuai dengan keadaan
b. sesuai dengan harapan
c. dapat dipertanggungjawabkan
d. dapat diwujudkan secara nyata
e. dapat menghasilkan uang
14. Negosiasi mengupayakan agar sebuah program kerja atau usulan tidak
dibuat seperti di bawah ini, kecuali
a. diterima
b. direvisi
c. diganti
d. ditolak
e. ditinjau ulang
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 272
15. Di bawah ini adalah ungkapan mempertahankan sebuah pendapat
atau rencana kegiatan
a. Saya sependapat dengan Anda.
b. Saya menyetujui kerja itu.
c. Saya kira rencana-rencana itu harus ditolak.
d. Rencana kegiatan ini mudah dilaksanakan layak untuk
diprogramkan.
e. Saya mendukung rencana kerja tersebut.
16. Dalam diskusi tentang ”Narkoba”, seseorang peserta mempertahankan
pendapatnya. Ungkapan yang santun ialah
a. Saudara-saudara, semua tahu kan narkoba sangat merugikan oleh
sebab itu harus dicegah.
b. Saudara-saudara harus paham dong, kegiatan narkoba oke banget!
c. Saudara-saudara harus maklum, narkoba kan mesti kita berantas!
d. Saudara-saudara, kegiatan penyuluhan narkoba perlu kita lakukan
sebab memiliki efek yang positif untuk mencegah penggunaan
narkoba.
e. Saudara-saudara, kalau kegiatan ini ditolak berarti saudara semua
bandar narkoba.
17. Seseorang yang telah selesai melaksanakan sebuah tugas diminta untuk
membuat
a. notuler c. proposal
b. laporan d. ringkasan
e. jadwal
18. Laporan dapat dibuat atau disampaikan secara
a. lisan c. a dan b benar
b. tulisan d. a, b dan c benar
e. ringkasan
19. Laporan dapat diadikan bahan acuan membuat hal di bawah ini,
kecuali
a. kebiakan c. pemikiran
b. tindakan d. penilaian
e. penghargaan
273 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
20. Dari segi materi laporan bersifat berikut, kecuali
a. lengkap c. faktual
b. akurat d. objektif
e. persuasif
21. Penyampaian laporan harus seperti di bawah ini
a. menarik c. tepat
b. jelas d. mendalam
e. sistematik
22. Salah satu bentuk laporan lisan ialah
a. laporan kunjungan
b. laporan berita
c. laporan tugas
d. laporan perjalanan
e. laporan observasi
23. Yang dimaksud laporan harus faktual adalah
a. apa adanya
b. didukung oleh data yang valid
c. sesuai dengan realita
d. berkaitan dengan hal yang baru terjadi
e. diterima oleh semua pihak
24. Suasana benar-benar kacau balau. Beberapa orang melompat ke tepi
dan tercebur ke kali. Beberapa perahu yang lepas tampak melaju
menuju hilir. Yang lainnya menyusul, sementara teriakan menanti
terdengar riuh sekali. Begitu saja keadaan terjadi. Arus deras dari
kampar-kampar menyerbu dari hulu membantu sampan-sampan itu
ke hilir. Sementara gemuruh kapal dari hilir makin mendekat, tetapi
gemuruh dan gemertak api yang datang dari hulu lebih seru. Lengking
suara orang dan tabuhan gong, menandakan tibanya petaka. Asap
yang mengepul hitam legam jelas menunjukkan bahwa sedang terjadi
kebakaran.
Paragraf tersebut termasuk wacana berjenis...
a. narasi
b. persuasi
c. deskripsi
d. eksposisi
e. argumentasi
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 274
25. Perhatikan kerangka karangan berikut.
(1) Teknologi sudah diketahui, tetapi belum dimanfaatkan
(2) Turbin yang berputar akan mengalirkan energi listrik sebesar 60
megawat
(3) Uap panas itu disalurkan ke turbin.
(4) Itu yang terjadi di Amerika Serikat, dan lain lagi di Indonesia.
Kerangka karangan di atas termasuk berbentuk
a. kerangka karangan kalimat
b. kerangka karangan topik
c. kerangka karangan ide pokok
c. kerangka karangan imajinatif
d. kerangka karangan naratif
26. Dalam kehidupan pribadi, disiplin berarti peraturan yang dibuat
untuk diri sendiri yang tidak bertentangan dengan peraturan umum.
Bangun dan melakukan sesuatu tepat pada waktunya. Hadir dalam
suatu acara pada waktu yang ditetapkan, atau melakukan tugas dan
kewajiban dengan tepat dan tertib hanya dapat tercapai kalau ada
disiplin pribadi.
Pengembangan paragraf di atas menggunakan pola
a. persuasi
b. eksposisi
c. argumentasi
d. narasi
e. deskripsi
27. Karangan deskripsi yang menggambarkan objek benda sesuai kesan
atau imajinasi si penulis disebut
a. narasi
b. deskripsi
c. narasi faktual
d. deskripsi impresionistis
e. argumentasi

28. Di bawah ini bentuk karangan ekspositoris, kecuali
a. biograf
b. otobiograf
275 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
c. roman
d. kisah perjalanan
e. peristiwa kejahatan
29. Di bawah ini pernyataan yang berkaitan dengan ringkasan, kecuali
a. Ringkasan berasal dari kata precis yang artinya memotong.
b. Ringkasan berisi hal-hal pokok dari karangan panjang.
c. Ringkasan berbeda dengan ikhtisar.
d. Ringkasan tidak perlu mengikuti urutan isi sumber aslinya.
e. Ringkasan merupakan suatu penyajian singkat dan suatu karangan
aslinya.
30. Di bawah ini pernyataan yang berkaitan dengan ikhtisar ialah
a. Ikhtisar berarti memangkas/
b. Ikhtisar tetap mempertahankan urutan isi wacana aslinya.
c. Ikhtisar tidak perlu mempertahankan urutan isi karangan asli.
d. Ikhtisar merupakan pengajuan berisi pandangan pembuat
ikhtisar.
e. Ikhtisar pada prinsipnya sama dengan ringkasan.
31. yang bukan merupakan cara membuat ringkasan yang baik adalah
a. membaca naskah asli
b. menggunakan interpreterasi pengarang
c. mencatat gagasan pokok
d. membuat reproduksi
e. menggunakan kalimat tunggal daripada kalimat majemuk.
32. Hal yang perlu dilakukan oleh pembuat ringkasan ialah membaca
naskah asli secara keseluruhan, maksudnya adalh berikut ini, kecuali
a. mendapatkan kesan umum
b. menangkap maksud pengarang
c. memahami sudut pandang
d. menghapal beberapa kalimatnya
e. menangkap gagasan pokoknya
33. Penulis ringkasan setelah mencatat gagasan pokok, akan melakukan
reproduksi, maksudnya
a. menulis kembali naskah drama
b. menyusun kembali karangan singkat berdasarkan gagasan yang
diperoleh
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 276
c. Membuat kerangka karangan
d. Menyusun karangan dari kerangka yang dibuat
e. Mencatat ide-ide pokok naskah asli
34. Ketika rumah tetangganya terbakar, ia sedang tertidur pulas.
Kalimat singkat dari kalimat majemuk di atas adalah
a. Rumahnya terbakar saat ia tidur.
b. Ia tidur pulas dan tetangganya terbakar.
c. Ia tidur pulas ditengah kebakaran.
d. Ia tertidur ketika kebakaran terjadi.
e. Tetangganya terbakar tetapi ia tertidur pulas.
35. Penyajian simpulan yang berawal dengan fakta berupa akibat dan
diakhiri dengan uraian berupa akibat-akibatnya disebut
a. silogisme
b. generalisasi
c. analogi
d. deduktif sebab-akibat
e. deduktif akibat-sebab
36. Penyajian simpulan secara umum yang bersumber dari fakta dan data
hasil pengamatan dan survei disebut
a. silogisme
b. generalisasi
c. analogi
d. deduktif sebab-akibat
e. deduktif akibat-sebab
37. Simpulan yang disajikan dari perbandingan dua hal yang memiliki
berbagai kesamaan disebut
a. silogisme
b. generalisasi
c. analogi
d. deduktif sebab-akibat
e. deduktif akibat-sebab
38. Pola simpulan yang dimulai dengan mengungkapkan fakta-fakta
berupa sebab dan diakhiri dengan pernyataan akibat disebut
a. induktif : sebab-akibat
277 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
b. induktif : akibat-sebab
c. deduktif : sebab-akibat
d. deduktif : akibat-sebab
e. generalisasi
39. Pola simpulan yang dimulai dengan pengungkapan berupa akibat-
akibat dan diakhiri dengan peristiwa yang menjadi sebab disebut
a. induktif : sebab-akibat
b. induktif : akibat-sebab
c. deduktif : sebab-akibat
d. deduktif : akibat-sebab
e. generalisasi
40. - Semua orang yang ingin sukses harus belajar dan berdoa.
- Tuti ingin sukses.
Simpulannya adalah
a. Tuti harus belajar.
b. Tuti harus berdoa.
c. Tuti harus sukses.
d. Tuti harus belajar dan berdoa.
e. Tuti akan sukses karena belajar.
II. Jawablah soal-soal di bawah ini dengan tepat dan benar!
1. Buatlah tiga contoh ungkapan salam pembuka dalam percakapan
formal.
2. Buatlah tiga contoh ungkapan pembuka dalam percakapan
nonformal.
3. Sebutkan jenis-jenis diskusi.
4. Sebutkan unsur-unsur diskusi.
5. Pertimbangan apa yang harus dikemukakan agar pendapat kita
diterima?
6. Untuk apa seseorang melakukan negosiasi?
7. Jelaskan pengertian laporan.
8. Jelaskan pengertian wacana deskripsi.
9. Apa perbedaan ringkasan dan ikhtisar?
10. Sebutkan yang termasuk pola penyajian deduktif.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 278
DAFTAR PUSTAKA
Berita Kota, Januari 2008
Dewanto, Nugroho. 2005. Kamus Sinonim-Antonim Bahasa Indonesia.
Bandung: Yrama Wiaya
Finoza, Lahmudin. 2006. Komposisi Bahasa Indonesia. Jakarta: Diksi Insan
Mulis.
Intisari, No. 528, Juli 2007
Intisari, No. 505, Agustus 2005
Komaruddin, Erien dan Atih Supriatih. 2005. Panduan Kreatif Bahasa
Indonesia. Jakarta: Yudhistira
Kompas, 18 November 2007.
Kompas, 24 November 2007.
Kompas, 02 Desember 2007.
Majalah Hobi Ikan + Mancing, Januari 2003.
Media Kominfo Mandikdasmen, November 2006.
Media Akademika, Edisi Mei, No. 01/2005.
Media Jaya, Tahun XXXI-Edisi 05-2007.
Murbandono Hs.,L. (ed.). 2003. Puisi Rakyat Merdeka. Jakarta: Grasindo.
Parera, J.D.2003. Belajar Mengemukakan Pendapat. Jakarta: Erlangga.
Priyantono, Agus dan Rustamaji. 2004. Strategi Sukses UAN SMA / MAN
Bahasa Indonesia. Yogyakarta: Andi.
Redaksi Lima Adi Sekawan. 2007. EYD Plus. Jakarta: Limas.
Republika, 10 Juni 2007.
Rumadi, A. (ed.).2004. Kumpulan Drama Remaja. Jakarta: Grasindo.
Sugono, Dendy (ed.). 2003. Buku Praktis Bahasa Indonesia 1 dan 2. Jakarta:
Pusat Bahasa Depdiknas.
Tim MGMP Bahasa Indonesia SMK DKI Jakarta. 2005. Modul Bahasa Indonesia.
Jakarta: Dinas Dikmenti Sub Dinas Pendidikan SMK. Provinsi DKI
Jakarta.
279 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
Tim LP2IP. 2006. Bahasa Indonesia untuk SMK Tataran Semenjana I B.
Yogyakarta: LP2IP Gajah Mada.
--------------2006. Bahasa Indonesia untuk SMK Tataran Madia Jilid. II A dan II B.
Yogyakarta: LP2IP Gajah Mada.
Tim Bahasa. 2006. Modul Bahasa Indonesia. Jakarta: Yudhistira.
Tim Bahasa dan Sastra Indonesia SMK. 2005. Modul Bahasa Indonesia untuk
SMK Tingkat XI. Jakarta : PT. Galaxy Puspa Mega.
Tim Bahasa dan Sastra Indonesia. 2005 Pelajaran Bahasa dan Sastra Indonesia.
Jakarta: Yudhistira
Tim Penyusun. 2003. Satu Bahasa Bahasa Indonesia. Kelas 2 dan 3 SMK. Klaten:
Saka Mitra Kompetensi.
Tim Pengurus Primagama. 2006. Kiat Sukses Ujian Nasional 2007 SMK.
Yogyakarta: Andi.
Tim Redaksi. 2007. Kamus Besar Bahasa Indonesia. Jakarta : Balai Pustaka
Tunas, Edisi 05. 17-30 November 2007.
Wira Usaha dan Keuangan. Ed. 049/12/Th. VI, April 2007.
Wira Usaha dan Keuangan. Ed. 057/20/Th. VII, Desember 2007.

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 280
GlOSARIUM
abstrak Tidak terwujud; tidak berbentuk; mujarad; niskala.
antonim Kata yang berlawanan makna dengan kata lain.
asimilasi Perubahan bunyi konsonan akibat pengaruh konsonan yang berdekatan.
biografi Riwayat hidup (seseorang) yang ditulis oleh orang lain.
deduktif Bersifat deduksi.
dialek Variasi bahasa yang berbeda-beda menurut pemakai (bahasa dari suatu
daerah tertentu, kelompok sosial tertentu, atau kurun waktu tertentu).
ektensif Bersifat menjangkau secara luas.
fiksi Rekaan; khalayan; tidak berdasarkan kenyataan.
frasa Gabungan dua kata atau lebih yang bersifat nonpredikatif.
generalisasi Perihal membentuk gagasan atau simpulan umum dari suatu kejadian dan hal.
hierarki Urutan tingkatan atau jenjang jabatan (pangkat kedudukan).
hiponim Hubungan antara makna spesifik dan makna generik atau antara anggota
taksonomi dan nama taksonomi.
ideologi Kumpulan konsep bersistem yang dijadikan asas pendapat (kejadian) yang
memberikan arah dan tujuan untuk kelangsungan hidup.
implementatif Pelaksanaan; penerapan.
induktif Bersifat (secara) induksi.
inovatif Bersifat memperkenalkan sesuatu yang baru; bersifat pembaharuan (kreasi
baru).
institusi Sesuatu yang dilembagakan oleh undang-undang, adat, atau kebiasaan.
instruksi Perintah atau arahan (untuk melakukan suatu pekerjaan atau melaksanakan
suatu tugas).
konflik Percekcokan; perselisihan; pertentangan.
kontemporer Pada waktu yang sama; semasa; sewaktu; pada masa kini; dewasa ini.
logis Sesuai dengan logika; benar menurut penalaran; masuk akal.
moderator Orang yang bertindak sebagai penengah.
motivasi Dorongan yang timbul pada diri seseorang secara sadar atau tidak sadar untuk
melakukan suatu tindakan dengan tujuan tertentu.
GLOSARIUM
281 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
numeralia Kata (frasa) yang menunjukkan bilangan atau kuantitas; kata bilangan.
notulis Orang yang bertugas membuat notula (catatan rapat).
objektif Mengenai keadaan yang sebenarnya tanpa dipengaruhi pendapat atau
pandangan pribadi.
plagiat Pengambilan karangan (pendapat) orang lain dan menjadikannya seolah-olah
karangan (pendapat) sendiri.
proposal Rencana yang dituangkan dalam bentuk rancangan kerja.
prosedur Tahap kegiatan untuk menyelesaikan suatu aktivitas.
rasional Menurut pikiran dan pertimbangan yang logia; menurut pikiran yang sehat;
cocok dengan akal.
relevan Kait-mengait; bersangkut-paut; berguna secara langsung.
representasi Perbuatan mewakili; keadaan diwakili; apa yang mewakili; perwakilan.
respon Tanggapan; reaksi; jawaban.
retorika Keterampilan berbahasa secara efektif.
revisi Peninjauan (pemeriksaan) kembali untuk perbaikan
silogisme Bentuk, cara berpikir atau menarik simpulan yang terdiri atas premis umum,
premis khusus, dan simpulan.
simposium Pertemuan dengan beberapa pembicara yang mengemukakan pidato singkat
tentang topik tertentu atau tentang beberapa aspek dari topik yang sama.
sinonim Bentuk bahasa yang maknanya mirip dengan atau sama dengan bentuk
bahasa lain; muradif.
solidaritas Sifat (perasaan) solider; sifat satu rasa (senasib); perasaan setia kawan
antara sesama anggota yang diperlukan.
toleran Bersifat atau bersikap menenggang (menghargai, membiarkan, membolehkan)
pendirian ( pendapat, pandangan, kepercayaan, kebiasaan, dan kelakuan)
yang berbeda atau bertentangan dengan pendirian sendiri.
topik Pokok pembicaraan di diskusi, ceramah, dan karangan.
valid Menurut cara yang semestinya.
verba Kata yang menggambarkan proses, perbuatan, atau keadaan; kata kerja.
voting Keputusan dengan pengambilan suara terbanyak.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 282
INDEKS
A
A. Rafq 100
AIDS 2
aktif 160
anakan 113
analitis 176
animator 13
antarmakna 74
antiklimaks 236
antonim 74
Asian Games 250

B
bagan 9
bangkit 155
batik 131
BBM 186
bengkel 155
biodiesel 186
biograf 224
buah naga 220

C
Cisolok 208

D
dampak 172
deduktif 16
denah 10
deskripsi 206
dialog 118
dialog 137
diskusi 134
diskusi panel 134
disposisi 50
dokumentasi 204

E
edelweisj 227
efektif 223
ekonomi 172
eksekutif 212
eksperimen 210
eksploitasi 256
eksposisi 234
ekspositoris 206
ekspresif 204
ekstensif 5
epidemi 2
F
faktual 232
fokus 192
formal 205
formulir 204
frasa 78

G
gagasan 176
gagasan utama 253
gasohol 186
gaya bahasa 63
gebyar 130
global 172
grafk 6
grafk garis 7
grafk lingkaran 7

H
hiponim 76
HIV 3

I
idiomatik 73
ikhtisar 252
impresionis 230
Indeks kls XI
induktif 16
informal 205
informasi 93
intensif 5
intonasi 137
izin bangunan 233

J
jadwal 32
jadwal kerja 33
jago dayung 251

K
kalimat tanya tersamar 97
kamus 77
karir 26
kata benda 66
kata dasar 68
kata kerja 64
kata keterangan 65
kata sifat 65
kata tugas 67
kata turunan 70
kelas kata 63
keparalelan 83
kerangka topik 223
khasiat 220
khayal 224
KIR 192
klarifkasi 96
klasifkasi 63
klausa 5
kompos 221
konferensi 134
kongres 134
konotatif 72
kredit 42
kronologis 122

L
logis 176

M
manual 51
Marlioboro 202
mas koki 112
matriks 11
memo 48
mimik 137
mini market 155
moderator 177
modifkasi 155

N
narasi 206
narkoba 2
nasi kucing 202
negosiasi 188
nonverbal 4
notulis 175

O
objek 232
oposisi 75
OSIS 32
OSIS 189
otobiograf 224

P
pakem 130
pamiahan 112
parafrasa 114
patok 202
pemrasaran 174
pengumuman 47
283 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI
percakapan 156
perintah 44
peta 9
pola contoh 121
pola gilir 132
pola penyajian 206
pola proses 121
program 93
program kerja 189
proporsional 192
proposal 32
prosa 116
proses 4
psikomotorik 191
puskemas 255

R
reproduksi 253
respon 31
retorik 95
ringkasan 252
ritual 62

S
sampah plastik 62
santun 190
sarasehan 134
seminar 134
seting 118
simposium 134
simpulan 177.178
sinonim 74
sistematis 176
skema 254
surat 45

T
tabel 233
tabulampot 222
tahapan 135
teks 254
tema 225
Tulung Agung 112

U
ungkapan 163
usaha 154

V
verbal 11
visual 11
volume 221
voting 178

W
wacana 115
wacana 222

Bahasa Indonesia 2
Untuk SMK/MAK Semua Program Kejuruan Kelas XI

Mokhamad Irman Tri Wahyu Prastowo Nurdin

Pusat Perbukuan Departemen Pendidikan Nasional
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

i

Hak Cipta ada Pada Departemen Pendidikan Nasional

Dilindungi Undang-undang

Bahasa Indonesia 2
Untuk SMK/MAK Semua Program Kejuruan Kelas XI

Penulis

: Mokhamad Irman
Tri Wahyu Prastowo Nurdin

Ukuran Buku : 17,6 x 25 cm

410 IRM b

IRMAN, Mokhamad Bahasa Indonesia 2 : untuk SMK/MAK Semua Program Keahlian Kelas XI/Mokhamad Irman, Tri Wahyu Prastowo, Nurdin– Jakarta: Pusat Perbukuan, Departemen Pendidikan Nasional, 2008. xii, 283 hlm.: ilus.; 25 cm. Bibliografi: hlm. 278-279 Indeks: hlm. 282 ISBN 979-462-868-9 1. Bahasa Indonesia-Studi dan Pengajaran I. Judul II. Prastowo, Tri Wahyu III. Nurdin

Diterbitkan oleh Pusat Perbukuan Departemen Pendidikan Nasional Tahun 2008 Diperbanyak oleh ...

ii

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

Kata Sambutan

Puji syukur kami panjatkan ke hadirat Allah SWT, berkat rahmat dan karunia-Nya, Pemerintah, dalam hal ini, Departemen Pendidikan Nasional, pada tahun 2008, telah membeli hak cipta buku teks pelajaran ini dari penulis untuk disebarluaskan kepada masyarakat melalui website Jaringan Pendidikan Nasional. Buku teks pelajaran ini telah dinilai oleh Badan Standar Nasional Pendidikan dan telah ditetapkan sebagai buku teks pelajaran yang memenuhi syarat kelayakan untuk digunakan dalam proses pembelajaran melalui Peraturan Menteri Pendidikan Nasional Nomor 12 Tahun 2008. Kami menyampaikan penghargaan yang setinggi-tingginya kepada para penulis yang telah berkenan mengalihkan hak cipta karyanya kepada Departemen Pendidikan Nasional untuk digunakan secara luas oleh para pendidik dan peserta didik di seluruh Indonesia. Buku-buku teks pelajaran yang telah dialihkan hak ciptanya kepada Departemen Pendidikan Nasional tersebut, dapat diunduh (down load), digandakan, dicetak, dialihmediakan, atau difotokopi oleh masyarakat. Namun, untuk penggandaan yang bersifat komersial harga penjualannya harus memenuhi ketentuan yang ditetapkan oleh Pemerintah. Diharapkan bahwa buku teks pelajaran ini akan lebih mudah diakses sehingga peserta didik dan pendidik di seluruh Indonesia maupun sekolah Indonesia yang berada di luar negeri dapat memanfaatkan sumber belajar ini. Kami berharap, semua pihak dapat mendukung kebijakan ini. Selanjutnya, kepada para peserta didik kami ucapkan selamat belajar dan manfaatkanlah buku ini sebaik-baiknya. Kami menyadari bahwa buku ini masih perlu ditingkatkan mutunya. Oleh karena itu, saran dan kritik sangat kami harapkan.

Jakarta, Juni 2008 Kepala Pusat Perbukuan

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

iii

PRAKATA
Puji syukur hanya pantas dipersembahkan ke hadirat Allah SWT atas limpahan nikmat berupa kemudahan dan kelancaran, serta petunjuk-Nya yang diberikan sehingga penulis dapat menyelesaikan buku Bahasa Indonesia 2 Kelas XI untuk SMK. Buku ini disusun Sesuai Standar Isi SK dan KD. Penyajian materi disesuaikan dengan penjabaran yang terdapat pada silabus mata pelajaran Bahasa Indonesia yang mengarah pada standar kompetensi, yaitu berkomunikasi dengan bahasa Indonesia setara tingkat madia. Buku Bahasa Indonesia 2 Kelas XI ini berisi materi pelajaran yang terbagi ke dalam 13 bab. Penyusunan dan pemberian judul pada setiap bab disesuaikan dengan urutan pada silabus seperti pada buku kelas X, agar guru tidak perlu lagi mengamati silabus untuk mengetahui seberapa jauh kompetensi dasar yang sudah dipelajari. Di samping itu, pada setiap bab, penulis mencantumkan uraian indikator sesuai silabus, sedangkan pokokpokok materi dan tujuan pembelajaran setiap materi diuraikan dalam bentuk paragraf pada kolom khusus. Materi pembelajaran bahasa Indonesia pada tingkat madia ini sudah mengarah pada penerapan cara berkomunikasi baik lisan maupun tulisan pada bentuk-bentuk kerja, seperti menyimpulkan, menyimak informasi, memahami bentuk perintah atau yang bukan perintah dalam konteks bekerja, memahami perintah kerja tertulis, berkomunikasi dalam berbagai situasi dengan menerapkan pola gilir, dalam bernegosiasi, dan berdiskusi. Untuk mengasah pemahaman dan keterampilan siswa lebih mendalam, penulis menyajikan tugas akhir pelajaran lebih banyak dilakukan secara berkelompok dan bersifat penerapan sesuai tuntutan kompetensi yang harus dicapai. Untuk tingkat madia, aspek keterampilan bahasa lebih ditujukan pada keterampilan berbicara dan menulis yang memang menjadi tuntutan dalam dunia kerja. Oleh sebab itu, buku ini sangat cocok untuk menjadi buku panduan dalam permbelajaran bahasa Indonesia bagi siswa SMK tingkat madya. Pokok-pokok materi diuraikan secara terperinci dengan menggunakan bahasa yang mudah dicerna demi untuk melatih aspek kognitif siswa dan memotivasi minat membaca dalam rangka memahami materi pelajaran secara mandiri. Penulis menyertai pula berbagai contoh yang dapat membantu siswa memahami penjelasan materi. Dengan itu, guru hanya memberikan penjelasan seperlunya saja pada hal-hal yang kurang dimengerti oleh siswa. Jika ada istilah atau kata yang kurang dipahami, siswa dapat melihat glosarium yang terdapat pada halaman belakang buku. Semoga dengan menggunakan buku ini, siswa dapat mencapai setiap kompetensi dasar yang telah ditentukan dalam silabus dan mahir dalam berkomunikasi setara tingkat madya. Akhir kata, penulis menerima saran dan kritik yang membangun untuk kesempurnaan buku ini. Semoga buku ini bermanfaat bagi kita semua dan bagi siapa saja yang mencintai bahasa Indonesia sebagai bahasa persatuan. Amin!

Jakarta, Januari 2008

Penulis

iv

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

904 orang. Setiap halaman bab disuguhkan bacaan yang diharapkan berguna bagi siswa untuk : Menambah wawasan pengetahuan Memberikan Motivasi positif Memperkaya pengalaman batin. AIDS. Setiap halaman bab diberikan pokok penjabaran materi pada bab tersebut berikut tujuan pembelajaran yang diharapkan tercapai setelah proses pembelajaran. diperkirakan 4. Kondisi ini seiring dengan laju epidemi AIDS.5 persen dan hubungan seks tidak aman 46 persen. jumlah kasus infeksi baru HIV mencapai 674 orang. Mayoritas kasus infeksi baru di Indonesia dan Vietnam disebabkan pemakaian narkotika.Cara Penyajian dan Penggunaan Buku I. Proses menyimak menuntut motivasi dan perhatian dari pendengar. Masing-masing subjudul dalam setiap bab disajikan sesuai tahapan indikator atau materi pembelajaran pada silabus.000 kasus baru pada tahun lalu. kita juga akan belajar mengubah informasi verbal ke nonverbal serta membuat simpulan secara deduktif dan induktif disertai dengan opini atau pendapat. BAB 1 1. epidemi HIV/AIDS telah bergeser dari hubungan seks tidak aman ke pemakaian napza (populer dengan sebutan narkoba) dengan jarum suntik. dan Kita Saat ini di kawasan Asia. Cara penularan kasus AIDS melalui IDU 49. Sekitar 300. Ketika epidemi di Kamboja. Jika tahun 1998 jumlah kumulatif kasus AIDS yang dilaporkan 258 orang.384 orang dengan prevalensi 4. di Indonesia dan Vietnam justru meningkat pesat.9 juta orang hidup dengan HIV/AIDS termasuk 440. dan hubungan seks tidak aman. tetapi juga berupaya menangkap isi atau pesan serta memahami makna informasi yang disampaikan. Myanmar. Jika tahun 1998 jumlah kumulatif kasus HIV baru 591 orang. Peningkatan kasus penularan virus itu melalui narkoba suntik mulai terlihat sejak tahun 1999. Sejak Januari hingga September 2007 saja. seperti berikut : Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI v . kita akan mempelajari kegiatan menyimak dan membedakan informasi berbentuk verbal serta nonverbal. 4. Pada dasarnya menyimak adalah kegiatan menyerap informasi yang disampaikan secara lisan dengan tidak sekadar menggunakan indera pendengaran. Di samping itu. Pada Bab ini. Kegiatan Menyimak dan Memahami Informasi Nonverbal Menyimak merupakan salah satu kegiatan berbahasa yang dapat menambah atau memperluas pengetahuan. Sejauh ini. Narkoba. pada September 2007 jumlahnya telah meningkat jadi 10. Penyajian Buku Buku ini disajikan dengan perincian sebagai berikut. Hasil simakan dapat diungkapkan kembali dengan bahasa sendiri dengan tidak mengubah pengertian dasar informasi sumber. Keterampilan menyimak perlu dilatih secara terus-menerus dan berkesinambungan. pada September 2007 jumlahnya telah mencapai 5. Melatih Kemampuan Membaca Efektif (KEM) MENYIMAK UNTUK MENYIMPULKAN INFORMASI YANG TIDAK BERSIFAT PERINTAH DALAM KONTEKS BEKERJA 2. Tujuan mempelajari bab ini adalah agar kita terampil menyimak informasi lisan untuk diubah menjadi informasi nonverbal sekaligus dapat menyampaikan pendapat berbentuk simpulan secara deduktif maupun induktif dari informasi yang didengarkan. dan Thailand menunjukkan penurunan prevalensi HIV. peningkatan kasus HIV di Indonesia sungguh mencengangkan. Tanpa keinginan dan perhatian. psikotropika. terutama penggunaan jarum suntik injecting drug use (IDU). Dalam sepuluh tahun terakhir. Wacana 3. yakni. Asia Tenggara sendiri memiliki tingkat prevalensi tertinggi di Asia dengan luas wilayah endemis bervariasi antarnegara. sulit mengharapkan hasil yang memuaskan. Judul setiap bab merupakan kompetensi dasar yang sesuai silabus. A. Proses pelatihan menyimak menuntut adanya kesiapan mental dan kesehatan fisik serta motivasi atau kemauan secara sadar untuk mengikuti seluruh isi simakan. dan zat-zat adiktif lainnya (napza).57 persen. Materi diuraikan secara tuntas dengan diberikan contohcontoh yang sesuai. Berdasarkan caranya.000 orang meninggal akibat berbagai penyakit terkait AIDS. menyimak terdiri atas beberapa macam.

bagan. Catatlah hal-hal yang belum dipahami untuk ditanyakan kepada Guru. II. 1. Pengalihan Informasi Verbal menjadi Nonverbal Hal-hal yang perlu diperhatikan untuk mengalihkan informasi verbal ke informasi nonverbal. 1. Anggap saja setiap kelompok diperintahkan oleh pembina OSIS/kepala sekolah untuk melaksanakan kegiatan (penentuan jenis kegiatan diserahkan pada kelompok). untuk dapat menguji pemahaman pembelajaran dalam satu bab. Informasi dapat berbentuk verbal dan nonverbal. Bacalah judul bab dan pahami penjabaran pokok-pokok materi serta tujuan pembelajaran yang akan dicapai pada setiap bab. Setiap bab diberikan uji kompetensi dengan model soal pilihan ganda dan essai. 3. dan menyimak untuk pemecahan masalah. UJI KOMPETENSI I. Lalu. Perhatikan data-data berupa lambang. carilah di Glosarium vi Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . 5. Tugas kelompok diberikan untuk dikerjakan secara berkelompok agar dapat mengolah kompetensi secara bersama-sama. Dari pokok informasi yang dicatat. narasi d. buatlah informasi berbentuk nonverbal ! Susunlah sebuah simpulannya secara deduktif atau induktif yang disertakan opini Anda. Untuk siswa Agar Anda dapat menggunaka buku ini dengan baik dan mencapai target hasil pembelajaran yang diharapkan. yaitu: 1. 5. menyimak diskriminatif. sedangkan siswa lainnya menyimak. eksposisi e. Perhatikan dengan saksama isi informasi verbal yang ingin diubah. 3. 1. Informasi nonverbal ialah informasi berbentuk visual seperti grafik. 8. setiap kelompok melakukan langkah-langkah berikut. Bacalah bacaan dan pahami uraian materi pada setiap subjudul. dan matriks. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! Menyusun kesimpulan dengan cara induksi atau deduksi kita lakukan bila membuat karangan a. 3. denah. menyimak ekstensif. deskripsi Lukisan naik turunnya data yang berupa batang atau balok dan dipakai untuk menekankan adanya perbedaan tingkat atau nilai dari berbagai aspek disebut a. 2. Rangkuman berisi ringkasan materi dalam setiap bab. diantaranya adalah menyimak intensif. tabel.5. 2. bagan pohon 2. TUGAS MANDIRI: Mintalah salah seorang siswa membacakan wacana yang terdapat di awal bab. apakah grafik. diagram. 4. argumentasi b. tabel. B. 2. grafik batangan c. grafik garis d. TUGAS KELOMPOK Bentuklah kelompok terdiri atas 4-5 orang. Catatlah pokok-pokok informasi. 4. grafik lingkaran b. Informasi verbal ialah informasi berbentuk uraian atau penjelasan. Rumuskanlah hal-hal yang akan dilakukan oleh tim kerja! Susunlah agenda atau jadwal kerja panitia! Buatlah struktur kerja berbentuk bagan! Susunlah da ar pertanyaan untuk konfirmasi! Presentasikanlah di depan kelas semua langkah kerja tersebut! 6. jika perlu diskusikan dengan teman sebangku. perhatikanlah dan ikutilah langkah-langkah berikut : 1. diagram dan yang lainnya. Ada beberapa macam cara menyimak. persuasi c. Setelah menyimak lakukan hal berikut. Amatilah contoh-contoh yang disajikan. 2. Kegiatan Menyimak dan Memahami Informasi Nonverbal Menyimak adalah kegiatan menyerap informasi yang disampaikan secara lisan dengan tidak sekedar menggunakan indera pendengaran tapi juga berupaya menangkap isi atau pesan serta memahami makna informasi yang disampaikan. bagan arus e. peta. Jika ada istilah atau kata yang belum Anda pahami. 7. RANGKUMAN A. Tugas mandiri diberikan untuk mengasah kompetensi secara individual sesuai materi dan tujuan pembelajaran. Petunjuk Penggunaan Buku A. satuan atau angka-angka serta perbandingannya untuk menentukan bentuk visual yang efektif.

Guru dapat mengatur penyajian materi pembelajaran dengan menggabungkan materi pada beberapa bab yang dianggap berhubungan atau satu pokok bahasan meskipun posisi bab berjauhan. Membaca uraian pokok-pokok materi pada setiap bab yang akan diajarkan dan mendalaminya dengan memperkaya contoh-contoh. Hasilnya berikan pada Guru. misalnya: 2. Menyediakan forum tanya jawab kepada siswa. Untuk guru Selain melihat langkah-langkah pembelajaran di dalam silabus. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI vii . Kerjakanlah tugas-tugas atau perlatihan untuk lebih menggali potensi Anda sesuai petunjuk tugas. Anda diharapkan melakukan hal berikut: 1. Hal ini dilakukan agar siswa dapat lebih fokus dan memiliki pemahaman serta penguasaan kompetensi yang komprehensif. B. Mintalah saran kepada Guru untuk menambah bahan dan sarana pembelajaran dalam rangka memudahkan mengerjakan latihan agar mencapai hasil yang maksimal. Hal ini mungkin dapat dilakukan dengan mempelajari buku sumber pembelajaran yang dapat dilhat pada kolom akhir silabus. Menyediakan banyak waktu kepada siswa untuk mengerjakan tugas di kelas dan membahasnya bersama.atau di kamus. 3. atau ikuti instruksi yang diberikan Guru. 4. 7. 6.

14.11.10. Menyimpulkan isi teks tertulis dalam konteks bekerja 2.6.1 Menyimak untuk menyimpulkan informasi yang tidak bersifat perintah dalam konteks 2. bentuk kata. ekspositoris. Membuat parafrasa lisan dalam konteks bekerja 2.4 Membaca untuk memahami makna kata.8. deskriptif.7.7.PETA KOMPETENSI TATARAN MADYA Menyimak Membaca Berbicara Menulis 2. Bercakap-cakap secara sopan dengan mitra bicara dalam konteks bekerja 2. Menyimak untuk memahami perintah yang diungkapkan atau yang tidak dalam konteks bekarja 2.12 Menulis wacana yang bercorak naratif.5 Menggunakan secara lisan kalimat tanya/pertanyaan dalam konteks bekerja 2.2.13. Meringkas teks tertulis dalam konteks bekerja 2. Menyampaikan laporan atau presentasi lisan dalam konteks bekerja viii Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . dan kalimat dalam konteks bekerja 2. 2. Bernegosiasi yang menghasilkan dalam konteks bekerja 2. Berdiskusi yang bermakna dalam konteks bekerja 2. Menerapkan Pola Menerapkan pola gilir dalam Gilir dalam berkomunikasi berkomunikasi 2. dan argumentatif 2. ungkapan.9.3 Memahami perintah kerja tertulis 2.

..................................................... Pengertian dan Ciri Kalimat Perintah ........... A.............................. UJI KOMPETENSI ............................................. BAB IV MEMBACA UNTUK MEMAHAMI MAKNA KATA................... B...... MENYIMAK UNTUK MEMAHAMI PERINTAH YANG DIUNGKAPKAN ATAU YANG TIDAK DALAM KONTEKS BEKERJA.................................................................................... A................. 1 4 11 15 19 BAB II 25 28 28 31 36 BAB III MEMAHAMI PERINTAH KERJA TERTULIS DALAM KONTEKS BEKERJA ..DAFTAR ISI KATA SAMBUTAN .. D........ iii PRAKATA .................. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 41 43 44 51 53 55 61 63 68 71 ix ................................ C.... DAN KALIMAT DALAM KONTEKS BEKERJA......... ............ C................ C...................... B... Pengalihan Informasi Verbal menjadi Nonverbal ......... A........................... Penggunaan Kamus dalam Mencari Bentuk.............................. UJI KOMPETENSI ......... viii DAFTAR ISI ..... D......................................... iv CARA PENYAJIAN DAN PENGGUNAAN BUKU ................................................... Klasifikasi Kata Berdasarkan Bentuk Kata ......... B Jenis-Jenis Kalimat Perintah .................. ix BAB I MENYIMAK UNTUK MENYIMPULKAN INFORMASI YANG TIDAK BERSIFAT PERINTAH DALAM KONTEKS BEKERJA.................................. BENTUK KATA UNGKAPAN.... Menyampaikan Pendapat melalui Simpulan Secara Deduktif dan Induktif .............. Berbagai Respons terhadap Perintah................... C....... Kegiatan Menyimak dan Memahami Informasi Nonverbal ................. A....... v PETA KOMPETENSI .. UJI KOMPETENSI ..... Menindak Lanjuti Perintah Kerja Tertulis .................................................................................................................... Perintah Kerja Berbentuk Manual............................................... Klasifikasi Kata Berdasarkan Kelas Kata ...................................................... Klasifikasi Kata Berdasarkan Makna Kata ..................................................................................................................... Kategori........ B................... Mengenal Bentuk Perintah Kerja Tertulis .......................................................................................................................... Model-Model Surat Berisi Perintah Kerja ....................................

......... Jenis Kalimat Tanya ... F. 93 B.................... E........ A......... Cara Membuat Parafrasa ............................ E...................................................................................................................... C. Mengalihkan Topik Pembicaraan secara Halus .............................................................................. Penerapan Pola Gilir dalam Berbagai Situasi . Salam dan Ungkapan dalam Mengakhiri Percakapan . UJI KOMPETENSI .................................. B..... serta Kalimat yang Santun dalam Berkomunikasi ............................................... 94 C......................................... Bentukan Kata/Frasa Baru ............ B.......... Penerapan Pola gilir dalam Percakapan secara Aktif.......................................... 153 156 158 160 161 162 164 x Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI ........................................................... Memparafrasakan Naskah Drama Menjadi Prosa atau Cerita ................. Frasa....... BAB VIII BERCAKAP-CAKAP SECARA SOPAN DENGAN MITRA BICARA DALAM KONTEKS BEKERJA . Bentukan kata........................ A.............. Menggunakan Kata............... TES SEMESTER GANJIL.......... D............. UJI KOMPETENSI ................................ UJI KOMPETENSI . Memahami Pola Gilir dalam Berkomunikasi ............................................................................................. BAB V 77 78 80 85 MENGGUNAKAN SECARA LISAN KALIMAT TANYA/PERTANYAAN DALAM KONTEKS BEKERJA ... Mengutarakan Pendapat dengan Kalimat Tanya yang Santun ........................... Pengertian dan Fungsi Kalimat Tanya ............................................ Pemakaian Kata ............... Pengertian Parafrasa ................................. 99 UJI KOMPETENSI ............ D.... 111 114 114 116 118 121 124 129 131 132 133 141 146 BAB VI BAB VII MENERAPKAN POLA GILIR DALAM BERKOMUNIKASI ........................................................... Memparafrasakan Puisi Menjadi Prosa .......................... UJI KOMPETENSI . C.......... Menggungkapkan Perbedaan Pendapat secara Halus ............. 91 A..................... 106 MEMBUAT PARAFRASA LISAN DALAM KONTEKS BEKERJA ....... B.. E.......................................................... C.. dan Kalimat yang Kurang Tepat ......... Pola Penyajian Informasi Lisan ..................................... A....dan Makna Kata................. Pilihan Kata atau Ungkapan untuk Memulai Percakapan ...............

...... B.............................................................. EKSPOSITORIS DAN ARGUMENTATIF.................................. A.. C.. Tugas dan Peranan Unsur Diskusi....................... BAB X BERNEGOSIASI YANG MENGHASILKAN DALAM KONTEKS BEKERJA ................ Pengertian Ringkasan .... 169 174 174 176 176 177 179 185 188 189 190 195 203 206 208 213 215 219 222 224 241 249 252 252 254 257 258 263 269 278 280 282 xi BAB XI MENYAMPAIKAN LAPORAN ATAU PRESENTASI LISAN DALAM KONTEKS BEKERJA ......................... Jenis-Jenis Wacana .........BAB IX BERDISKUSI YANG BERMAKNA DALAM KONTEKS BEKERJA .......... UJI KOMPETENSI .......................... UJI KOMPETENSI ............... Bernegosiasi dengan Santun ..................................... A................................ A.................................................................................. Pengertian Wacana ............................................ D....... Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI ...................................................................................... TES SEMESTER GENAP...................................................... DESKRIPTIF................. B....................... Beberapa Contoh Bentuk Ringkasan ....... Diskusi dan Manfaatnya ........................ UJI KOMPETENSI ........ UJI KOMPETENSI ...................................................................... A............................................................................. Menyampaikan Rangkuman dan Simpulan Laporan.......... BAB XIII MERINGKAS TEKS TERTULIS DALAM KONTEKS BEKERJA ......... DAFTAR PUSTAKA .................................................... Menyampaikan Tanggapan dan Sanggahan dalam Diskusi .............................................................................................. Pengertian Laporan .. Bernegosiasi dalam Menyusun Program Kerja ....................................... Pola Penyajian Laporan secara Lisan............... C............... Mengambil Simpulan dalam Diskusi ............................................. C.............. B...... D................................ UJI KOMPETENSI ......................................................................................................................... E.. A........ C. Pengertian Negosiasi ........ Pengertian Simpulan ...................... B..................... BAB XII MEMBUAT WACANA BERCORAK NARATIF.............................................................................................................................................................. Cara Membuat Ringkasan . Pola Penalaran dalam Mengambil Simpulan . E.............................................. INDEKS ........ Menyampaikan Pendapat dan Gagasan dalam Diskusi .................................................................... GLOSARIUM ................................................................... B......................................

xii Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .

Di samping itu. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI  . kita juga akan belajar mengubah informasi verbal ke nonverbal serta membuat simpulan secara deduktif dan induktif disertai dengan opini atau pendapat. kita akan mempelajari kegiatan menyimak dan membedakan informasi berbentuk verbal serta nonverbal. Tujuan mempelajari bab ini adalah agar kita terampil menyimak informasi lisan untuk diubah menjadi informasi nonverbal sekaligus dapat menyampaikan pendapat berbentuk simpulan secara deduktif maupun induktif dari informasi yang didengarkan.BAB 1 MENYIMAK UNTUK MENYIMPULKAN INFORMASI YANG TIDAK BERSIFAT PERINTAH DALAM KONTEKS BEKERJA Standar Kompetensi Kompetensi Dasar - Berkomunikasi dengan bahasa Indonesia setara tingkat madya Menyimak untuk Menyimpulkan Informasi yang Tidak Bersifat Perintah dalam Konteks Bekerja - Indikator - Mengubah informasi dari bentuk lisan ke dalam bentuk nonverbal (bagan/tabel/diagram/grafik/ denah/matriks) Menyampaikan pendapat/opini dengan menggunakan teknik penyampaian simpulan dan pendapat yang akurat secara deduktif atau induktif Menggunakan bahasa Indonesia yang baik dan benar dalam menyimpulkan sesuatu informasi Pada Bab ini.

000 kasus baru pada tahun lalu. Sementara estimasi prevalensi HIV pada pengguna narkoba suntik mencapai 41. dan zat-zat adiktif lainnya (napza). Kondisi ini seiring dengan laju epidemi AIDS. Sekitar 300. Jika tahun 1998 jumlah kumulatif kasus HIV baru 591 orang. dan Thailand menunjukkan penurunan prevalensi HIV.5 persen di antaranya adalah pengguna narkoba suntik. Jika tahun 1998 jumlah kumulatif kasus AIDS yang dilaporkan 258 orang. Mayoritas kasus infeksi baru di Indonesia dan Vietnam disebabkan pemakaian narkotika. Asia Tenggara sendiri memiliki tingkat prevalensi tertinggi di Asia dengan luas wilayah endemis bervariasi antarnegara. Dalam sepuluh tahun terakhir.  Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . dari kasus AIDS yang terlaporkan secara kumulatif.9 juta orang hidup dengan HIV/AIDS termasuk 440.5 persen dan hubungan seks tidak aman 46 persen.57 persen. Ketika epidemi di Kamboja. pada September 2007 jumlahnya telah meningkat jadi 10. terutama penggunaan jarum suntik injecting drug use (IDU). Departemen Kesehatan menyebutkan. Sejak Januari hingga September 2007 saja. epidemi HIV/AIDS telah bergeser dari hubungan seks tidak aman ke pemakaian napza (populer dengan sebutan narkoba) dengan jarum suntik.000 orang meninggal akibat berbagai penyakit terkait AIDS. dan Kita Saat ini di kawasan Asia. 49. Sejauh ini.Wacana Narkoba. jumlah kasus infeksi baru HIV mencapai 674 orang.000 orang.000 hingga 247.6 persen dan ditemukan di tiap provinsi. peningkatan kasus HIV di Indonesia sungguh mencengangkan. Aids. pada September 2007 jumlahnya telah mencapai 5. dan hubungan seks tidak aman.904 orang.384 orang dengan prevalensi 4. Secara nasional. Peningkatan kasus penularan virus itu melalui narkoba suntik mulai terlihat sejak tahun 1999. Cara penularan kasus AIDS melalui IDU 49. psikotropika. diperkirakan 4. Myanmar. di Indonesia dan Vietnam justru meningkat pesat. jumlah pengguna narkoba suntik di Indonesia pada tahun 2006 diperkirakan 190.

Cara membersihkan jarum. 26. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI  . di wilayah Provinsi DKI Jakarta. mereka rentan tertular akibat praktik berbagi jarum suntik. pengetahuan pentingnya sterilisasi jarum suntik sangat rendah. Hasil penelitian lain yang dilakukan I Made Setiawan dan timnya di Bali (1998) menyebutkan. yang populer dikonsumsi adalah narkoba suntikan berupa heroin atau putau. Akan tetapi. Bahkan. Akibatnya. angka kematian penghuni lapas atau rutan pada tahun 2005 meningkat dua kali lipat dibandingkan dengan tahun sebelumnya. serta 17. Hal ini membuat kelompok pengguna narkoba suntik menempati posisi amat penting dalam mata rantai penyebaran HIV/AIDS.5 persen lainnya pernah menggunakan jasa pekerja seksual. Menurut penelitian Budi Utomo.” kata Nafsiah Mboi. Guru Besar dari FKUI RSCM yang bergerak di bidang penanggulangan HIV/AIDS. di kalangan remaja pengguna narkoba suntik umumnya satu jarum suntik dipakai dua sampai 18 orang. 26. mereka berpeluang besar menularkannya ke kalangan non-pengguna narkoba suntik.6 persen berhubungan intim dengan orang asing.5 persen dari pengguna narkoba suntik itu memiliki lebih dari satu pasangan seksual aktif. “Usia pengguna napza suntik cenderung makin muda sehingga mereka akan terinfeksi HIV lebih awal dan sulit dijangkau. Di Indonesia. 72 persen dari total jumlah kumulatif kasus AIDS adalah pengguna narkoba suntik. Para pengguna narkoba suntik yang terinfeksi HIV di lapas atau rutan selama ini kesulitan mengakses pelayanan kesehatan. Para pengguna narkoba suntik di lembaga pemasyarakatan (lapas) dan rumah tahanan (rutan) juga meningkat pesat serta rata-rata 20 persen terinfeksi HIV. Di sisi lain. Sekretaris Komisi Nasional Penanggulangan HIV/AIDS. cuma satu orang yang konsisten memakai kondom.Bahkan. 31 persen air panas. istri mereka. 65 persen memakai air biasa. Tingginya angka terinfeksi HIV di kalangan pengguna narkoba terutama disebabkan perilaku mereka amat beresiko. Konon karena efeknya lebih cepat dan murah dibandingkan dengan yang nonsuntikan. anak dan pasangan seksual mereka. 62 persen di antaranya memakai ulang jarum tersebut. Guru Besar dari Fakultas Kesehatan Masyarakat Universitas Indonesia (FKM UI). Menurut Zubairi Djoerban. Sangat sedikit yang mensterilkan dengan merebus. Kemudian. Salah satunya masih meluasnya praktik berbagi jarum suntik di kalangan IDU.

seperti berikut :  Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Departemen Hukum dan Hak Asasi Manusia bertugas mengurus di lembaga pemasyarakatan. kita bisa belajar dari negara-negara tetangga seperti Kamboja. Proses menyimak menuntut motivasi dan perhatian dari pendengar. (Sumber: Kompas. Pedoman itu mengatur penggunaan jarum suntik sebagai bagian layanan harm reduction di puskesmas.Sejauh ini. Hasil simakan dapat diungkapkan kembali dengan bahasa sendiri dengan tidak mengubah pengertian dasar informasi sumber. Kegiatan Menyimak dan Memahami informasi Nonverbal Menyimak merupakan salah satu kegiatan berbahasa yang dapat menambah atau memperluas pengetahuan. Berdasarkan caranya. tetapi juga berupaya menangkap isi atau pesan serta memahami makna informasi yang disampaikan. yaitu memisahkan antara pengedar dan pengguna. pasien bisa mendapat pengobatan tanpa didiskriminasi. rumah sakit. Pada dasarnya menyimak adalah kegiatan menyerap informasi yang disampaikan secara lisan dengan tidak sekadar menggunakan indera pendengaran. menyimak terdiri atas beberapa macam. sulit mengharapkan hasil yang memuaskan. Pemerintah telah menyusun pedoman penanggulangan HIV/AIDS akibat pemakaian jarum suntik pada pengguna narkoba suntik secara bergantian. Dalam aturan itu. Realisasinya tentu butuh komitmen kuat dari pemerintah dan pemangku kepentingan dalam penanggulangan HIV/AIDS di kalangan pengguna narkoba suntikan. dengan beberapa perubahan) A. dan lapas. Setiap pengguna narkoba di lapas juga wajib diperlakukan sebagai pasien yang bisa disembuhkan. Tanpa keinginan dan perhatian. 24 November 2007. Apabila terlanjur terinfeksi HIV. yakni. Keterampilan menyimak perlu dilatih secara terus-menerus dan berkesinambungan. khususnya menyangkut bagaimana upaya pencegahan yang terfokus dan berkelanjutan dapat menekan perkembangan epidemi HIV. Sabtu. Proses pelatihan menyimak menuntut adanya kesiapan mental dan kesehatan fisik serta motivasi atau kemauan secara sadar untuk mengikuti seluruh isi simakan. Untuk itu.

film. seseorang mempelajari berbagai hal yang dibutuhkan. 2. 3. 6. pertunjukan sandiwara. secara kreatif dan analisis setelah yang bersangkutan mendapat informasi dari menyimak sesuatu. Menyimak untuk Menilai menyimak mendengarkan. memahami isi simakan. dan mendalami bahan yang disimak. Untuk dapat mengungkapkan kembali informasi simakan yang diterima dengan baik dan memadai. Menyimak untuk Belajar melalui kegiatan menyimak. 2. 5. dan sebagainya. Misalnya. 7. teliti. para siswa mendengarkan suara radio. misalnya siswa harus dapat membedakan bunyi (i) dan (i:). para siswa menyimak ceramah guru bahasa Indonesia. Menyimak Pemecahan Masalah menyimak mengikuti uraian pemecahan masalah secara kreatif dan analisis yang disampaikan oleh si pembicara. dan sebagainya. menguji. 4. Menyimak Intensif menyimak memahami secara terperinci. Menyimak Ekstensif menyimak memahami secara sepintas dan umum dalam garis-garis besar atau butir-butir penting tertentu. Catatlah ide-ide pokok setiap paragraf. Catatlah kata-kata kunci yang dianggap penting berupa frasa atau klausa. televisi. 1. menelaah. Mungkin juga penyimak dapat memecahkan masalah yang dihadapinya. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI  . Dalam belajar bahasa Inggris. kita dapat melakukan langkah-langkah sebagai berikut. 3. Menyimak untuk Menghibur menyimak sesuatu untuk menghibur dirinya. Perhatikan judul wacana yang akan dilisankan.1. Menyimak Diskriminatif menyimak untuk membedakan bunyi suara. Misalnya. dan membandingkan dengan pengalaman serta pengetahuan menyimak. menyimak pembacaan cerita-cerita lucu. mengkaji.

yaitu grafik batang. Grafik Grafik adalah gambaran pasang surutnya suatu keadaan atau data yang ada dengan garis atau gambar.4. Informasi verbal berwujud uraian. Contohnya: grafik. atau matriks. Grafik dibedakan menjadi tiga macam. diagram. jika hasil ujian periode sebelumnya tidak ditindaklanjuti dengan upaya peningkatan kualitas pembelajaran pada sekolah yang angka kelulusannya rendah. bagan. Contoh informasi verbal: Sulistya mengatakan UN lebih banyak menimbulkan penderitaan bagi sekolah swasta dan pinggiran. Informasi ini dianggap lebih mudah dicerna dan dipahami. Informasi berbentuk nonverbal cenderung bersifat visual. Uraikan kembali dalam bentuk ikhtisar berdasarkan data-data yang dicatat. 1. denah. berupa bentuk atau gambar serta garis-garis yang memiliki ciri-ciri tersendiri dan cenderung perlu pengamatan lebih khusus. Berikut ini pengertian dan contoh bentuk informasi nonverbal. Bagaimana mungkin sekolah pinggiran yang sarana. ulasan. kualitas SDM. Informasi hasil simakan dapat dikemukakan atau disampaikan dalam bentuk verbal maupun nonverbal. UN yang diselenggarakan setiap tahun hanya akan menambah persoalan dan pemborosan APBN. Catatlah fakta-fakta atau data berupa angka. atau penjelasan dan dapat disampaikan secara lisan maupun tulisan. grafik garis. atau perbandingan. persentase. a. Grafik batang adalah lukisan naik turunnya data berupa batang atau balok dan dipakai untuk menekankan adanya perbedaan tingkatan  Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . dan pemenuhan standar pelayanan minimal (SPM)-nya sangat terbatas disamakan dengan sekolah yang SPM-nya lengkap dan pada umumnya didominasi sekolah negeri perkotaan. dan grafik lingkaran. 5. prasarana.

Grafik garis adalah lukisan naik turunnya data berupa garis yang dihubungkan dari titik-titik data secara berurutan. Contoh grafik garis: Grafik Pengunjung Perpustakaan SMK Nuris Tahun 2007 Grafik Pengunjung Perpustakaan SMK Nurul Islam Tahun 2007 Jumlah Pengunjung 300 250 200 150 100 50 0 Series1 c.atau nilai berupa aspek. Grafik ini dipakai untuk menggambarkan perkembangan atau perubahan dari waktu ke waktu. Ja n M ar M ei Ju l Se pt No v Bulan Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI  . Contoh Grafik Batang : Grafik Pekerjaan Orang Tua Siswa SMK Nurul Islam Tahun 2007 Grafik Pekerjaan Orang Tua Siswa SMK Nurul Islam Tahun 2007 150 100 50 0 1 ABRI PNS SWASTA BURUH PETANI LAINNYA b. Grafik lingkaran adalah gambaran naik turunnya data berupa lingkaran untuk menggambarkan persentase dari nilai total atau seluruhnya.

 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .2 Series 1 0 1 2 3 4 5 6 Tahun Tahun 3. diagram lingkaran.5 200 Transaksi 120.9 300 128. Tabel Tabel adalah daftar yang berisi ikhtisar dan sejumlah data informasi. diagram balok. diagram Diagram adalah (gambaran buram. diagram gambar. dan diagram pohon.8 Transa 125. Contoh diagram: Total Nilai Transaksi Transaksi Di BEJ (dlm triliyun) di BEJ (dalam Triliyun) 147. biasanya berupa kata-kata dan bilangan yang tersusun secara bersistem. sketsa) untuk memperlihatkan atau menerangkan sesuatu. Bentuk-bentuk diagram antara lain adalah diagram arus (bagan alur). urut ke bawah dalam lajur dan deret tertentu dengan garis pembatas sehingga dapat dengan mudah disimak.8 Nilai Nilai 97.4 100 ksi 246.Contoh grafik lingkaran: Persentase Penganut Agama di SMK Kartini Persentase Penganut Agama di SMK Kartini Islam 1% 2% Protestan 14% Katolik Hindu Budha 28% 55 28 14 2 1 55% Islam Protestan Katolik Hindu Budha 2. diagram cabar. diagram garis.

2 ksi 0 1 2 3 4 5 6 Tahun Contoh: Data Tentang Kesegaran Jasmani Manusia Berdasarkan Usia dan Jenis 3. sehingga dapat dengan mudah di Jenis Tes Waktu Tempuh Contoh : Jarak 2. dan sebagainya atau representasi melalui gambar dari suatu daerah yang menyatakan sifat. Contoh bagan: Contoh bagan: Bagan Budidaya Belut Bagan Budidaya Belut Pembuatan Kolam Penaburan Kapur Pemberian bibit Penaburan Rompas Seleksi Bibit Penggenangan Kolam Penebaran Bibit 5.5 Km Selama 12 menit Data Tentang Kesegaran Jasmani Manusia Berdasarkan Usia dan Jenis Kelamin Usia Jenis Tes menit Tempuh utk 2400 m yg ditempuh Jarak 18 .29 tahun 12 Waktu 13 menit 2250 m karak 2.49 tahun 13 menit 14 menit 2250 m 2090 m Pria Wanita Pria Wanita 40 . laut. dan masyarakat manusia. Bagan adalah gambaran secara analisis atau terurai tentang proses yang terjadi di alam.49 tahun 13 menit 14 menit 2250 m 2090 m Bagan . dan sebagainya.49 tahun 14 menit 15 menit 2090 m 1850 m 40 Pria Wanita Pria Wanita 4. gunung-gunung. Bagan digunakan Bagan digunakan memperjelas terjadi di alam. Bagan adalah gambaran secara analisis atau terurai tentang proses 4. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI  . proses kerja yang kurang komunikatif.49 tahun 14 menit 15 menit 2090 m 1850 m 2250 m 18 .29 tahun 12 menit 13 menit 2400 m 30 . Tabel adalah daftar yang berisi ikhtisar dan sejumlah data informasi. teknologi. sungai. untuk membantu untuk membantu memperjelas proses kerja. biasanya berupa Kelamin kata-kata dan bilangan yang tersusun secara bersistem. sifat permukaan. yangteknologi dan masyarakat manusia.246.5 Km slm 12 menit Usia 30 . urut ke bawah dalam lajur dan deret tertentu dengan garis pembatas untuk Jarak yang Ditempuh simak. batas. Peta Peta adalah gambar atau lukisan pada kertas yang menunjukkan letak tanah.

Contoh: 0 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . peta. jalan.Contoh : 6. atau gambar rancangan bangunan. denah Denah adalah gambar yang menunjukkan letak kota.

7. kita perlu berlatih dengan saksama. Bentuk-bentuk pengungkapan informasi baik yang verbal maupun nonverbal masingmasing selalu membutuhkan penyampaian informasi. setelah disimak. cobalah perhatikan: Apa isinya. Itulah sebabnya. Kedua. hal itu bukan hal yang tidak dapat dilakukan. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI  . Contoh: Program Kerja Bimbingan Konseling SMK Mitra Kencana Jakarta No 1 2 3 4 5 6 7 8 9 Nama Kegiatan Penyusunan Personil Bimbingan Konseling Konsultasi Program Pengadaan Sarana Prasarana Layanan Bimb. Pengalihan informasi Verbal menjadi Nonverbal Informasi yang kita simak perlu ditelaah isinya berdasarkan kepentingan atau maksud yang terkandung di dalamnya. Kerja sama dengan orang tua Laporan Bulan Semester Evaluasi X X X Juli X X X X X X X X X X X X X X X X X Agust Sept X Okt X Nov X Des X Ket X 10 Analisis 11 Tindak Lanjut B. bila bahan simakan dapat ditelaah. Adakalanya suatu informasi lebih tepat disampaikan dengan penyajian verbal karena lebih memerlukan banyak penjelasan daripada bentuk visual. Matriks Matriks adalah tabel yang disusun dalam lajur dan jajaran sehingga butir-butir uraian yang diisikan dapat dibaca dari atas ke bawah dan dari kiri ke kanan. Namun. Tapi pada dasarnya semua itu bergantung pada kebutuhan. ada informasi yang lebih mudah dicerna karena disajikan dalam bentuk nonverbal. simaklah isi informasi dengan penuh perhatian. Namun. Cara pertama. bagaimana uraiannya. dan dapatkah divisualisasikan. Proses mengubah isi informasi verbal menjadi nonverbal memang agak sulit. Konseling Instrumen Bimbingan Pengembangan Sistem Prog.

602 atau 33. diagram dan yang lainnya. Yudhoyono-Yusuf Kalla menempati urutan pertama dengan perolehan suara sebanyak 35.501 atau 22. apakah grafik. atau grafik dibuat dengan baik. atau bentuk untuk menggambarkan atau membedakan data-datanya.27% dari total perolehan suara. Buatlah bentuk nonverbal yang tepat untuk mengungkapkan informasi tersebut. 3. Perhatikan contoh perubahan informasi verbal menjadi informasi nonverbal di bawah ini! Contoh I. 1. 2. Megawati-Hasyim menempati urutan kedua dengan perolehan suara 27. benar.687. Tentukan warna.583.60% dari total perolehan suara. 6. Inti dari informasi verbal di atas. lambang. Urutan keempat ditempati Amien Rais-Siswono dengan perolehan jumlah suara sebanyak 15.08% dari total perolehan suara sedangkan duet HamzahAgum menempati urutan terakhir.706 atau 26.602 atau 33. 3. Perhatikan data-data berupa lambang. 5. Total perolehan suara yang telah terkumpul sampai 19 Juli 2004. Urutan ketiga ditempati oleh Wiranto-Salahuddin dengan perolehan suara sebanyak 23.  Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .687.20%. tabel.800.60%.Hal-hal yang perlu diperhatikan untuk mengalihkan atau mengubah informasi verbal ke informasi nonverbal.910.979 atau 14.910. adalah sebagai berikut. tepat.20% dari total perolehan suara. Gambar. satuan atau angka-angka serta perbandingannya untuk menentukan bentuk visual yang efektif. 2. Megawati-Hasyim menempati urutan kedua dengan perolehan jumlah suara sebanyak 27.706 atau 22. Penghitungan suara sementara putaran pertama pemilu Presiden 2004 Yudhoyono-Kalla menempati urutan pertama pemilu dengan perolehan suara sebanyak 35. Catatlah hal-hal pokok atau inti dari informasi yang disimak. Berdasarkan penghitungan suara sementara putaran pertama pemilu Presiden 2004.247 orang. bagan. 1. pukul 21.00 adalah 106. Perhatikan dengan saksama isi informasi verbal yang ingin diubah.228. dan seimbang dengan isi. 4. adalah sebagai berikut. Informasi tentang penghitungan suara pemilu Presiden 2004.

dia akan melanjutkan sekolah ke perguruan tinggi.745.87%) PEMILU PRESIDEN RI 2004 Perhitungan Suara Sementara Putaran Pertama Total: 106.253.836 (26.80%. 5.2. suara 7. dia akan kursus desain grafis saja.20%.Amien-Siswono memperoleh jumlah suara 15. 2: Vika.014 atau Hamzah-Agum menempati terakhir dengan dengan jumlah perolehan 3. Akan tetapi.60%. dia mengikuti kursus komputer dan bahasa Inggris. 22. Amien-Siswono memperoleh jumlah suara 15. “Calon animator profesional” tersebut telah merencanakan setamat pendidikan nanti. 23.80%.20%.583.247 orang.983. jika kedua keinginannya tersebut tidak dapat terpenuhi.58%) 27.014 (3.484 (22.979 atau 14. adalah 106.645.228. 14. 6.687.Wiranto-Salahuddin berada diurutanurutan ketiga dengan perolehan23. Sampai Pukul 21.583.501 atau Wiranto-Salahuddin berada di ketiga dengan perolehan suara suara 4.06%.058 (100%) ContohContoh II. 7. Dengan mengikuti Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI  . dia memilih sekolah di SMK jurusan Grafika.501 atau 22.20%.826.454.06%. 3. 4.00 106. yaitu: Bentuk informasi nonverbalnya berupa diagram seperti berikut.00 adalah Total perolehan suara yang terkumpul sampai 19 Juli 2004 pukul 21. Jika keuangan keluarganya tidak memungkinkannya untuk kuliah.979 atau 6.06%) 35.Hamzah-Agum menempati urutan urutan terakhirjumlah perolehan suara 3.014 atau 3. jika kondisi sangat memungkinkan.800. Jurusan yang akan diambilnya adalah desain grafis. Penghitungan suara sementara putaran pertama pemilu Presiden 2004 Yudhoyono-Kala menempati urutan pertama pemilu dengan perolehan suara sebanyak 35.602 atau 33.00 WIB Contoh II perubahan informasi verbal menjadi informasi nonverbal : Yudhoyono-Yusuf Kalla (4) Megawati-Hasyim (2) Wiranto-Salahuddin (1) Amin Rais-Siswono (3) Hamzah-Agum (6) 3.526 (14. bercita-cita menjadi animator profesional.Total perolehan suara yang terkumpul sampai 19 Juli 2004 pukul 21.198 (33.253. 5.706 atau 22. Selain sekolah dan magang yang telah ditetapkan sebagai program sekolah.29%) 23. Untuk itu. Bentuk informasi nonverbalnya berupa diagram. untuk menunjang cita-citanya tersebut.21%) 15. Megawati-Hasyim menempati urutan kedua dengan perolehan suara 27.800. siswi Kelas 1 SMK.228.247 orang. 3. dia akan mengikuti balai latihan kerja (BLK) terlebih dahulu sebelum terjun ke dunia kerja.910.253.

4. 1. Vika yakin akan mudah mendapat pekerjaan karena peserta pelatihan di BLK akan disalurkan kerja sesuai dengan bidang keahliannya masingmasing. yang penting dia dapat menabung untuk dapat meraih cita-citanya kelak. terpaksa dia langsung bekerja di mana saja dalam bidang apa saja. Vika berencana melanjutkan ke perguruan tinggi jika ada biaya. Inti dari informasi di atas seperti berikut. Tamat SMK. Tekadnya. Vika bercita-cita menjadi animator profesional. 2. Bila ikut pelatihan di BLK pun tidak memungkinkan karena kondisi keuangan keluarganya. Vika mengikuti latihan balai kerja (BLK). 3.BLK. Bentuk Informasi Nonverbal yang cocok dari informasi di atas adalah bagan. Vika memilih sekolah di SMK jurusan Grafika. Jika biaya tidak memungkinkan. yaitu:  Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .

Terakhir adalah pasangan Hamzah Haz dan Agum Gumelar.20 persen. Menyampaikan Pendapat melalui simpulan secara deduktif dan induktif Penyimpulan secara deduktif ialah cara mengambil simpulan dari pernyataan yang bersifat umum diikuti oleh uraian atau pernyataanpernyataan yang bersifat khusus. Negara adalah institusi mapan. tetapi dinamis sehingga mampu mengantisipasi segala perubahan yang terjadi.  .C. Dalam dunia karya sastra memang terdapat larangan keras untuk pengarang plagiat. Perhatikan contoh berikut. Demikian juga seniman akan menggoreskan lukisan di dasar kain dengan imajinasinya ke arah yang sebenarnya. Ia menyediakan kerangka umum yang bersifat abstrak sehingga terbuka untuk ditafsirkan. Plagiat tidak diperkenankan dalam dunia sastra. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2.60 persen. 1. Peringkat pertama diraih oleh pasangan Susilo Bambang Yudhoyono dan Jusuf Kalla dengan persentase suara terbanyak. Negara mewadahi seluruh kepentingan masyarakat. sebagai penyelenggara negara dalam jangka waktu yang ditetapkan oleh konstitusi negara. yaitu 33. Perhatikan contoh berikut. Banyak karya sastra yang beredar merupakan karya plagiat. barulah tercermin sebuah puisi. Disusul peringkat ketiga yaitu pasangan Wiranto dan Salahudin. 2. Memang benar imajinasi itu diperlukan yang mencipta suatu karya. Penyimpulan secara induktif ialah cara mengambil simpulan dari pernyataan-pernyataan atau fakta-fakta yang bersifat khusus menuju ke suatu simpulan yang bersifat umum. Plagiat ialah pengambilan atau penerjemahan sesuatu hasil begitu saja dengan tidak menyebutkan pengarang asli melainkan menurunkan nama sendiri sebagai pengarang. Hasil perolehan suara sementara dari penyelenggaraan pemilu pemilihan presiden tahun 2004 cukup signifikan. 1. Penyair akan membuat sebuah puisi dengan cara menuangkan imajinasinya. Selanjutnya peringkat keempat ialah pasangan Amin Rais dan Siswono. Pengarang novel akan merangkai ceritanya dengan pengembangan imajinasi. Sementara pemerintah adalah pranata kontemporer. Peringkat kedua diraih oleh pasangan Megawati dan Hasyim Muzadi dengan persentase suara 22.

berusaha menuntaskan kesepakatan pembangunan fisik jalan tol. Opini dapat juga disebut pendapat seseorang. Fakta Harga tanah yang dibebaskan ditetapkan Rp 80. harapkan mampu mendorong akselerasi pertumbuhan perekonomian kawasan. Simpulan yang di dalamnya terdapat opini dapat dilihat pada contoh di bawah ini. Fakta bersifat objektif.Menyampaikan simpulan dapat dilakukan secara lisan maupun tulisan. Jalan tol Gempol–Pasuruan di. Di Gedung Grahadi Surabaya dilangsungkan penandatanganan kesepakatan bersama. Simpulan dapat disertakan dengan opini atau pendapat. merupakan kenyataan bersifat konkret dan dapat dibuktikan kebenarannya. ia berencana setelah lulus sekolah akan kuliah pada jurusan desain grafis. ia juga mengikuti kursus komputer dan bahasa Inggris. Di samping itu.000. Bila tak memungkinkan.. 2. Penyampaian harus menggunakan bahasa Indonesia yang baik dan benar. Simpulan yang disampaikan dapat diperoleh dari informasi lisan maupun tulisan baik informasi lisan yang bersifat verbal maupun informasi tulisan yang berbentuk nonverbal.000 per meter persegi. Ia pun masuk ke SMK Grafika.hingga Rp 400. Antonim dari opini adalah fakta. Sungguh begitu kuatnya keinginan Vika dalam mengapai citacitanya sehingga segala kemungkinan jalan yang terbaik akan dia tempuh. Untuk mencapai keinginannya itu. Perhatikan tabel berikut. Pemkab. Jika tak mampu kuliah. ia berencana kursus desain grafis atau mengikuti balai latihan kerja (BLK). Opini adalah pandangan berdasarkan ideologi atau sikap seseorang dalam memberikan suatu wawasan terhadap objek atau peristiwa.2. Vika bercita-cita menjadi animator profesional.  Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . ia akan bekerja apa saja untuk mengumpulkan uang biaya kuliah. Pendapat/Opini 1. Jasa Marga 1. dan PT. Contoh 1.

dan menyimak untuk pemecahan masalah. jika pun tak bisa. Namun. tabel. tabel. apakah grafik. Semua itu dilakukan atas dasar dorongan yang kuat untuk mencapai cita-citanya. RANGKUMAN A. Ada beberapa macam cara menyimak. Kegiatan Menyimak dan Memahami informasi Nonverbal Menyimak adalah kegiatan menyerap informasi yang disampaikan secara lisan dengan tidak sekedar menggunakan indera pendengaran tapi juga berupaya menangkap isi atau pesan serta memahami makna informasi yang disampaikan. Jika tak bisa ia mau mencoba kursus desain grafis atau masuk balai latihan kerja. dan matriks. Informasi nonverbal ialah informasi berbentuk visual seperti grafik. menyimak diskriminatif. Contoh kedua ialah simpulan yang diuraikan secara induktif dengan penambahan kalimat opini sebelum kalimat terakhir yang merupakan simpulan umum. yaitu: 1. ia kemungkinan akan bekerja dulu dalam rangka mengumpulkan uang untuk biaya kuliah pada jurusan yang sama. Ia bercita-cita menjadi animator profesional. denah. 2. Saat ini pun ia masuk SMK jurusan Grafika. Perhatikan dengan saksama isi informasi verbal yang ingin diubah. B. diagram dan yang lainnya. diantaranya adalah menyimak intensif. Informasi dapat berbentuk verbal dan nonverbal. menyimak ekstensif. Informasi verbal ialah informasi berbentuk uraian atau penjelasan. Contoh pertama ialah simpulan yang diuraikan secara deduktif dengan penambahan opini atau pendapat di bagian akhir paragraf.Contoh 2. diagram. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI  . Perhatikan data-data berupa lambang. satuan atau angka-angka serta perbandingannya untuk menentukan bentuk visual yang efektif. Niat Vika setelah lulus sekolah akan meneruskan kuliah ke jurusan desain grafis. Pengalihan informasi Verbal menjadi Nonverbal Hal-hal yang perlu diperhatikan untuk mengalihkan informasi verbal ke informasi nonverbal. bagan. peta.

Penyimpulan secara induktif yaitu cara mengambil simpulan dari pernyataan-pernyataan atau fakta-fakta yang bersifat khusus menuju ke suatu simpulan yang bersifat umum. Gambar . 6. Simpulan dapat disertakan dengan opini atau pendapat. Setelah menyimak lakukan hal berikut. Catatlah pokok-pokok informasi. 1. 3. 4. 5. buatlah informasi berbentuk nonverbal ! Susunlah sebuah simpulannya secara deduktif atau induktif yang disertakan opini Anda. C. Buatlah bentuk nonverbal yang tepat untuk mengungkapkan informasi tersebut. atau bentuk untuk menggambarkan atau membedakan data-datanya. atau grafik dibuat dengan baik. TUGAs MANdiRi: Mintalah salah seorang siswa membacakan wacana yang terdapat di awal bab. lambang. Menyampaikan Pendapat melalui simpulan secara deduktif dan induktif Penyimpulan secara deduktif yaitu cara mengambil simpulan dari pernyataan yang bersifat umum diikuti oleh uraian atau pernyataanpernyataan yang bersifat khusus. Dari pokok informasi yang dicatat. benar. dan seimbang dengan isi. Simpulan yang disampaikan dapat diperoleh dari informasi lisan maupun tulisan baik informasi lisan yang bersifat verbal maupun informasi tulisan yang berbentuk nonverbal.3. sedangkan siswa lainnya menyimak. tepat.  Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . 2. bagan. Catatlah hal-hal pokok atau inti dari informasi yang disimak. Tentukan warna-warna.

narasi d. surat edaran c. grafik batangan c. tabel c. grafik garis d. persuasi c. denah e. argumentasi b. bagan pohon Informasi nonverbal diperlukan bila data informasi membutuhkan a. 1. grafik lingkaran b. eksposisi e. visualisasi d. diagram b. surat pengumuman e. persentase e. perincian b. bagan arus e. alasan-alasan Berikut ini yang termasuk perintah kerja tertulis. deskripsi Lukisan naik turunnya data yang berupa batang atau balok dan dipakai untuk menekankan adanya perbedaan tingkat atau nilai dari berbagai aspek disebut a.  . 5. peta Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2.UJi KOMPETENsi i. surat pengiriman barang Gambaran informasi yang berbentuk garis-garis menaik dan menurun disebut a. 4. grafik lingkaran d. penjelasan c. 3. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! Menyusun kesimpulan dengan cara induksi atau deduksi kita lakukan bila membuat karangan a. buku manual kerja d. kecuali a. memo b.

bom yang ditempatkan di pinggir jalan meledak. kecuali Produksi Produksi padi ( juta ton kg ) Produksi Beras ( Juta ton ) Impor Beras ( Juta Ton ) Pengadaan Beras ( Juta Ton ) Tahun 1996 51.56 2002 51. membaca tabel memerlukan kecermatan dan kepekaan berpikir d.30 saat serangan terjadi. Produksi beras impor dan pengadaan beras! Pernyataan berikut sesuai dengan tabel tersebut. b.32 0. tabel ialah informasi tanpa kalimat penjang dan tanda baca c. c. d. kecuali a. 8. Ketika kendaraan mereka melintas. a. Siswa tim PBB yang lalu. e. d. Tingginya produksi beras seiring dengan tingginya pengadaan beras. tabel ialah informasi lewat kata dan bilangan yang tersusun b.81 35. Impor beras tertinggi terjadi pada kondisi beras tinggi.5 37.17 33.5 33. b. Menurut polisi insiden itu tidak menimbulkan korban. e.22 2. Tentara AS sedang melakukan patroli sekitar pukul 21.28 2004 54.36 1999 50.6.87 33.14 35.47 1. Ledakkan itu menimbulkan lubang di jalan dan menghancurkan jendela di kawasan pemukiman dekat markas pasukan AS.49 33.06 4.69 7. 0 Makin tinggi produksi padi makin rendah impor beras. c. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .34 45. Impor pengadaan beras terjadi ketika terjadi pengadaan beras terendah. tabel dapat merupakan sumber gagasan e. Kondisi produksi beras paling tinggi justru pengadaan beras terendah. Semua pernyataan di bawah ini benar. tabel disusun setiap kita membuat karangan Pernyataan-pernyataan berikut yang merupakan opini adalah a.

Paragraf yang dimulai dengan pernyataan yang khusus dan diikuti penjelasan yang bersifat umum disebut a. kecuali a. menghemat waktu karena mempercepat komunikasi c. sebab akibat 11. Pernyataan di bawah ini yang tidak tepat adalah . Pernyataan yang dimulai dengan pernyataan yang bersifat umum dan diikuti penjelasan yang bersifat khusus disebut a. menunjukkan fakta dengan jelas b. mendengarkan sambil berkreatifitas dapat membantu mencapai hasil yang baik dalam menyimak d. mengungkapkan informasi dapat berbentuk verbal dan nonverbal b.. deduktif-induktif e. induktif– deduktif 10. menyatakan fakta-fakta dalam konteks d. menunjukkan fakta-fakta itu lebih mudah 13. biasanya kita menggunakan a. deduktif c. deduktif b. diagram Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI  . a. akibat sebab e. induktif b.. proses menyimak adalah upaya memahami isi pesan dari informasi yang didengarkan 12. menyatakan fakta-fakta lebih tersamar e. menyimak adalah kegiatan menyerap informasi yang didengarkan e. induktif-deduktif d. peta c.9. Di bawah ini merupakan kegunaan tabel dan grafik. induktif c. denah b. Bila ingin menggambarkan data berupa program kerja.. sebab akibat d. grafik d. matriks e. mendengar adalah bagian dari menyimak c.

intensif c. untukmenilai  Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Menyimak untuk memahami secara terperinci. denah d. mengemukakan tanggapan sesuai dengan instruksi yang disampaikan b. tabel 16. kecuali a. memahami informasi yang didengarkan e.14. apresiatif c. apresiatif 18. denah e. cerpen. laut. pemecahan masalah e. peta b. untuk menghibur b. Menyimak dianggap berhasil bila diukur dari hal berikut. bagan c. matriks c. Gambar atau lukisan pada kertas yang menunjukkan letak tanah. Menyimak pembacaan puisi. dapat mengutarakan kembali informasi yang didengar dengan makna yang sesuai 17. sungai. diskriminatif e. membuat kesimpulan dengan menguraikan inti pokok informasi yang disampaikan d. peta d. gunung disebut a. Gambaran buram sketsa istilah lain dari a. diagram b. diagram e. dan mendalam bahan yang disimak adalah jenis menyimak a. diskriminatif d. ekstensif b. dapat mengaktualisasikan informasi baik lisan maupun tulisan c. untuk belajar d. bagan 15. teliti. termasuk jenis menyimak a.

kecuali a. Apa yang kamu ketahui tentang denah? Jelaskan! 7. artikan hubungan antar–lambang atau angka e. Jawablah soal-soal di bawah ini dengan tepat dan benar! Sebutkan langkah-langkah yang harus dilakukan agar dapat mengungkapkan kembali informasi yang disimak! 2. Apa yang dimaksud paragraf deduktif? 9. persuasi e. Apa yang kamu ketahui tentang grafik? 5. 1. Untuk mengambil kesimpulan dari informasi nonverbal diperlukan hal-hal berikut. Karangan/tulisan yang memerlukan analisis dan sintetis dapat ditulis dalam bentuk a. Berikan masing-masing contoh informasi verbal dan nonverbal! 10. perhatikan isi informasi b. Sebutkan macam-macam grafik! 6. narasi c. deskripsi 20. ii. perhatikan kata-kata dan angka-angka c. Jelaskan perbedaan grafik dan peta! 8. Jelaskan hal-hal yang perlu dipertimbangkan untuk mengalihkan informasi verbal ke nonverbal! Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI  . Jelaskan perbedaan informasi berbentuk verbal dan nonverbal! 3. lihat model dan warna gambarnya d. perhatikan antar–bagian-bagiannya.19. eksposisi b. argumentasi d. Hak apa saja yang harus dilakukan agar menyimak mencapai hasil yang baik? 4.

 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .

kita akan mempelajari hal-hal yang berkaitan dengan perintah kerja dari penjelasan mengenai pengertian serta ciri kalimat perintah. Standar Kompetensi Kompetensi Dasar - Berkomunikasi dengan bahasa Indonesia setara tingkat madya Menyimak untuk memahami perintah yang diungkapkan atau yang tidak dalam konteks bekerja - Indikator - Merumuskan kembali isi perintah (secara lisan maupun tulisan) Menuliskan kembali isi perintah dalam bentuk kerangka atau bagan Menyebutkan kegiatan yang akan dilakukan berdasarkan isi perintah secara lisan/tertulis Mengonfirmasikan kebenaran rencana kegiatan yang telah direncanakan dengan rencana pemberi perintah Pada bab ini. mencatat. dan berbagai respons terhadap perintah. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 25 . dan mengonfirmasikan kembali isi perintah dengan membuat kerangka kegiatan dan perencanaan sesuai kebenaran isi perintah kerja yang diberikan.BAB 2 MENYIMAK UNTUK MEMAHAMI PERINTAH YANG DIUNGKAPKAN ATAU YANG TIDAK DALAM KONTEKS BEKERJA. Tujuan mempelajari bab ini ialah agar kita dapat memahami berbagai bentuk perintah yang diungkapkan atau tidak serta dapat merumuskan. jenisjenis kalimat perintah.

26 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Jangan ragu-ragu untuk menyediakan waktu makan siang dengan orangorang ini.Wacana Sukses Memulai Karir bagi Pemula Di dunia kerja memang berbeda dengan dunia pendidikan. teman satu departemen atau dari departemen lain yang mempunyai hubungan erat dengan pekerjaan Anda). menyenangkan. 1. atau membuat Anda bertanya-tanya. pimpinan proyek). dekati mereka-mereka yang akan sering Anda temui (misalnya. agar Anda bisa bertahan dengan pekerjaan yang akan digeluti. sesungguhnya Anda baru tiba di dunia nyata tempat Anda harus memulai hidup baru dan karir profesional Anda. sebaiknya Anda perlu mengetahui informasi seputar hari-hari awal meniti karier. para pembuat keputusan (misalnya. Supaya bisa diterima oleh lingkungan baru. misalnya apa saja yang boleh dan tidak boleh dilakukan. Ibaratnya Anda sedang berada di persimpangan. kepercayaan dan informasi akan datang dengan sendirinya. Bisa juga semua perasaan itu bercampur aduk menjadi satu. Dengan membangun hubungan. Karena itu. membingungkan. perjalanan selanjutnya mungkin bisa menakutkan. Ketika memasuki dunia kerja. Jika tidak. Makin banyaknya tenaga kerja yang berkualitas menuntut Anda untuk secepatnya menyesuaikan diri dengan tempat kerja baru. dan orang-orang yang berpotensi menjadi mentor Anda. Pertama. Untuk berhasil. Berikut adalah strategi bagaimana Anda harus bersikap selama 60 hari pertama di tempat kerja baru. Mungkin saja karier Anda akan melesat dan berada di jalur cepat. persaingan antar–perusahaan makin ketat. diperlukan kombinasi antara performa dan kepribadian. sering-seringlah menghabiskan waktu dengan rekan-rekan yang dapat memberi tahu kita peraturanperaturan informal di dalam perusahaan. Saat ini. 14 Hari Pertama: Pengenalan Rekan-Rekan Kerja. Persaingan tenaga kerja untuk mendapatkan pekerjaan pun demikian. Tujuannya tak lain adalah untuk mengetahui rule-of-the-game yang berlaku di tempat baru tersebut. Anda akan tersingkir dan gagal untuk meniti karier yang diidamkan.

4. tanyakan apakah ada kemajuan dalam pekerjaan Anda? Kebanyakan orang yang diterima bekerja di tempat baru mengira atasan mereka tahu persis apa saja kemajuan yang telah mereka alami. Bagaimanapun juga atasan pasti ingin Anda sukses sebab kesuksesan Anda secara tidak langsung akan berakibat positif pada dirinya. Karena itu. jangan takut bertemu atasan untuk menanyakan penilaiannya atas kinerja Anda. Anda harus berhati-hati. jangan pilih pekerjaan yang hanya Anda yang terlibat karena hanya akan memakan waktu lebih lama dan mungkin tidak akan mendapat dukungan dari atasan Anda. temui atasan Anda dan diskusikan hal ini dengannya. 60 hari pertama: Selesaikan pekerjaan dengan baik. Intinya adalah berusaha melakukan hal yang sama (dengan semangat yang sama) sebagaimana Anda bekerja di dua bulan pertama. 30 hari pertama: Bertemu atasan. Memang. Setelah satu setengah bulan di posisi baru. Hal ini untuk menyamakan persepsi Anda berdua tentang bagaimana menyelesaikan tugas-tugas di posisi Anda yang dapat diterima oleh bos Anda. Memperluas pergaulan hingga mempunyai banyak teman dari perusahaan lain juga dapat menunjang usaha Anda. harusnya Anda sudah tahu tanggung jawab apa saja yang harus Anda emban. Tentu saja sikap dan cara berpikir ini fatal karena atasan tidak selamanya mengikuti perkembangan anak buahnya secara detail. Namun. Hal ini diperparah oleh ketakutan kalau-kalau tugas kita dianggap tidak dikerjakan dengan benar. Pilih proyek pekerjaan yang masuk akal dan bisa diselesaikan dengan tepat waktu. buat kerangka kerja berdasarkan landasan yang telah Anda ciptakan di 60 hari pertama tersebut. Kemudian. Ambilah proyek-proyek yang melibatkan orang lain dalam tim Anda. 45 hari pertama: Tulis dan pahami deskripsi pekerjaan Anda.2. 60 hari kemudian: Penyegaran Untuk melakukan hal ini. Sebagai contoh. Ingatlah selalu bahwa Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 27 . 3. Tulis pertanyaanpertanyaan yang terlintas di benak Anda di atas sebuah kertas. berikut dengan daftar proyek-proyek yang telah Anda tangani. sebenarnya susah-susah gampang. Kemudian. 5. Anda harus melakukan pekerjaan yang cukup sulit untuk membuat orang lain terkesan.

18 November 2007) A. Ciri-ciri kalimat perintah adalah seperti berikut. jadi jangan cepat puas! (Sumber: Kompas. Contoh: 1. Pengertian dan Ciri Kalimat Perintah Kalimat perintah adalah kalimat yang berisi perintah kepada orang lain untuk melakukan sesuatu atau kalimat yang dipakai untuk mendapatkan tanggapan sesuai dengan kehendak penuturnya.memberikan atau menerima feedback dan menentukan posisi Anda di kantor adalah proses yang terus berlanjut. Santaplah makanan itu! Menggunakan tanda seru (!) bila digunakan dalam bahasa tulis. Pergilah dari sini! 2. Ayo masuk! 3. Kalimat Perintah Biasa Contoh. Ambilkan buku itu! 2. Cepatlah kamu mandi! 3. Pulanglah! Kalimat perintah jika dilisankan berintonasi menaik di awal dan berintonasi rendah di akhir. Selesaikan tugasmu! 2. Contoh: 1. 28 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Contoh: 1. Contoh : 1. 3. Bawa barang-barang itu kemari! 2. Pergilah dari sini! 2. Jenis-Jenis Kalimat Perintah 1. B. Bantulah adikmu! Berpola kalimat inversi (PS). 1. 4. Menggunakan partikel –lah.

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 29 . Saya mohon kamu bisa datang di acara pesta ulang tahunku. Kalimat Perintah Larangan Contoh: 1. Marilah kita gunakan tekstil buatan dalam negeri demi menyukseskan program pemerintah. 2. Maju kalau kamu berani. Kalimat Perintah Ajakan Contoh: 1. tunjukkanlah jalan yang lurus yang Engkau ridhoi. Biarkan dia pergi sendiri. Biarlah aku yang membawa barang itu. Kami mohon kepada-Mu. 2. Saya minta kerjakan tugasmu tepat waktu. 6. Masukkan barang-barang ini ke dalam bagasi mobil! 2. Kalimat Perintah Sindiran Contoh: 1. 2. 2. Saya berharap Anda hadir di acara itu. Jangan membuang sampah di sini. Ayolah bersenam pagi setiap hari agar badan kita menjadi sehat. 3. Antarkan surat ini kepada Pak RT sekarang juga! 2. Jangan dekati tempat itu. Kalimat Perintah Permintaan/Larangan Contoh: 1. Kalimat Perintah Permohonan Contoh: 1. 7.1. 2. 5. 4. Kalimat Perintah Pembiaran Contoh: 1. ya Tuhan.

Hendaknya kamu pulang sekarang. Ambil saja kado yang kauberikan kalau kau tidak malu terhadapnya. Menggunakan partikel –lah. 7. 3.2. 30 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . 2. sudilah. Sudilah Anda membantu saya menyelesaikan tugas ini. 1. 2. Silakan masuk. Kalimat perintah dapat diperhalus dengan menggunakan unsur-unsur berikut. Contoh: 1. 5. Sebaiknya cepat bawa adikmu ke rumah sakit. Kalimat perintah beragam jenisnya mulai dari yang kasar sampai yang halus. Bahkan karena halusnya sering orang tidak menyadari bahwa hal tersebut berupa perintah. 2. Susunlah sehingga membentuk lingkaran penuh. 2. Harap datang tepat waktu 6. Hendaknya Anda bersedia menjadi pengurus kegiatan itu. 4. Contoh: 1. Terima kasih Anda tidak menolak untuk menjadi pembawa acara pada malam reuni nanti. 9. Tolong buatkan kopi untuk Ayah. 8. sebaiknya. Kalimat Perintah yang Menuntut Proses atau Langkah Kerja Contoh: 1. Urutlah dari nomor kecil hingga nomor yang besar. Berangkatlah lebih halus daripada berangkat. Menggunakan kata-kata seperti mohon. tolong. silakan. harap. Kalimat Perintah yang Berbentuk Kalimat Berita Contoh: 1. Mohon kembalikan buku itu di meja saya. hendaknya.

Langkah yang perlu kita tempuh dalam menanggapi perintah adalah sebagai berikut. bentuk-bentuk perintah umumnya bersifat operasional kerja sehingga perintah tidak sertamerta bisa secara langsung dilaksanakan. bentuk-bentuk perintah pun sudah menjadi suatu hal yang pasti dan selalu ditemui. sebenarnya pada lingkungan kalangan tertentu. dan saksama. Namun. (3) Isi perintah ditulis dalam bentuk kerangka/bagan sehingga mudah dipahami. teliti. Pengubahan ke struktur berita. (4) Membuat perencanaan dalam bentuk kerangka/tabel/bagan segala kegiatan yang akan dilakukan dalam rangka memenuhi perintah. Dalam dunia kerja. Pengubahan ke struktur tanya. Sebagai alat komunikasi. tentu bahasa harus dapat menerjemahkan segala bentuk keinginan dan pilihan pemakainya. seperti di dunia kerja. Hanya dalam skala umum perintah yang biasa yang langsung bisa ditanggapi. Oleh karena itu. C. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 31 . bahasa perintah perlu dicermati karena belum tentu dipahami sebagai perintah biasa. Berbagai Respons terhadap Perintah Sejalan dengan bervariasinya kepentingan manusia terhadap manusia yang lain sebagai wujud dinamika hubungan antar–manusia. termasuk keinginan mendapatkan respons dari sebuah perintah yang disampaikan baik secara lisan maupun tertulis. kita perlu mencermati dan mengenal bentuk-bentuk perintah agar respons yang dilakukan tidak menyimpang dari isi perintah. (1) Membaca kembali isi perintah secara hati-hati. Contoh: − Panitia sangat gembira jika Bapak/Ibu berkenan hadir pada acara perpisahan.3. Contoh: − Apakah tidak ada petugas piket yang menghapus papan tulis? 4. (2) Merumuskan/menuliskan kembali isi perintah. Banyak ragam kalimat perintah menunjukkan banyaknya bentuk perintah yang diwujudkan melalui simbol bahasa.

Mulai saat ini. Dalam rangka memperingati HUT SMK Nusantara 1 Bumiayu. Perhatikan dengan cermat proses menerima perintah kerja di bawah ini dan respons yang dilakukan.(5. Pengurus OSIS mencatat isi instruksi/perintah Pembina OSIS sebagai berikut. saya ingin Ketua OSIS dan pengurus seksi mulai mempersiapkan segala sesuatunya. Pembina OSIS mengumpulkan beberapa pengurus OSIS. 32 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Saya berharap seminggu sebelum acara. Menghubungi pihak yang terkait dengan kegiatan. Demikian pertemuan kita. semuanya sudah siap. Saya minta seluruh pengurus OSIS terlibat menyukseskan acara ini. b. beliau menjelaskan bahwa OSIS akan mengadakan pentas seni dan bazar untuk merayakan Hari Ulang Tahun ke-20 Sekolah. e. Membuat bagan atau struktur kerja. Kemudian. Berhubung masih ada waktu satu bulan. Sosialisasi kegiatan kepada siswa dan komite sekolah.) Meminta konfirmasi kepada pemberi perintah akan ketepatan rencana kegiatan yang telah disusun. c. Menggalang dana dengan menghubungi sponsor untuk meminta dukungan. g. seperti membuat kepanitiaan lalu menyusun rencana kerja dan struktur kerja. Membuat jadwal kegiatan. h. Jika diperlukan. kalian bisa bekerja sama dengan sponsor atau dunia usaha yang menjadi anggota majelis sekolah kita untuk membantu pendanaan dan penyediaan barang buat bazar. Klarifikasi dan konfirmasi. d. a. Membuat kepanitiaan kegiatan bazar-amal. Membuat proposal kegiatan. kita saling berkomunikasi untuk mempersiapkan segalanya hingga menjelang pelaksanaan acara. Beliau melanjutkan: ”Dalam rangka HUT sekolah kita. selamat bekerja! 1. OSIS akan mengadakan kegiatan Pentas Seni dan Bazar. f. Segala hal yang masih belum jelas dapat dikonfirmasikan kepada saya.

6. dan (4) garis hubungan kerja dan wewenang yang jelas. Pembina OSIS Ketua OSIS Ketua Panitia Seksi-Seksi Siswa Sponsor d. (3) siapa bertanggung jawab terhadap pekerjaan apa dan kepada siapa. Ketua OSIS dan sekretaris menyusun jadwal kerja. 3. No. dibuat pula struktur atau prosedur kerja yang mengatur: (1) siapa mengerjakan apa. 4. 1. (2) siapa bekerja sama dengan siapa.2. Agar proses kerja berjalan lancar. Semua hal tersebut dapat divisualisasikan dalam bentuk bagan seperti di bawah ini. Ketua OSIS beserta panitia kegiatan mengkonfirmasikan Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 33 . 5. 2. Nama Kegiatan Rapat pembentukan panitia Pembuatan proposal Sosialisasi ke seluruh siswa Menghubungi sponsor Pertemuan dengan sponsor Evaluasi √ √ √ √ √ √ √ √ Minggu 1 2 3 4 Keterangan 3.

4. Pertanyaan untuk konfirmasi dapat seperti berikut. RANGKUMAN A. Pengertian dan Ciri Kalimat Perintah Kalimat perintah adalah kalimat yang berisi perintah kepada orang lain untuk melakukan sesuatu atau kalimat yang dipakai untuk mendapatkan tanggapan sesuai dengan kehendak penuturnya. (1) (2) (3) (4) (5) (6) (7) Apakah yang sudah dilakukan sesuai dengan perintah? Apakah semua rencana sesuai dengan harapan? Siapa saja yang akan diundang? Berapa banyak sponsor yang akan dilibatkan? Biaya yang disiapkan sudah cukup atau kurang? Acara sesuai dengan tema? Dan sebagainya. Ketua OSIS beserta panitia kegiatan mengonfirmasikan informasi perintah kepada pembina OSIS dengan mengajukan beberapa pertanyaan berkaitan dengan persiapan dan perencanaan yang sudah dan akan dilakukan agar langkah kerja tidak menyimpang. Ciri-ciri kalimat perintah: (1) (2) (3) (4) Menggunakan partikel –lah Berpola kalimat inversi (PS) Menggunakan tanda seru (!) bila digunakan dalam bahasa tulis Kalimat perintah jika dilisankan berintonasi menaik di awal dan berintonasi rendah di akhir B. Jenis-Jenis Kalimat Perintah (1) Kalimat perintah biasa (2) Kalimat perintah ajakan (3) Kalimat perintah larangan (4) Kalimat perintah permintaan (5) Kalimat perintah permohonan (6) Kalimat perintah pembiaran (7) Kalimat perintah sindiran (8) Kalimat perintah yang menuntut proses atau langkah kerja (9) Kalimat perintah yang berbentuk kalimat berita 34 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .

4. (3) Pengubahan ke struktur tanya. (2) Menggunakan partikel –lah. tolong. (4) Pengubahan ke struktur berita. dan saksama. setiap kelompok melakukan langkah-langkah berikut. C. (3) Isi perintah ditulis dalam bentuk kerangka/bagan sehingga mudah dipahami. 2. 1. Berbagai Respons Terhadap Perintah Langkah yang perlu kita tempuh dalam menanggapi perintah: (1) Membaca kembali isi perintah secara hati-hati. (5) Meminta konfirmasi kepada pemberi perintah akan ketepatan rencana kegiatan yang telah disusun. Lalu. (4) Membuat perencanaan dalam bentuk kerangka/tabel/bagan segala kegiatan yang akan di lakukan dalam rangka memenuhi perintah. sudilah. Anggap saja setiap kelompok diperintahkan oleh pembina OSIS/kepala sekolah untuk melaksanakan kegiatan (penentuan jenis kegiatan diserahkan pada kelompok). TUGAS KELOMPOK Bentuklah kelompok terdiri atas 4-5 orang. sebaiknya. teliti. hendaknya.Kalimat perintah dapat diperhalus dengan menggunakan unsurunsur berikut. 5. harap. RW. (2) Merumuskan/menuliskan kembali isi perintah. 3. ( Ilustrasi bisa dikembangkan di luar sekolah. Rumuskanlah hal-hal yang akan dilakukan oleh tim kerja! Susunlah agenda atau jadwal kerja panitia! Buatlah struktur kerja berbentuk bagan! Susunlah daftar pertanyaan untuk konfirmasi! Presentasikanlah di depan kelas semua langkah kerja tersebut! Kelompok lain mengomentari. misalnya di lingkungan RT. (1) Menggunakan kata-kata seperti mohon. silakan. atau kantor) Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 35 .

kecuali a. sebaiknya kami pulang sekarang Berikut ini adalah ciri-ciri kalimat perintah. intonasi keras (terutama perintah biasa dan larangan) b. 4. permintaan e. pemberitahuan Berikut ini merupakan contoh kalimat perintah. bahwa ia boleh datang besok! c. larangan c. biarlah dia bersamaku b. Laporkan segera anggaran pengeluaran bulan ini! Kalimat perintah yang berbentuk kalimat berita a. Siapa yang mengatakan hal itu? d. Kerjakan soal ini sebaik-baiknya! b. 5. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! Jangan mencontek ketika ulangan! Kalimat di atas merupakan contoh kalimat perintah a. perintah biasa d.UJI KOMPETENSI I. permohonan e. 1. ajakan d. kata kerja yang mendukung isi perintah itu biasanya merupakan kata dasar c. perintah biasa b. jangan ada yang pergi dari sini d. Tolong sampaikan kepadanya. Letakkan buku-buku itu di atas meja! e. kecuali a. kami mohon hadirin tenang! Perintah lisan pada kalimat di atas merupakan kalimat a. . permohonan larangan c. memakai intonasi tanya 36 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2. saya harap Anda datang tepat waktu c. 3. harapan Dengan hormat. hendaknya ada yang mengoordinasi kegiatan ini e. permintaan b.

Sudikah Anda mampir ke rumahku? Kalimat perintah berpola kalimat inversi (P-S) a. 8. Sebaiknya. untuk mendapatkan inspirasi 7. b. Pulanglah kamu sekarang. Bantulah aku dalam mengerjakan tugas ini! c. Sebaiknya kita istirahat dahulu. jangan berisik! b. untuk mendapatkan respons berupa jawaban b. untuk mendapatkan informasi c. aku mau pergi. c. Sudahlah. e. uang itu dikembalikan. Bersihkan tempat ini! Kalimat perintah himbauan di bawah ini adalah a. 6. d. Terima kasih Anda tidak menolak. Yang termasuk contoh perintah ajakan terdapat pada kalimat a. Jagalah kelestarian lingkungan kita. Diamlah. Tidurlah. b. 9. Saya mohon Anda mengoordinasi sumbangan ini. Kalimat perintah pembiaran adalah a. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 37 . c. Marilah kita bernyanyi bersama-sama. menyampaikan keinginan e.d. 10. mempergunakan partikel penghalus -lah. e. e. Hendaknya Saudara pikirkan penawaran ini. Simpanlah dokumen ini! c. d. d. Janganlah kauganggu adikmu ! Tujuan kalimat perintah adalah a. berbentuk perintah Kalimat perintah sindiran a. mendapatkan respons berupa tindakan d. 11. Kita berhenti di sini saja. Makanlah hidangan ini! d. Harap wakili saya pada rapat besok! e. Lebih baik kamu berbisnis dalam bidang otomotif. Lestarikan budaya bersih. e. b. hari sudah malam.

membuat perencanaan dalam bentuk kerangka/bagan 13. 12.b. hari sudah malam. Kalimat di atas merupakan contoh kalimat perintah a. Marilah ketetanggamu kalau kauberani. Kalimat di bawah ini yang merupakan kalimat perintah biasa adalah. Makanlah hidangan ini. Contoh kalimat perintah ajakan a. Langkah yang dapat ditempuh dalam menanggapi perintah kecuali a. 15. Kalimat perintah berikut yang dikategorikan kalimat perintah halus a. Per langkah! b. c. Tidurlah. c. merumuskan kembali isi perintah b. Marilah kita gunakan tekstil dalam negeri. c. e. Pergilah sekarang. d. b. Biarkan buku itu di mejaku. mengecek kebenaran kegiatan yang akan dilaksanakan. apakah sesuai perintah d. Saya minta kalian belajar sungguh-sungguh. Sebaiknya Bapak memakai helm demi keselamatan berkendara. kita bersenam pagi agar tubuh kita sehat. Ayolah. 38 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Cepat pergi dari sini! 16. d. b. Ambillah bagian paling bawah hingga atas. pembiaran d. Marilah kita lanjutkan pekerjaan. Sudilah Anda mampir ke rumahku. a. berbentuk berita b. yang memutus proses kerja c. Sebaiknya telepon ia sekarang. membuat perencanaan dalam bentuk karangan e. himbauan 14. Kami berharap Anda datang tepat waktu. ajakan e. e. Antarkan surat ini ke Pak RT. d. isi perintah dituliskan berbentuk kerangka c. e.

e. Hendaknya seorang anak berbakti kepada orang tua! e. Pelajari halaman 10. Saya ingin Anda belajar dengan semangat! b. Mimpi indahlah dalam tidurmu! c. Jagalah bicaramu di mana saja kauberada. Hendaknya selalu waspada dalam segala suasana. Jelaskan pengertian kalimat perintah! Sebutkan ciri-ciri kalimat perintah! Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 39 . 2. Kalimat perintah dengan nada bersahabat a. Tempat ini bukan untuk membuang sampah. Semuanya saya sarankan kembali ke kelas. c. Hadirin saya minta berdiri! c. d. Kalimat perintah yang sepadan dengan kalimat di atas ialah a. Belajarlah hingga akhir hayatmu! b. Berhati-hatilah selama dalam perjalanan! b. b. Di bawah ini yang bukan perintah berisi nasihat ialah a. Kami sangat berterima kasih bila Anda membuang sampah pada tempatnya. Bawa oleh-oleh ini untuk nenekmu. Katakan dengan sejujurnya! 19. Kalimat perintah yang berkesan harapan adalah a. Kami mohon Anda bersedia bekerja di sini. Hapuslah papan itu! e. e. d. e. Jawablah soal-soal di bawah ini dengan tepat dan benar! 1. Tabunglah uangmu untuk simpanan hari tua. II.c. besok ulangan! c. Anda diminta kesediaannya menjadi pembawa acara pada malam reuni nanti. Pulanglah kamu sekarang. 17. d. 18. nenekmu sudah menunggu! 20. Ambillah kembali kado yang kauberikan kalau kamu tidak mau. Pergilah segera. Saya mohon kamu segera melunasi utangmu. Simpanlah baik-baik surat wasiat ini! d. Kerjakanlah soal ini sampai selesai! d.

8. 6. Buatlah dua contoh kalimat berita dan ubahlah menjadi kalimat perintah! Buatlah contoh kalimat perintah sindiran! Sebutkan langkah-langkah yang ditempuh dalam menanggapi perintah agar respons yang dilakukan tidak menyimpang dari isi perintah! Buatlah contoh kalimat perintah pembiaran! Buatlah contoh kalimat perintah himbauan! Buatlah contoh kalimat perintah berpola inverse! Buatlah contoh kalimat perintah larangan! 10. Buatlah kalimat perintah dengan nada bersahabat! 40 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . 4. 5. 7.3. 9.

atau surat tugas. memorandum. kita diharapkan mampu menindaklanjuti perintah kerja dengan membuat perencanaan. namun lebih khusus kepada perintah kerja berbentuk surat-surat resmi atau surat dinas. pada pelajaran ini. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 41 . Sebagaimana pelajaran sebelumnya. surat perintah.BAB 3 MEMAHAMI PERINTAH KERJA TERTULIS DALAM KONTEKS BEKERJA Standar Kompetensi Kompetensi Dasar - Berkomunikasi dengan bahasa Indonesia setara tingkat madya Memahami perintah kerja tertulis - Indikator - Mengenali informasi yang berkaitan dengan budaya kerja yang berlaku di tempat kerja Merencanakan tindak lanjut perintah berdasarkan catatan yang dibuat pada waktu membaca informasi dari perintah kerja tertulis Membuat bagan/prosedur kerja berdasarkan perintah kerja tertulis Mengonfirmasikan rencana kegiatan yang akan dilakukan (secara lisan/tulisan) kepada pemberi perintah Bab ini masih membahas perintah kerja. disposisi. dan perintah kerja berbentuk manual. seperti surat edaran. serta dapat mengonfirmasikan isi perintah kerja kepada pemberi perintah. prosedur kerja.

kartu dinyatakan valid dan pemegang kartu dianggap memiliki cukup kredit untuk menutup biaya pembelian. di Negeri Paman Sam. Dengannya. Awalnya. kartu kredit adalah penerus berbagai program kredit pedagang. nasabah bisa menggunakan transaksi pembelian sampai batas kredit tertentu. Christopher Thorton adalah orang pertama yang memasang iklan penjualan perabot rumah yang biasa dibayar pada akhir minggu. sekitar 3. Setiap kali transaksi pembelian. yang mencatat biaya yang dikeluarkan pelanggan atas permintaan penerbit kartu. 42 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . beberapa perusahaan mulai menerima kartu-kartu lainnya. Cara ini kemudian banyak ditiru pada tahun 1938. penggunaan kartu menandatangani resi berupa catatan data kartu dan jumlah yang dibayarkan. Kartu kredit dikeluarkan setelah ada persetujuan dari penerbit kartu (biasanya bank umum). Inilah konon iklan pertama untuk pembelian secara kredit. misal melalui telepon dengan hanya mengutip nomor kartu kredit yang dicetak embossed (timbul) pada kartu. Pada tahun 1730. Bayar Nanti”.000 tahun lalu masyarakat Babilonia dan Mesir telah melakukan praktik utang atau kredit atas sesuatu yang ingin dimiliki. Konsep pembayaran menggunakan kartu kredit ditemukan pada tahun 1950. Melalui sistem verifikasi elektronik. yakni dioperasikannya charge card oleh Dinners Club. produk yang akhirnya berevolusi menjadi sistem Visa. 1951. Inilah “Uang Plastik” pertama. Bayar Nanti Kapan orang mulai berhutang-piutang? Jangan kaget. Tahun itu pula. untuk menjual bahan bakar ke sejumlah pemilik mobil. yang bisa digunakan pada 27 rumah makan di New York. Mastercard muncul pada tahun 1966 ketika sekelompok bank penerbit kartu membentuk MasterCharge. yang memeriksa strip bahan magnetis berisi data. Kartu kredit pertama kali digunakan pada tahun 1920 di Amerika Serikat. Pada tahun 1958. Bank of America menciptakan BankAmericard. yang hakikatnya menunda pembayaran. Seluruh rekening dibayarkan pada setiap datangnya laporan rekening. ada sebuah toko pecah belah yang menggunakan sistem “Beli Sekarang. Dinners Club melepaskan kartu kredit pertama kepada 200 orang pelanggannya. Langkah ini diikuti American Express.Wacana Beli Sekarang. Beberapa cara lain dikembangkan. Setahun kemudian.

Agustus 2005) A. masyarakat. yang mengenal kartu kredit sejak 1985. untuk transaksi tanpa kartu. dibuat tiga perbaikan keamanan kartu kredit. Dalam dunia kerja. maupun dalam kehidupan berbangsa dan bernegara. Ketiga. Untunglah. perintah sudah menjadi bagian keseharian dalam proses kerja sekaligus menjadi jaminan keberlangsungan kerja yang diwarnai oleh pola hubungan manusia secara hierarki. justru jadi fukos dunia lantaran penipuan kartu kredit via internet yang dilakukan segelintir anak muda. Baik di lingkungan rumah tangga. Agar aman. kartunya diganti smart card. Pertama. bahkan lewat pos. beberapa bank memberi nomor sekali pakai untuk setiap transaksi. Perintah sering menjadi acuan pekerjaan. Penerbit kartu berusaha keras agar kerugian akibat penipuan dan biaya pencegahan penipuan diminimalkan. Celakanya. hampir 6 juta kartu kredit beredar di seantero Nusantara. Karenanya. sedangkan bentuk perintah tertulis umumnya bersifat tidak langsung. Dalam budaya kerja. Indonesia. disusul Pengadilan Negeri Denpasar pada tanggal 14 September 2004 mengganjar 3 tahun penjara terhadap seorang terdakwa pemalsuan kartu kredit. Bentuk perintah dapat disampaikan secara lisan ataupun tertulis.8 tahun penjara. dengan pertumbuhan sebesar 20-30 % per tahun. Benny Wong. Mengenal Bentuk Perintah Kerja Tertulis Banyak bentuk aturan atau petunjuk yang dapat ditemukan dalam kehidupan kita. yang dampak sama tetapi antipenipuan. Ini lazim disebut “transaksi tanpa kartu”. Kartu kredit semacam ini merebak di kalangan menengah negara-negara Barat. ditambahkan kode 3 atau 4 digit di belakang kartu. (Sumber : Majalah Intisari. sistem verifikasi online. di tempat pekerjaan. Kedua. perintah dapat dimanifestasikan dalam bentuk Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 43 . Pemalsuan kartu kredit pun merebak. Perintah lisan biasanya menuntut respon/tindakan langsung sehingga muncul variasi kalimat perintah. sekolah. yang harus langsung dipakai sebelum diendus pihak berwajib. tercipta pasar gelap bagi nomor kartu kredit curian. pada tanggal 6 Juni 2004 Pengadilan Negeri Gianyar memvonis 2. bahkan roda penggerak agar manusia selalu melakukan pekerjaan karena perintah itu sendiri adalah awal tindakan atau pedoman kerja. Kini. Soal keamanan kartu menjadi kelemahan sistem ini. yakni nomor indentifikasi pribadi (PIN) dijadikan empat digit.Cara ini bisa pula untuk melakukan pembayaran via internet.

Berdasarkan jenisnya. Surat yang berhubungan dengan pekerjaan disebut surat dinas atau surat resmi. memorandum. Surat perintah terdiri atas: (1) (2) (3) d. dan pedoman kerja. ketentuan. duta organisasi. peraturan waktu berkunjung. (3) Peraturan. Surat Perintah Surat perintah adalah surat yang berisi perintah dari pimpinan kepada bawahan yang berisi petunjuk yang harus dilakukannya. efektif. dan praktis.instruksi. petunjuk. Surat perintah berlaku sementara dan berakhir setelah tugas yang diperintahkannya selesai dilaksanakan serta melaporkan hasil pekerjaan tersebut kepada pimpinan. larangan membuang sampah. bentuk petunjuk dan pedoman lebih banyak diwujudkan secara tertulis dalam bentuk surat. (2) petunjuk. surat juga berfungsi sebagai alat bukti tertulis. Surat dipandang sebagai alat komunikasi tertulis yang paling efisien. misalnya himbauan menjadi akseptor RB. misalnya petunjuk penggunaan suatu barang. alat bukti historis. misalnya pedoman penulisan karya ilmiah. atau perintah kerja yang dapat dijadikan pedoman bagi karyawan pada suatu lembaga. Selain itu. Karena pekerjaan berkaitan dengan administrasi dan dokumentasi. B. kepala surat pembukaan isi surat perintah kaki surat/bagian akhir surat 44 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Model-Model Surat Berisi Perintah Kerja Surat adalah suatu alat atau sarana komunikasi tertulis. instansi. misalnya peraturan berlalu lintas. (4) pedoman. atau perusahaan. pengumuman. misalnya undang-undang tentang penyalahgunaan narkoba. antara lain surat perintah. dan disposisi. Model surat yang berisi informasi kerja atau perintah kerja. dan pedoman. Surat ini umumnya berisi informasi. (5) undang-undang. alat pengingat. ekonomis. surat edaran. undang-undang pendidikan. bentuk perintah tertulis dapat dibedakan menjadi: (1) himbauan/larangan. 1.

........ Surat Pemimpin Redaksi Harian Umum Pedoman No.. Dasar : 1......... HARIAN UMUM PEDOMAN Jalan Teratai 13 Bekasi =============================================================== SURAT PERINTAH Nomor : ............. MEMERINTAHKAN : Kepada : Nama Pangkat Jabatan Alamat 1....... : : : : ............. Saudara diperintahkan untuk melaksanakan kewajiban/pekerjaan sebagaimana tercantum dalam lampiran surat perintah ini.......... Ereng Sarindat Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI Untuk : 45 ......................... di samping tugas pokok yang telah ada. ............. Dikeluarkan di : Bekasi Pada tanggal : 3 Juni 1996 Pemimpin Redaksi Harian Umum Pedoman ttd Ir........... Pertimbangan : Untuk peningkatan sumber daya manusia dalam menyongsong era globalissi....................Contoh surat perintah pada instansi swasta............ ............... untuk hal tersebut di atas perlu dikeluarkan surat perintah.............. Terhitung tanggal 12 Juni 1996.... Dalam rangka manusia peningkatan sumber daya 2.... ................... 346 P-76/KEP/1994 tanggal ....................... 2 Agar pelaksanaannya dijalankan dengan sebaik-baiknya dengan penuh rasa tanggungjawab....................

lampiran. tanggal surat. Kepala sekolah. Pembayaran paling lambat sampai tanggal 14 Januari 2008. dari Kurikulum 2004 menjadi Kurikulum Tingkat Satuan Pendidikan (KTSP). setiap siswa diwajibkan membayar Rp. 421/SD/’07 Sehubungan adanya perubahan kurikulum SD. buku laporan hasil belajar siswa diganti untuk menyesuaikan kurikulum yang baru. 46 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . (1) (2) (3) (4) (5) Kepala surat edaran bertuliskan nama perusahaan dan identitasnya. hal. Surat edaran khusus ditujukan kepada orangatau pejabat tertentu dan seperti surat dinas biasa. S. 20. Surat Edaran Surat edaran adalah surat pemberitahuan tertulis yang ditujukan kepada pejabat/pegawai. Tembusan: Pengurus Komite Sekolah Guntur Sangaji. semoga Bapak/Ibu orang tua murid dapat memakluminya. Surat edaran ini berisi penjelasan mengenai sesuatu hal. Perkataan ”Edaran” biasanya ditulis di tengah Isi surat edaran: Salam pembuka. BOGOR Nomor Lamp Hal : 421/ED/’07 : : Penggantian Buku Laporan Pendidikan Bojonggede. BOJONGGEDE KAB. Ada dua macam bentuk dan sifat surat edaran. kami ucapkan terima kasih. dan alamat tujuan surat. Surat edaran umum ditujukan kepada orang banyak atau umum.000. misalnya kebijakan pimpinan. Bapak /Ibu orang tua murid SD RAGAJAYA di tempat SURAT EDARAN No. Atas perhatiannya. Surat edaran terdiri atas unsur-unsur berikut. yaitu surat edaran umum dan surat edaran khusus. 19 Desember 2007 Yth. Demikianlah surat edaran kami. No. Dalam rangka pengadaan buku laporan yang baru. Contoh surat edaran bersifat umum: Contoh surat edaran bersifat umum SD RAGAJAYA KEC.Pd. petunjuk mengenai tata cara pelaksanaan. isi surat.2. atau peraturan perundang-undangan. dan penutup surat Kaki surat: salam penutup serta nama penanggung jawab surat edaran.

Sehubungan dengan hal tersebut diatas. Mengumumkan berarti memberitahukan atau memaklumkan. surat kawat. Kata dasar umum mempunyai arti seluruh atau orang banyak. yaitu pengumuman dalam bentuk tulisan. Pengumuman berarti pemberitahuan kepada orang banyak tentang sesuatu masalah. Drs. agar diketahui dan dilaksanakan oleh orang banyak yang berkepentingan. Atas perhatian saudara. Surat Pengumuman Pengumuman berasal dari kata ”umum”. saudara memakai kemeja batik pada waktu dinas. papan pengumuman. dengan ini kami beri tahukan bahwa dalam rangka persaudaraan antar SMK kota Malang maka diadakan Pekan Seni berlangsung pada tanggal 3 Januari sampai dengan 7 Januari 2005. telex. kecuali bagi petugas keamanan. yang disampaikan melalui telegram. dengan ini kamu ajukan agar selama Pekan Seni. (2) Pengumuman tertulis. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 47 . yaitu disampaikan secara oral komunikasi. Laksana Muria 3. kami ucapkan terima kasih. pengumuman dapat dibedakan menjadi tiga. (1) Pengumuman lisan. dan lain-lain. Kepala Sekolah. 21/12/05 tertanggal 27 Oktober 2004 tentang Pekan Seni. penyampaiannya dapat melalui pesawat telepon atau pengeras suara (sound system). yaitu seperti berikut. surat kabar. Berdasarkan sifat dan asalnya.Contohsurat edaran bersifat khususkhusus : Contoh surat edaran bersifat : DEPARTEMEN PENDIDIKAN DAN KEBUDAYAAN SEKOLAH MENENGAH KEJURUAN BINA MULYA II MALANG EDARAN 572/33/05 Hal : Pekan Seni 29 Desember 2004 Yth : Para Guru / Karyawan SMK Bina Mulya II Malang Sesuai dengan surat keputusan No. mendapat konfiks pe-an dan bunyi sengau ng. majalah.

Anggi Surendra 4. 215/033/05 tentang Kesempatan Kerja bagi Para Lulusan SLTA PT. Pendaftaran dibuka mulai tanggal 3 Januari sampai dengan 7 Januari 2005. Ir. Tunjung Mulia Drs. Lamaran ditulis di atas kertas bermaterai Rp 6000. Surat pengumuman merupakan surat yang berisi pemberitahuan tentang masalah yang perlu diketahui oleh siapa saja yang berkepentingan sesuai dengan pengumuman tersebut. Tunjung Mulia membuka kesempatan bagi para lulusan SLTA untuk diangkat sebagai karyawan/i di perusahaan kami. Contoh surat pengumuman: PT. SKKB dan surat keterangan sehat dari dokter. foto 3 x 4 = 3 lembar.00 WIB. dan (3) memasangnya di koran-koran sebagai iklan. Memo atau Memorandum Memorandum biasa digunakan untuk surat-menyurat secara intern 48 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .(3) Pengumuman dari instansi dan surat pengumuman bukan dari instansi. (2) memasangnya di papan-papan pengumuman. Palembang PENGUMUMAN No.00 – 12. 5. di antaranya: (1) menyebarkannya sebagai surat edaran.. Tunjung Mulia Jalan Diponegoro No. Pelamar datang sendiri di kantor kami pukul 08. riwayat hidup. 1 Januari 2005 Direktur PT. Surat Pengumuman dapat disebarkan dengan beberapa cara.dengan dilampiri ijazah (fotokopi). Demikian pengumuman kami untuk diketahui Palembang.

dalam lingkungan kantor. perintah. Jakarta. Budi Santoso. yaitu kepala memo dan isi memo. 22 Maret 2005 (paraf) Ajun Ginanjar Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 49 . Bagian-bagian memorandum meliputi sebagai berikut: a. Karena peredarannya yang terbatas. Pengiriman Buku : Pengiriman Buku Segera kirimkan buku Teori karya Prof. Penulisan memo dapat ditik atau ditulis tangan. penerangan. b. Isi memo singkat. Memo umumnya berisi peringatan. memo biasanya tidak mencantumkan identitas kantor. Dr. sederhana. dan lain sebagainya. Isi memo umumnya tidak lebih dari 10 baris. Bacalah contoh memo berikut ini dan perhatikan ciri-cirinya! Contoh 1 Memo Kepada Dari Perihal : Manajer Pemasaran : Kasubag. arahan. Ciri Bentuk Terdiri atas dua bagian. pertanyaan. Memo dibuat oleh atasan kepada bawahan atau antara pejabat yang setaraf. Penulisan memo harus langsung menyampaikan pesan atau perintah dengan kalimat pendek dan tegas. Hamid Abdul Hadi untuk Bapak Dr. dan mudah agar cepat dipahami. Kepala memo berisi: (1) pihak yang dituju (2) pengirim memo (3) perihal memo (4) tanggal pengirim memo (5) paraf dan nama pengirim Ciri Isi Isi memo disampaikan dengan bahasa singkat. Kepala Perpustakaan Kota Bogor. sebanyak 80 eksemplar.

S. suatu intitusi menerima surat penawaran barang oleh bagian administrasi. Angkasa Raya Jalan Pancanaka No. Surat itu diagendakan. 3 (1)--------------------------Jakarta – Selatan (3) (4) (5) (6) (7) Dari Hal Memo Kepada : Bagian Personalia : Direktur PT Angkasa : Pengadaan Pegawai (2) 30 Desember 2004 Sesuai dengan perkembangan di perusahaan terutama pada bidang sales. Keterangan: (1) (2) (3) (4) (5) (6) (7) (8) 5. Selanjutnya. (penjelasan terlampir) Ttd (8) Dandang Kusuma. disposisi adalah catatan berupa saran /tanggapan/ instruksi setelah surat dibaca oleh pimpinan. Isi disposisi bisa merupakan 50 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . kop surat memo tanggal surat memo judul memo alamat memo pengirim memo perihal pokok memo isi memo tanda tangan dan nama terang pengirim memo Disposisi Lembaran disposisi adalah lembaran kertas yang disediakan oleh agendaris untuk diisi oleh pimpinan tentang tindak lanjut surat yang masuk. lalu diberi lembar disposisi.Contoh 2 PT. pimpinan membuat disposisi. Dengan kata lain. saya meminta Saudara mempersiapkan sarana dan perencanaan guna penerimaan karyawan baru. Sebagai contoh.E.

yaitu disposisi yang dituliskan pada lembaran tersendiri (lembaran disposisi). ttd Imam Ahmad. S.Jika perlu. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 51 .E. Agenda Tanggal Penting Rutin : 102/SP/2007………Tgl.perintah untuk menolak penawaran tersebut atau memerintahkan staf yang bersangkutan untuk membalas surat yang isinya memesan barang-barang tersebut.Harap dipelajari . 30 Maret 2007 Pimpinan. Oleh sebab itu. Biro Umum 3.Tanyakan bagian pengadaan barang . Petunjuk penggunaan umumnya disediakan oleh produsen barang untuk memberi petunjuk penggunaan barang yang bersangkutan. Darma Tekstil Instansi/Informasi: . petunjuk penggunaan (manual kerja) biasanya menggunakan bahasa lugas dan mudah dipahami. Bagian gudang 2. Penyelesaian : 30 Maret 2007 Perihal : Penawaran Bahan Kain Tanggal : 30 Maret 2007 Asal : PT. segera pesan Diteruskan kepada: 1. yaitu disposisi yang langsung ditulis pada lembaran surat. Keuangan 4. Jakarta. Contoh disposisi : Contoh disposisi : Rahasia No. dan (2) disposisi tidak langsung. Perintah Kerja Berbentuk Manual Petunjuk penggunaan yang disebut juga manual kerja merupakan perintah bagaimana melakukan pekerjaan atau perbuatan terhadap suatu objek atau alat. Disposisi dibedakan menjadi dua macam: (1) disposisi langsung. C. Bag.

lalu tekan set/save. kalender otomatis yang berlaku sepanjang masa c. Berikut contoh buku petunjuk cara kerja pesawat telepon. Untuk memilihnya. Caller id (menampilkan nomor yang masuk) Bisa menyimpan nomor telepon secara otomatis pada saat melakukan telepon keluar maupun telepon masuk. cukup disentuh. tekan Vip. 5. Bisa me-redial nomor-nomor internasional. 4. 5. tampilkan nomor telepon. tekan dialed. seperti kulkas. tekan tombol handsfree. 3. Perhatikanlah dengan saksama! IMAGE TOUCH PANEL PHONE LCD KEISTIMEWAAN 1. tekan up atau down. televisi. Untuk menghapus. Bisa mengunci menggunakan password (dengan nomor pin) 3. 4. Tombol tidak perlu ditekan. Setelah selesai. bisa menggunakan tombol up dan down. tekan delete.Petunjuk penggunaan dibuat agar pengguna barang/alat dapat menggunakan barang tersebut dengan baik dan bermanfaat sesuai dengan cara kerja dan kegunaan barang tersebut. Untuk mengoperasikan kalkulator. mesin cuci. 52 . Untuk set tahun/bulan/tanggal dan waktu/jam. tekan SET/SAVE hingga keluar set/date. Untuk konfirmasi. Untuk melihat nomor telepon yang masuk. tekan delete. lalu tekan set/save. tekan AC dan untuk keluar. penunjuk waktu/jam/24 jam b. atau komputer perlu buku petunjuk. VCD/DVD. Untuk menyimpan nomor telepon yang masuk. Ada fasilitas handsfree tanpa harus mengangkat gagang telepon. tekan tombol delete (exit) dan kembali ke menu semula. Barang-barang elektronik. telepon. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2. lalu pilih nomor telepon dengan up atau down. Untuk melihat telepon masuk atau keluar tekan dialed lalu tekan down Untuk menggunakan handsfree. CARA PAKAI / CARA KERJA: 1. 6. Dilengkapi dengan layar LCD yang dapat menampilkan: a. 2.

dan menyusun beberapa pertanyaan untuk konfirmasi. baik secara lisan maupun tertulis. struktur kerja. tekan set save lalu tekan tombol up/down hingga keluar set 6 lcd. tekan set atau save. tekan delete. harus mampu memahami serta menyikapi dengan baik peraturan atau budaya kerja yang ada pada perusahaan tempat dia bekerja. Ketua OSIS dan pengurusnya segera melakukan langkahlangkah seperti membentuk panitia. setelah itu tekan set save. kita telah mempelajari bagaimana menindaklanjuti perintah kerja secara lisan. Membuat catatan informasi penting dari perintah kerja tersebut. (1) (2) (3) (4) (5) Membaca perintah kerja secara teliti. Untuk mengatur kejelasan layar LCD. Dan untuk keluar. D. merencanakan kegiatan. hati-hati. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 53 . Membuat rencana tindak lanjut berdasarkan perintah Merancang bagan atau prosedur kerja yang diperintahkan. seorang pemimpin tentu sering memberikan perintah kerja. ialah seperti berikut. Dalam dunia kerja. dan saksama. Tekan tombol up atau down untuk mengatur tingkat 1 sampai dengan 5. Menindak Lanjuti Perintah Kerja Tertulis Pada bab dua. Hal-hal yang perlu dilakukan saat menerima perintah kerja tertulis. Setiap menerima perintah kerja secara tertulis dalam bentuk surat atau instruksi kedinasan lainnya yang berkaitan dengan pekerjaan.6. Meminta konfirmasi kepada pemberi perintah akan ketepatan rencana kerja. misalnya instruksi dari Pembina OSIS tentang rencana menyelenggarakan Pentas Seni dalam rangka peringatan HUT sekolah. kita harus dapat menindaklanjutinya.baik sebagai atasan maupun bawahan. merumuskan agenda kerja. Setiap karyawan .

dan undang-undang. seperti barang-barang elektronik TV. Surat Pengumuman yang dapat dibedakan menjadi tiga. Surat Perintah Surat edaran. kulkas.RANGKUMAN A. pedoman. 2. Perintah Kerja Berbentuk Manual Petunjuk penggunaan yang disebut juga manual kerja merupakan perintah bagaimana melakukan pekerjaan atau perbuatan terhadap suatu objek atau alat. 54 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . yaitu himbauan/larangan. B. yaitu: (1) Pengumuman lisan (2) Pengumuman tertulis (3) Pengumuman dari instansi dan surat pengumuman bukan dari instansi. yang terdiri atas surat edaran umum dan surat edaran khusus. Model-Model Surat Berisi Perintah Kerja Surat adalah suatu alat atau sarana komunikasi tertulis. 4. peraturan. antara lain: 1. Memo atau Memorandum Disposisi yang dibedakan menjadi disposisi langsung dan disposisi tidak langsung. 3. C. VCD. Mengenal Bentuk Perintah Kerja Tertulis Bentuk perintah tertulis dapat dibedakan menjadi beberapa jenis. Menindak lanjuti Perintah Kerja Tertulis Setiap menerima perintah kerja secara tertulis dalam bentuk surat atau instruksi kedinasan lainnya yang berkaitan dengan pekerjaan. 5. Surat yang berhubungan dengan pekerjaan disebut surat dinas atau surat resmi. atau HP. Model surat yang berisi informasi kerja atau perintah kerja. D. petunjuk. Petunjuk penggunaan umumnya disediakan oleh produsen barang untuk memberi petunjuk penggunaan barang yang bersangkutan. Tindak lanjut tersebut mulai dari membaca perintah kerja secara teliti sampai dengan meminta konfirmasi kepada pemberi perintah akan ketepatan rencana kerja. kita harus dapat menindaklanjutinya.

1. bahasa yang kontaminatif a. Berikut ini termasuk ke dalam perintah kerja tertulis. surat pengumuman Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 55 . nama diberi garis bawah menggunakan tanda kurung buka dan tanda kurung tutup tidak diapit oleh tanda kurung buka dan tanda kurung tutup dan tidak digarisbawahi dengan menggunakan huruf kapital seluruhnya diapit oleh tanda kurung buka dan tanda kurung tutup dan digarisbawahi. bahasa yang singkat. 3. memorandum b. bahasa Indonesia yang baik dan benar d. Jelaskan perbedaan bentuk perintah kerja secara tetulis dari segi struktur dan penggunaan bahasa! UJI KOMPETENSI I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! Bila kita akan menyampaikan perintah kerja tertulis secara ringkas. memorandum b. Nama jelas penanda tangan surat ditulis 2. jelas. d. 4. bahasa yang panjang dan terurai b. kerjakanlah tugas berikut. sebaiknya membuat a.TUGAS MANDIRI: Untuk lebih mengenal dan memahami bentuk perintah kerja tertulis. e. c. 1. b. dan tepat c. kecuali a. surat perintah c. buku manual kerja Formulir penyusunan bahasa dalam memorandum dianjurkan a. Carilah minimal tiga bentuk perintah kerja secara tertulis yang lainnya! 2. disposisi e. faktur d. kalimat yang ambigu e.

b. cap dinas. tanda tangan. iklan c. isi. Kehadiran Saudara sangat kami harapkan dan terima kasih. surat pernyataan dalam hubungan diplomasi c. . Atas perhatian Saudara. arahan. dan penerangan b. bentuk komunikasi yang berisi saran. alat bukti historis e. memo dibuat oleh atasan dan jajaran yang berada di bawahnya dalam satu organisasi d. 8. nama jabatan. d. dan cap dinas d. 9. e. tembusan. alat komunikasi b. lampiran. spanduk d. permohonan kerja e. alat bukti tertulis c. 7. nota atau peringatan tidak resmi Yang bukan fungsi surat resmi a. isi.c. nama pejabat. disebut surat a. Harap dilaksanakan dengan sebaik-baiknya. dan penutup c. pembukaan. tembusan. dan penutup e. surat pernyataan dalam hubungan diplomasi Penutup surat perintah yang tepat adalah a. surat edaran b. kami ucapkan terima kasih. pendahuluan. perihal surat Bagian surat edaran yang dinamakan kaki surat/bagian akhir terdiri atas a. tanda tangan pejabat. 5. kecuali a. dan tanda tangan pejabat Penjelasan di bawah ini berhubungan dengan memo. kaki surat e. alat pengingat d. surat edaran buku manual kerja surat pengiriman barang Pemberitahuan pemerintah kepada rakyat Indonesia tentang pelaksanaan pemilu. tulisan edaran. 56 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 6. c. nama terang. dan tembusan b.

diskualifikasi b. jawaban pemberi perintah. judul. nomor.. dan tanda tangan e. badan surat. Rangkaian bagian surat perintah adalah a. dan nama jelas c. surat edaran umum b. tempat kedudukan. dan isi perintah d. tempat dan tanggal. dan kaki surat e. pertimbangan. kepala. surat sirkuler 12. bagian isi. tempat. 10. tempat kedudukan. e. alamat. dan bagian kaki c. surat edaran khusus c.d. yang terhormat b. Surat yang dimaksud disebut a. judul. Atas perhatian dan kerja sama Bapak. 14. surat edaran dari suatu instansi d. Assalamu’alaikum warahmatullahi wabarakatuh d. kehadiran Saudara tidak boleh diwakilkan. Bapak yang terhormat c. keterangan yang diberi perintah. pengumuman e. bagian. nama yang diberi perintah. nomor surat. memorandum c. nomor surat. dan tanda tangan b.. Di bawah ini yang bukan salam pembuka adalah a. dasar. tanggal. Wassalam 11. tanda tangan. Surat pemberitahuan tertulis yang ditujukan kepada pejabat/pegawai yang berisi suatu penjelasan disebut a. kami ucapkan terima kasih. dan tanda tangan. dan tanda tangan d. tempat dan tanggal. dispensi 13. Lembaran kertas yang disediakan oleh agendaris untuk diisi pimpinan tentang tindak lanjut. dan konsideran b. nama. nama yang diberi perintah. distorsi d. Dengan hormat e. Saudara. Berhubung pentingnya acara. dan nomor urut surat perintah Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 57 . disposisi e. Bagian-bagian surat perintah ialah a.

tembusan d. buku pedoman c. buku keterangan e. ajakan c. majalah mingguan c. Berdasarkan penggalan surat di atas.. peraturan 17.15. primbon 19. buku petunjuk b. dengan ini kami beri tahukan bahwa salah satu materi dalam rangka penyempurnaan tata persuratan dinas adalah tentang cap dinas pokok. pembuka surat c. Mengetahui informasi lisan tentang kurs rupiah. Bentuk perintah tertulis antara lain. Buku petunjuk cara melakukan sesuatu berkaitan dengan penggunaan benda atau alat disebut a. Bagian surat edaran yang merupakan daftar penerima surat selain yang dialamatkan adalah a. alamat e. buku manual kerja d. kecuali a. bisa melalui a. himbauan/larangan e. Bentuk perintah kerja tertulis umumnya bersifat tidak langsung. DEPARTEMEN AGAMA KANTOR WILAYAH PROVINSI DAERAH ISTIMEWA YOGYAKARTA SURAT EDARAN Nomor : WI / I / KS. tanggal surat 18. surat kabar e. petunjuk b. alamat dalam b. berita televisi b. alamat surat ditujukan kepada 58 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . …………………….02 / 01 / 2006 Untuk menindaklanjuti Peraturan Menteri Agama Republik Indonesia Nomor 1 tahun 2005 tanggal 12 Desember 2005 perihal Tata Persuratan Dinas di Lingkungan Departemen Agama RI. berita ekonomi 16. undang-undang d. Pokok penyempurnaan itu sebagai berikut. tabloid d.

Demikianlah surat ini dikemukakan agar mendapat perhatian. d. c. 22 Maret 2005 ( paraf ) Ajun Ginanjar Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 59 . c. Kami mengharapkan surat ini mendapat perhatian Saudara. Kepala Dinas Pendidikan Pemuda dan Olahraga se-Daerah Istimewa Yogyakarta Kepala Kantor Departemen Agama Kodya/Kabupaten se–Daerah Istimewa Yogyakarta Kepala Kantor/Menteri Agama RI Kepala Kantor Wilayah Provinsi Kepala Kantor Departemen Agama se–Indonesia 20. Selanjutnya perintah ini agar dilaksanakan dengan penuh tanggung jawab. e. Jakarta. b. e.a. Agar pelaksanaannya dijalankan sebaik-baiknya. Hamid Abdul Hadi untuk Bapak Dr. Memo Kepada Dari Perihal : Manajer Pemasaran : Kasubag Pengiriman Buku : Pengiriman Buku Segera kirimkan buku Teori Karya Prof. b. Perintah ini harus dilaksanakan dengan penuh tanggung jawab. Budi Santoso. Kalimat-kalimat di bawah ini yang dapat digunakan dalam surat perintah adalah a. sebanyak 80 eksemplar. Dr. Kepala Perpustakaan Kota Bogor. d.

3. jawablah pertanyaan di bawah ini! 1. 5. 6. 8. 9. Ditujukan kepada siapa memo di atas? Siapa pengirim memo tersebut? Apa isi perintah kerja tertulis pada memo di atas? Apakah pesan yang disampaikan memo itu singkat dan jelas? Berdasarkan pengamatanmu unsur-unsur apakah yang menjadi ciri khas memo? Sebutkan kekurangan dari memo di atas! Jelaskan! Apa yang dimaksud dengan disposisi? Sebutkan macam-macam pengumuman! Apa perbedaan surat edaran dan surat perintah? 10. Bila Anda telah mencermati contoh memo di atas. 7. 4. 2. Buatlah perintah kerja berbentuk manual! 60 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .II.

serta mengindentifikasi kata/frasa baru. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 61 . kita akan mempelajari kembali kelas kata dalam kaitannya dengan keterampilan membaca. ungkapan. frasa. bentuk kata. kalimat. dan kalimat dalam konteks bekerja - Indikator - - - Mengelompokkan kata. makna kata. dan kalimat yang baru yang tidak benar atau tidak lazim sesuai kaidah bahasa Indonesia. Kita juga harus mampu mengindentifikasi penggunaan kata. frasa. bentuk kata.BAB 4 MEMBACA UNTUK MEMAHAMI MAKNA KATA. frasa. Pada bab ini. kita sudah belajar tentang kelas kata. ungkapan. kita harus mampu mendaftarkan dan mengelompokkan kata berdasarkan kelas kata dan makna kata. kita juga akan mempelajari kata berdasarkan bentukan kata. DAN KALIMAT DALAM KONTEKS BEKERJA Standar Kompetensi Kompetensi Dasar - Berkomunikasi dengan bahasa Indonesia setara tingkat madya Membaca untuk memahami makna kata. Setelah mempelajari bab ini. dan kalimat berdasarkan kelas kata dan makna kata Mendaftar kata-kata yang berpotensi memiliki sinonim dan antonim dalam teks bacaan Mengidentifikasi kata (termasuk bentuk kata baru). kalimat yang dipersoalkan kebenaran/ketepatannya (diterima/ditolak) berdasarkan paradigma atau analogi Mengidentifikasi kata. Selain itu. ungkapan. BENTUK KATA UNGKAPAN. atau bentuk kata baru yang perlu dipersoalkan kebenarannya/ ketepatannya (diterima/ditolak) berdasarkankan kaidah atau kelaziman Pada kelas X.

namun menimbulkan masalah lain: gunungan sampah! Padahal.” Ini kampanye dari toko pernik interior IKEA di Singapura.2 (setara Rp 12. Dulu. pemandangan semacam itu nyaris tak pernah ada. plastik itu terbuat dari minyak bumi yang jumlahnya makin hari makin terbatas? Jadi “Bring your own bag. beli tas belanja dari belacu dengan rancangan cantik seharga Sin $ 1. dalam tempo 5 menit.000). bila ingin membeli bakso. dengan gerakan cepat. Idealnya. repot dan lama melayaninya!” katanya dengan nada ketus tiap kali pelanggannya pesan untuk dibawa pulang. Bahkan ada yang ramah lingkungan. Jadi. atau es kelapa muda di pojok jalan. Di pertigaan Rawa Belong. tapi juga menghemat BBM. tiap sore hingga malam bisa kita temui warung tenda “Bubur Ayam Lumayan Bang Tatang. Ritual belanja memang jadi lebih praktis. saya tak menyediakan plastik.” Bubur nasi kental dengan tumpukan suwiran ayam ini laris manis. soto. kita harus membawa rantang susun sendiri bila membeli makanan untuk dibawa pulang dari 62 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . mereka tak lagi menyediakan tas belanja plastik. Yang umum justru banyak yang memanfaatkan kantong plastik. kampanye pengurangan penggunaan plastik bukan hanya untuk mengurangi gunungan sampah. ia menjejerkan 20 mangkuk kosong sekaligus. atau membeli tas plastik seharga 5 atau 10 sen dolar Singapura. cara Bang Tatang menyiapkan bubur bagi pelanggannya yang antre sampai ke luar tenda. Sejak Hari Bumi 22 April 2007. bergantung pada ukurannya. banyak di antara kita yang membawa mangkuk sendiri. kita masih terbiasa melihat nenek atau ibu-ibu tetangga ke pasar tradisional membawa tas sendiri yang terbuat dari anyaman pandan atau tas kain. Tak kalah laris. tahukah Anda. Para pelanggan diberi pilihan membawa tas belanja sendiri. Sewaktu kecil. semuanya sudah terhidang di hadapan pelanggan. Jakarta Barat. sampai awal tahun 1980-an. “Bawa tempat sendiri.Wacana Kebiasaan Lama Kurangi Sampah Plastik Kebiasaan lama tak selalu jelek. kebiasaan itu menghilang. Sekarang. Sombong! Begitulah komentar pembeli yang baru pertama kali berkunjung. Sejalan merebaknya pasar swalayan yang menyediakan tas belanja plastik sebagai layanan bagi pelanggan sekaligus promosi. “kesombongan” Bang Tatang adalah perilaku baik yang ramah lingkungan. One man show. Tapi bila dipikir-pikir.

ungkapan. dan surat kabar. terkandung banyak unsur bahasa yang berkaitan dengan makna kata dan ruang lingkupnya. Juga penggunaan gaya bahasa yang berhubungan dengan ungkapan dan bentuk-bentuk pemakaiannya. Kampanye penggunaan tas bukan plastik sendiri sebenarnya sudah cukup lama ada di Indonesia. membawa wadah sendiri untuk jajanan dan belanjaan kita. Kata merupakan unsur yang sangat penting dalam membangun suatu kalimat. misalnya. Pelanggan dipersilakan mengangkut belanjaan dalam kemasan karton aslinya. seperti buku. diperlukan kesadaran akan pentingnya pengayaan kosakat. Setiap kata mempunyai fungsi dan peranan yang berbeda sesuai dengan kelas kata atau jenis Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 63 . Pada bab ini. bentuk kata. sedangkan perusahaan tata rias The Body Shop sempat mengadakan kampanye Reuse Reduce Recycle dengan memberikan potongan harga bagi pelanggannya. Pusat perkulakan Makro. Bukankah sekarang. (Sumber: Intisari. Membaca merupakan kegiatan berbahasa yang secara aktif menyerap informasi atau pesan yang disampaikan melalui media tulis. Dalam sebuah bacaan. yang mengisi ulang produk dengan membawa wadah lama. saat mulai beroperasi di Indonesia tak menyediakan tas belanja. kita akan membahas dan menelaah unsur-unsur kebahasaan di dalam bacaan berkaitan dengan kata. tetapi membaca dapat juga dilakukan dengan tujuan menelaah unsur-unsur kebahasaan yang terkandung di dalamnya. serta kalimat berdasarkan kelas kata dan makna kata. Tindakan ini untuk mengurangi sampah styrofoam dan plastik. Juli 2007) A. Untuk mengurangi gunung sampah plastik dan menghemat BBM.restoran. majalah. Tanpa kata. tidak mungkin ada kalimat. Aktivitas membaca tidak saja dilakukan untuk menyerap informasi atau pesan yang diuraikan di dalam bacaan. Tak lagi menerima wadah lama. kembalilah pada kebiasaan lama. Klasifikasi Kata Berdasarkan Kelas Kata Untuk mendayagunakan bahasa secara maksimal. kurangnya peminat membuat The Body Shop mengubah strategi. Kesadaran itulah yang memotivasi kita untuk lebih rajin membaca. tapi mengganti bahan wadah dengan materi yang lebih cepat terurai di alam. wadah makanan banyak yang dirancang cantik? Dijamin tak bakal bikin malu. Namun.

Contoh: (akan) mandi (sedang) tidur (telah) pergi (3) Dapat diingkari dengan kata tidak. Suatu kata dapat digolongkan ke dalam kelas kata kerja apabila memenuhi persyaratan berikut.katanya.) (Jalan dengan santai. dan telah. kata ganti (pronomina).) (Tidur dengan nyenyak.) (2) Dapat diberi aspek waktu. Contoh: (tidak) makan (tidak) lihat (tidak) pulang (4) Berawalan me. kata bilangan (numeralia) kata tugas Kata Kerja (Verba) Kata kerja ialah kata yang menyatakan perbuatan atau tindakan. seperti akan. yaitu: (1) (2) (3) (4) (5) 1. Kata kerja biasanya berfungsi sebagai predikat. Di kelas X. (1) Dapat diikuti oleh gabungan kata (frasa) dengan + kata sifat. sedang. kata kerja (verba) kata sifat (adjektif ) kata keterangan (adverbia) kata benda (nomina). Secara umum kelas kata terdiri atas 5 macam.dan berContoh: melatih melihat merakit berdiskusi 64 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Contoh: pergi tidur jalan (Pergi dengan gembira. kita sudah mempelajari kelas kata dan pada bab ini akan dibahas kembali tentang kelas kata dan hubungannya dengan kalimat.

(2) Adverbia turunan terbagi atas 3 bentuk berikut. Contoh: luas bodoh mudah buruk baik (seluas/terluas) (sebodoh/terbodoh) (semudah/termudah) (seburuk/terburuk) (sebaik/terbaik) (3) Dapat diingkari dengan kata tidak. misalnya: alangkah. paling.berpikir berusaha 2. Contoh: murah sulit pahit (tidak murah) (tidak sulit) (tidak pahit) 3. amat. Kata sifat berfungsi sebagai predikat. Berikut adalah macam-macam adverbia. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 65 . atau kalimat. nomina predikatif. agak. adjektiva. niscaya. Kata Keterangan (Adverbia) Kata keterangan atau adverbia adalah kata yang memberi keterangan pada verba. akan. Contoh: indah (sangat indah/indah sekali) baik (sangat baik/baik sekali) tinggi (sangat tinggi/tinggi sekali) (2) Dapat diberi awalan se.dan ter-. pula. nian. paling dan diakhiri dengan kata sekali. (1) Dapat diawali dengan kata sangat. pernah. Suatu kata dapat digolongkan ke dalam kelas kata sifat apabila memenuhi persyaratan berikut. saja. binatang. benda. misalnya keadaan orang. saling. tidak. (1) Adverbia dasar bebas. Kata Sifat (Adjektiva) Kata sifat ialah kata yang dipakai untuk mengungkapkan sifat atau keadaan sesuatu.

Pronomina berfungsi untuk mengganti kata benda atau nomina. belum pernah. Contoh: mobil (mobil yang bagus/mobil yang sangat bagus) pemandangan (pemandangan yang indah/pemandangan yang sangat indah) pemuda (pemuda yang gagah/pemuda yang sangat gagah) (2) Berimbuhan pe-. sebenarnya. Kata Benda (Nomina). atau tidak mungkin. -an. agaknya. misalnya . sebaiknya. Contoh: Aku sudah mencoba membujuknya. (c) Adverbia yang berasal dari berbagai kelas. pe-/-an. ataupun pengertian yang berfungsi sebagai objek dan subjek. ke-/-an.(a) Adverbia reduplikasi. lagi-lagi. (b) Adverbia gabungan. paling-paling.1.2. Kami sangat berharap kepada kalian. Kata benda Kata benda ialah kata yang mengacu pada benda. konsep. Kata Bilangan (Numeralia) 4. harusnya. (1) Dapat diikuti oleh frasa yang + sangat. orang. agak-agak. Contoh : saya roti gubuk (bukan saya) (bukan roti) (bukan gubuk) 4. Kata Ganti (Pronomina). Suatu kata dapat digolongkan ke dalam kelas kata benda apabila memenuhi persyaratan berikut. misalnya: terlampau. secepat-cepatnya. 4. Contoh: permainan pertunjukan kesehatan (3) Dapat diingkari dengan kata bukan. lebih-lebih. misalnya : belum boleh. Kata Ganti (Pronomina) Kata ganti atau pronomina adalah kata yang dipakai untuk mengacu pada nomina lain. 66 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . per-/-an.

Contoh : adik dan kakak makan atau minum tidak makan. tetapi minum ia tidak naik kelas karena bodoh Adi meletakkan tasnya. Itu memang miliknya. (3) kata sandang. Kata Tugas Kata tugas dapat dirinci menjadi empat jenis kata.3. klausa dengan klausa. Contoh: Ibu membeli gelas selusin. dan (5) partikel. yaitu (1) kata depan. Bapak Bardi memiliki dua puluh ekor kambing. frasa dengan frasa. Sepertiga dari harta warisan itu disumbangkan ke panti asuhan.Dia telah meninggalkan kita. Contoh: di (sebelah) utara = menunjuk arah ke timur = menunjuk arah dari pasar = menunjuk tempat pada hari senin = menunjuk waktu (2) Kata Sambung (Konjungsi) Kata sambung adalah kata yang menghubungkan dua satuan bahasa yang sederajat: kata dengan kata. 5. 4. (4) kata seru. binatang. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 67 . (1) Kata Depan (Preposisi) Kata depan adalah kata yang menghubungkan dua kata atau dua kalimat. dan benda. Ia mendapat peringkat pertama di kelasnya. lalu ia membuka seragamnya. (2) kata sambung. Kata Bilangan (Numeralia) Kata bilangan atau numeralia adalah kata yang dipakai untuk menghitung banyaknya orang.

3. -tah. dan Alhamdulillah. Masya Allah. gila. Kita dapat merinci setiap kata berdasarkan kelas katanya. Contoh partikel: -lah. dan -pun Kita baru saja mempelajari kelas kata beserta ciri-cirinya. perintah. mengapa kamu berani mencuri ? Ayo. kakiku sakit sekali. Klasifikasi Kata Berdasarkan Bentuk Kata Dari segi bentuknya. frasa. B. Kata Dasar Kata Turunan Kata Ulang Kata Majemuk 68 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Kata yang dicetak miring adalah kata seru. celaka. -kah. 4. dan pernyataan (berita). dan kalimat. -kek. Dalam suatu wacana. Unsur ini digunakan dalam kalimat tanya. kata dapat dibedakan atas empat macam. atau mengukuhkan sebuah kalimat dalam komunikasi.(3) Kata Sandang (Artikula) Kata sandang adalah kata tugas yang membatasi makna nomina. tentu terdapat berbagai kata. 2. Contoh lain kata seru adalah hai. Contoh: sang guru (sang bermakna tunggal) para pemimpin (para bermakna jamak) si cantik (si bermakna netral) (4) Kata Seru (Interjeksi) Kata seru adalah tugas yang digunakan untuk mengungkapkan seruan hati. Contoh: Aduh. “Wah. -dong. (5) Partikel Partikel adalah kategori atau unsur yang bertugas memulai. yaitu : 1. jangan putus asa. mahal sekali!” kata adik. nah. -deh. oh. mempertahankan. Astaga.

yaitu “satu”. Kata bersatu bukan merupakan kelas kata bilangan lagi. sisipan.menjadi bersatu. Semua kata ulang wajib di tulis dengan memakai tanda penghubung ( . getaran. Contoh : Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 69 .1. Kata Asal Verba asuh baca bangun buat cetak edar potong sapu tulis ukir impor Pelaku pengasuh pembaca pembangun pembuat pencetak pengedar pemotong penyapu penulis pengukir pengimpor Proses pengasuhan pembacaan pembangunan pembuatan pencetakan pengedaran pemotongan penyapuan penulisan pengukiran pengimporan Hal/Tempat Perbuatan Hasil asuhan bacaan bangunan buatan cetakan edaran potongan sapuan tulisan ukiran imporan mengasuh membaca membangun perbuatan membuat percetakan mencetak pengedaran mengedar perpotongan memotong persapuan menyapu menulis mengukir mengimpor 3. Coba Anda amati kata satu termasuk kata bilangan/numeralia yang berarti “bilangan asli pertama”. kata tersebut sudah dikategorikan ke dalam kata turunan. getar. Jika katakata itu diberi imbuhan. Bagaimana pengimbuhannya? Anda telah melihat bahwa dari satu kata (misalnya satu) dapat kita bentuk belasan kata turunannya. Kata-kata seperti baik. dan pegunungan. Kata Turunan Sebuah kata dapat menyampaikan beberapa pengertian melalui bentukan-bentukannya. meskipun masih memiliki arti dasar yang tetap. sakit. Kata Dasar Kata dasar adalah kata yang tidak berimbuhan atau yang belum diberikan awalan. Hal ini dapat berlaku pula pada kata-kata yang lainnya. Kata satu diberi awalan ber. Bentuk berimbuhan tersebut menunjukkan pertalian yang teratur antara bentuk dan maknanya.). akhiran. 2. Kata Ulang Kata ulang adalah kata yang mengalami proses pengulangan bentuk baik seluruh kata maupun sebagian. Dari satu kata pula. Pemekaran kata dengan memberi imbuhan itu pun akan membuat katakata tersebut mengalami perubahan jenis atau kelas katanya. Perhatikan tabel berikut dengan cermat. pekerja. Kata tersebut mengalami perubahan arti. kita dapat membuat atau mengembangkannya menjadi beberapa kata turunan. tetapi termasuk kelas kata kerja. dan penggabungan awalan akhiran. kesakitan. kerja. hasilnya antara lain terbaik. bersatu artinya berkumpul atau bergabung menjadi satu. kita dapat mengungkapkan satu bahkan beberapa ide/perasaan. gunung disebut sebagai kata dasar karena kata-kata itu tidak berimbuhan atau belum diberi imbuhan. Jika sudah mengalami penambahan atau pengimbuhan. Dari kata turunan tersebut.

3. Ulangan seluruh kata dasar Contoh: anak-anak buku-buku main-main 2. Ulangan seluruh kata yang dinamakan kata asal Misalnya : anai-anai kunang-kunang kupu-kupu agar-agar 70 ubur-ubur lobi-lobi mata-mata Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . meja-meja ibu-ibu makan-makan mondar-mandir porak-poranda biri-biri kupu-kupu laba-laba Ulangan kata dengan memberi imbuhan Contoh: berjalan-jalan dibesar-besarkan berlari-larian bermanja-manja dipukul-pukulkan menarik-narik 3. Ulangan seluruh kata. namun terjadi perubahan suara pada kata yang kedua Contoh: gerak-gerik mondar-mandir huru-hara bolak-balik lauk-pauk caci-maki compang-camping terang-benderang carut-marut 4. Kata Ulang Kata ulang adalah kata yang mengalami proses pengulangan bentuk baik seluruh kata maupun sebagian. Contoh: lauk-pauk anak-anak berjalan-jalan gerak-gerik dibesar-besarkan huru-hara Macam-macam kata ulang 1. Semua kata ulang wajib ditulis dengan memakai tanda penghubung (-).

tiga kata. Selain proses bentukan kata. Contoh: duta besar kereta api senja utama meja tulis guru rumah makan terjun payung buku sejarah baru kereta api cepat luar biasa lapangan udara rumah sakit jiwa siap tempur Contoh di atas menunjukkan bahwa kata dasar majemuk dapat sendiri dari gabungan dua kata. Contoh: matahari sapu tangan olahraga kacamata beasiswa antarkota C. rumah makan) dan ada yang ditulis serangkai (jika hubungan kedua kata sudah sangat padu).4. empat kata. lima kata bahkan dapat lebih. Cara penulisan kata majemuk ada yang terpisah atas dua kata atau lebih. makna kata juga dapat ditimbulkan oleh dua hal. Kata Majemuk Kata majemuk adalah gabungan dua kata atau lebih yang membentuk satu pengertian. Hal yang terpenting adalah gabungan kata-kata itu harus menunjuk kepada satu arti dan tidak melebihi batas fungsi sebagai kata. Klasifikasi Kata Berdasarkan Makna Kata Kita sudah mempelajari proses pembentukan kata yang semua itu berpengaruh pada perubahan makna kata dari makna awalnya. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 71 . yaitu hubungan referensial dan hubungan antarmakna. seperti contoh tadi (duta besar.

kursi artinya jabatan/kekuasaan 2. 4. 4. Untuk menafkahi kedua anaknya. 3. Ibunya Rosita sedang hamil lima bulan.1. 3. Bininya seorang dokter. 4. Contoh: 1. Contoh cakupan makna kasar: 1. Makna konotatif Makna konotatif ialah makna kiasan atau diartikan makna yang cenderung lain dengan benda nyata (makna kontekstual) disebut juga makna tambahan. berbunga-bunga artinya gembira 3. Kakakku sedang bunting. Pahlawan telah mati di medan laga. Istri Pak Dadang seorang perawat di rumah sakit pusat. ia menjual sayuran di pasar. 2. 2. Contoh : 1. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . b. Contoh cakupan makna halus: 1. Bajunya basah kuyup terkena keringat. Makna Kata Berdasarkan Hubungan Referensial Makna kata ini dibedakan menjadi: a. Makna denotatif Makna denotatif ialah makna yang paling dekat dengan bendanya (makna konseptual). Neneknya sudah meninggal dua hari yang lalu. Sekarang ia bekerja di tempat yang basah. Penjual menawarkan barang kepada pembeli. Ayahnya mendapat kursi sebagai anggota dewan. 72 Pamannya sudah mampus seminggu yang lalu. atau kata yang mengandung arti sebenarnya. Hatiku berbunga-bunga setelah anakku mendapat juara pertama. Bunga mawar itu dipetik Sita dan disuntingkan di rambutnya. 3. 2. basah artinya selalu menghasilkan uang Dalam pengertian lain makna konotasi berkaitan dengan cakupan makna halus dan cakupan makna kasar. dia harus berhati-hati. Mari kita doakan para pahlawan yang telah gugur agar arwahnya diterima oleh Allah.

Dilihat dari bentuk dan prosesnya. Tata bahasa ibarat kebun. yang tidak dapat dijelaskan lagi lewat makna kata-kata pembentuknya. Dua kata − mencari ilham : berusaha mencari ide baru − bercermin bangkai : menanggung malu b. Ungkapan dapat juga diartikan makna leksikal yang dibangun dari beberapa kata. suka memukul − gerak langkah = perbuatan − dipeti-eskan = dibekukan atau tidak digunakan − tertangkap basah = terlihat saat melakukan − gali lubang tutup lubang = pinjam sini. tajam − rambutnya bagai mayang mengurai : ikal. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Makna idiomatik (ungkapan) Secara umum ungkapan berarti gabungan kata yang memberi arti khusus atau kata-kata yang dipakai dengan arti lain dari arti yang sebenarnya. pinjam sana − banting stir = mengubah haluan − jantung hati = kekasih Ungkapan berfungsi menghidupkan. Tiga kata atau lebih − diam seribu bahasa : membisu − hutangnya setiap helai bulu : tak terhitung banyaknya Menurut zaman a. Contoh: − ringan tangan = rajin bekerja. melancarkan serta mendorong perkembangan bahasa Indonesia supaya dapat mengimbangi perkembangan kebutuhan bahasa terhadap ilmu pengetahuan dan keindahan sehingga tidak membosankan. Menurut jumlah kata a. ungkapan ibarat kembang-kembangnya. Ungkapan baru − ranjau pers − berebut senja − ranum dunia : undang-undang pers : siang berganti malam : penyebab kesulitan 73 2. 1. Ungkapan lama − matanya bagai bintang timur : bersinar. keriting − berminyak air : berpura-pura b. ungkapan dapat diperinci ke dalam beberapa jenis berikut.c.

Persis di bangunan kantor pos Jakarta kota tertancaplah sebuah kawasan bangunan kolot yang kuat. antonim. Menurut asalnya a. Namun kalimat 1 lebih jelas isinya. dan hiponim. b. a. Ungkapan berasal dari bahasa daerah − soko guru : suri tauladan − anak bawang : yang tidak diutamakan 2. Dalam kalimat tertentu. Makna Kata Berdasarkan Hubungan Antarmakna Makna kata berdasarkan hubungan antarmakna terdiri atas sinonim. 74 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . sesungguhnya arti kata-kata itu tidaklah sama betul.3. Ungkapan berasal dari bahasa asing − black sheep : kambing hitam − over nemen : mengambil oper − side effect : akibat samping b. suatu kata mungkin dapat digunakan tetapi dalam kalimat lain tidak dapat digunakan atau penggunaannya selalu dipertimbangkan oleh unsur nilai rasa atau lingkungan penuturnya (kontekstual). Contoh sinonim dengan kata yang sama maknanya : − − − Bung Hatta telah wafat. Sinonim Sinonim ialah pasangan kata atau kelompok kata yang mempunyai arti mirip atau hampir sama. Makna kalimat 1 dan 2 sama. kalimat 2 pilihan katanya kurang tepat sehingga pembaca / pendengar menjadi ragu menafsirkan maknanya. Walaupun sinonim menunjukkan kesamaan arti kata. Antonim Antonim adalah kata-kata yang berlawanan maknanya/berlawanan artinya. (sangat = amat) Contoh beberapa kata yang memiliki kemiripan makna : − − Tepat di muka gedung kantor pos Jakarta berdirilah sebuah kompleks bangunan kuno yang kukuh. (karena = sebab) Bung Hatta sangat berjasa. (telah = sudah) Kita merdeka karena jasa Bung Hatta.

d) Perkembangan anak itu sangat lambat.tangan rumah-makan c. Ia harus meminum obat itu sesuai yang dianjurkan oleh dokter. Oposisi gradual Contoh: − kaya. b) Aksi penebangan pohon merupakan perusakan hutan.Contoh: a) Sejak sakit batuk. Nasihat orang tuanya seringkali tidak didengarnya. Oposisi antarkata dapat berbentuk seperti berikut. Pemerintah menghimbau agar warga melestarikan hutan. Terdapat beberapa perbedaan antara kata-kata yang berantonim. c) Kadang-kadang ia berlatih seminggu sekali. ia menendang bola ke mulut gawang. Oposisi relasional (kebalikan) Contoh: − orangtua-anak − guru-murid − memberi-menerima e. ia pantang minum es.miskin − panjang. Oposisi inversi Contoh: − Jual-beli − Pulang-pergi Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 75 . laki-laki-perempuan jantan–betina hidup-mati Oposisi majemuk Contoh: − − − baju-merah sapu. Dengan tangkasnya. a.pendek d. Oposisi kembar Contoh: − − − b.

camat lurah. menonton. Untuk menyambut tahun baru. meratap. 2. c. Pukul 07. kambing. Oposisi komplementer Contoh: − mur-baut − kompor-minyak Oposisi inkompabilitas Contoh: − merah-hijau Oposisi hierarki Contoh: . g. yang memiliki semua komponen makna kata lainnya yang menjadi unsur bawahannya (hiponim). menengok. mengintip sapi. Jadi. Kata bunyi bisa digunakan untuk semua suara benda/sesuatu. sedangkan kata khusus digunakan untuk perinciannya. Proses hiponim dan hipernim menimbulkan istilah kata umum dan kata khusus.f. Kata Umum melihat mamalia Kata Khusus memandang. Kata melati dan mawar merupakan kata khusus. menyaksikan. kucing 76 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Ibu merangkai melati dan mawar. Kata umum dipakai untuk mengungkapkan gagasan umum. kata umum dapat diterapkan untuk semua hal. Hiponim Hiponim ialah kata yang memiliki hubungan hierarkis dengan beberapa kata yang lain. Berdasarkan contoh penggunaan kata umum dan kata khusus di atas. cermatilah kata umum dan kata khusus pada tabel berikut ini. Kata umumnya ialah bunga. sedangkan kata khusus diterapkan untuk hal tertentu saja. Kata umumnya ialah bunyi.00 WIB bel berdering cukup keras. Contoh penggunaan kata umum dan khusus dalam kalimat seperti berikut. Berdering (kata khusus). h. 1. Hubungan hierarki ini terdiri atas satu kata yang merupakan induk (hipernim). biasanya digunakan untuk bunyi bel.

contoh Jw untuk Jawa. rock. menggergaji D. mobil. boros. (3) Ragam bahasa. Di dalam kamus. kas untuk ragam kasar. menenteng. hor untuk ragam hormat. memikul. irit. keroncong. Kamus disusun berdasarkan abjad yang disertai penjelasan tentang makna dan pemakaiannya. contoh cak untuk cakapan. dan contoh-contoh pemakaiannya. Anat (anatomi) Ark (arkeologi). Bld untuk Belanda. contoh: Adm (administrasi dan kepegawaian). (2) Dialek. n (nomina). mengiris. memancung. sederhana jazz. (1) Label bidang ilmu. Penggunaan Kamus dalam Mencari Bentuk. Ar untuk Arab. v (verba) Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 77 .pola hidup musik kendaraan membawa memotong berfoya-foya. BT untuk Batak. termasuk pelafalan. kelas kata. menggendong memenggal. (4) Penjelasan makna. adv (adverbia). contoh a (adjektiva). bus menjinjing. memanggul. terdapat keterangan tentang hal-hal berikut. contoh berlari: berjalan kencang. menebang. dan Makna Kata Kamus dapat membantu seseorang untuk mencari variasi bentukan kata. mewah. Kategori. dan bentuk ungkapannya. (5) Label kelas kata. motor. pedoman kata.

dapat kita bentuk belasan kata turunannya. Bentuk berimbuhan tersebut menunjukkan pertalian yang teratur antara bentuk dan maknanya. Hal ini terjadi karena adanya proses asimilasi dan adaptasi dari kosakata asing dan juga akibat paradigma atau proses analogi. Dalam perkembangan bahasa Indonesia. kata banyak mengalami penambahan. Bentukan Kata/Frasa Baru Kata adalah satuan terkecil dari tata bahasa yang bermakna. Contoh bentukan kata berdasarkan paradigma: Cuci Mencuci (perbuatan) pencuci (pelaku) pencucian (proses) cucian (hasil) 78 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . sedangkan analogi membandingkan pola yang sudah ada. Dari satu kata. Paradigma artinya pembentukan kata mengikuti pola atau contoh yang sudah ada.Contoh Lembaran Kamus E. Pada dasarnya keduanya sama. Makna kata merupakan perwujudan kesatuan perasaan dari pikiran yang disampaikan lewat bahasa.

muncullah bentukan kata: − pramuwisma − pramusiwi − pramusaji − pramuria − pramuwisata − pramujasa 4. Bentuk Dasar potong cetak lukis tanam ajar Makna Pelaku pemotong pencetak pelukis penanam pelajar Proses pemotongan pencetakan pelukisan penanaman Hasil potongan cetakan lukisan tanaman Perbuatan memotong mencetak melukis menanam mengajar pembelajaran ajaran Contoh pembentukan frasa berdasarkan paradigma atau analogi. Dari frasa alih bahasa. muncul frasa yang sejenis.Berlaku pula pada kata-kata di bawah ini. muncul frasa baru: − bawah umur − bawah standar − bawah tanah − bawah harga 3. Dari frasa rumah produksi. Dari bentukan kata pramugari dan pramuniaga. Dari frasa hari raya muncul frasa baru : − jalan raya − pasar raya Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 79 . yaitu: − rumah singgah − rumah potong − rumah duka − rumah industri 2. 1. timbul frasa: − alih ragam − alih ilmu − alih kuasa − alih haluan − alih teknologi 5. Dari frasa bawah sadar.

dan Kalimat yang Kurang Tepat Dalam kegiatan berkomunikasi baik secara lisan maupun tulisan. parlementer : struktur. normal : teknis. Frasa. kalimat yang diungkapkan tidak tepat atau 80 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . − − − − − − − -if -er -al -is -isasi pascapra: aktif. timbul istilah: − adibusana − adikuasa − adidaya − adikarya Contoh pembentukan kata yang dipengaruhi oleh imbuhan asing. Pemakaian Kata . Dari istilah adipati. adakalanya pemakai bahasa tidak cermat memilih kata yang dituangkannya di dalam kalimat. panen raya Dari kata tamu agung muncul − jaksa agung − upacara agung − hakim agung − jumat agung − dewan pertimbangan agung − mahkamah agung − karya agung 7. agresif : komplementer. Dari gabungan kata angkat topi timbul gabungan kata: − angkat diri − angkat bicara − angkat sumpah − angkat sembah − angkat bahu − angkat kaki 8. legalisasi : pascapanen. prakarsa. F.− 6. normalisasi. pascasarjana : prasejarah. praktis : modernisasi. Akibatnya.

tidak sesuai dengan kaidah yang benar. Kesalahan itu dapat terjadi pada penggunaan bentuk kata (proses morfologi), pemakaian kelompok kata (frasa), pemilihan ungkapan, atau keefektifan kalimat. Dalam bentuk lisan, kesalahan itu terjadi disebabkan oleh hal-hal berikut. 1. Kesalahan penggunaan imbuhan (bentuk kata). Contoh : a. Pintu masuk SMK 3 akan diperlebarkan. (salah) Pintu masuk SMK 3 akan dilebarkan atau Pintu masuk SMK 3 akan diperlebar. (benar) b. Jangan dibiasakan mengenyampingkan masalah itu. (salah) Jangan dibiasakan mengesampingkan masalah itu. (benar) c. Rudi sedang mencat pagar rumahnya. (salah) Rudi sedang mengecat pagar rumahnya. (benar) 2. Ketidaktepatan pemakaian frasa (kelompok kata). Contoh : a. Untuk sementara waktu, siswa tidak bisa praktik karena ruangan sedang direnovasi. (salah) Untuk sementara siswa tidak bisa praktik karena ruangan sedang direnovasi. (benar) Bus Parahiyangan sudah dinyatakan laik darat. (salah) Bus Parahiyangan sudah dinyatakan laik jalan. (benar)

b.

3. Kesalahan kalimat a. Di dalam darah orang itu mengandung virus HIV. (salah) Darah orang itu mengandung virus HIV. (benar) b. Untuk peningkatan mutu pendidikan dari sekolah swasta dimana memerlukan ketekunan dan keuletan para pamong. (salah) Untuk meningkatkan mutu pendidikan sekolah swasta diperlukan ketekunan dan keuletan para pamongnya. (benar) Kesalahan juga banyak terjadi akibat penggunaan bentukan kata atau frasa yang baru yang tidak lazim atau tidak benar secara kaidah bahasa. Ketidaktepatan bentukan kata atau frasa juga dapat disebabkan kesalahan secara analogi atau paradigma.

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

81

Perhatikanlah contoh di bawah ini. a. b. c. pertanggungan jawab dalam kalimat “Laporan pertanggungan jawab gubernur telah diterima sebagian besar anggota dewan.” (tidak tepat secara kaidah/tidak lazim) seharusnya pertanggungjawaban. goreng pisang dalam kalimat “Ia membeli goreng pisang untuk adiknya.” (tidak tepat secara kaidah/tidak lazim ) seharusnya pisang goreng. pengangguran dalam kalimat “Ia menjadi pengangguran setelah perusahaannya bangkrut.” (salah secara analogi) seharusnya penganggur dari kata menganggur (verba)-penganggur (nomina)-pengangguran (nomina proses) ruang rokok untuk ruang khusus merokok (tidak lazim) meskipun dianalogikan kepada ruang tunggu untuk ruang khusus menunggu. Bentuk kata pemelajaran, tidak tepat secara analogi, sebab kata tersebut berasal dari kata belajar yang diberi imbuhan pe-an, seperti kata berhenti menjadi pemberhentian. Kata penglepasan, pada kalimat “ Penglepasan siswa kelas XII dimeriahkan dengan kegiatan pentas seni dari siswa-siswi.” Tidak tepat secara analogi, sebab kata dasarnya lepas, jika diberi imbuhan pe-an, menjadi pelepasan.

d. e. f.

Untuk membuat kalimat yang cermat, kita harus memahami ciri kalimat efektif. Kalimat yang baik atau efektif mempunyai ciri-ciri seperti berikut. a. Kepadanan − Memiliki S dan P dengan jelas. (di depan S tidak boleh ada kata depan dan di depan P tidak boleh ada kata penghubung yang) Contoh: (1) Semua mahasiswa perguruan tinggi ini harus membayar uang kuliah. (benar) (2) Bagi semua mahasiswa perguruan tinggi ini harus membayar uang kuliah. (salah) − Tidak terdapat S ganda. Contoh: (1) Dia pulang setelah dia membeli berbagai kebutuhan. (salah) (2) Dia pulang setelah membeli berbagai kebutuhan. (benar) Kata penghubung intra kalimat tidak dipakai dalam kalimat tunggal. Contoh: (1) Kami datang agak terlambat. Sehingga kami tidak dapat mengikuti acara pertama. (salah)
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

82

(2) Kami datang agak terlambat sehingga kami tidak dapat mengikuti acara pertama. (benar) b. Keparalelan Persamaan bentuk kata digunakan dalam kalimat yang mengandung rincian. Contoh: (1) Harga minyak dibekukan dan dinaikkan secara bertahap (benar) (2) Harga minyak dibekukan atau kenaikan secara bertahap. c. Kehematan Kehematan menggunakan kata atau frasa − Menghindarkan penjamakan bentuk jamak Contoh: (1) Para tamu-tamu mencicipi hidangan yang disediakan. (salah) (2) Para tamu mencicipi hidangan yang disediakan. (benar) Penggunaan kata-kata yang berlebihan. Contoh: (1) Ia memakai baju warna merah. (salah) (2) Ia memakai baju merah. (benar)

d. Kepaduan (tegas dan lugas) − Hindarkan kalimat bertele-tele. Contoh: (1) Kita harus dapat mengembalikan kepada kepribadian kita, orang-orang kota yang telah terlanjur meninggalkan rasa kemanusiaan itu dan yang secara tidak sadar bertindak ke luar dari kepribadian manusia Indonesia dari sudut kemanusiaan yang adil dan beradab. (salah) (2) Kita harus dapat mengembalikan kepribadian kita yang sudah ke luar dari rasa kemanusiaan dan dari kepribadian manusia Indonesia yang adil dan beradab. e. Kecermatan Kecermatan pemakaian kata, penulisan kata, penggunaan tanda baca. Contoh : Dua puluh lima ribuan. Bisa diartikan dua puluh lima lemar uang ribuan (Rp 25.000,-) Atau Dua puluh lembar uang, lima ribuan.

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

83

RANGKUMAN
A. Klasifikasi Kata berdasarkan Kelas Kata Secara umum kelas kata terdiri atas 5 macam, yaitu: (1) (2) (3) (4) Kata kerja (verba) Kata sifat (adjektif) Kata keterangan (adverbia) Kata benda (nomina), kata ganti (pronomina), kata bilangan (numeralia) (5) Kata tugas yang dapat dirinci menjadi empat jenis kata, yaitu (1) kata depan, (2) kata sambung, (3) kata sandang, (4) kata seru, dan (5) partikel. B. Klasifikasi Kata Berdasarkan Bentuk Kata Dari segi bentuknya, kata dapat dibedakan atas empat macam, yaitu : (1) Kata Dasar (2) Kata Turunan (3) Kata Ulang (4) Kata Majemuk C. Klasifikasi Kata Berdasarkan Makna Kata Selain proses bentukan kata, makna kata juga dapat ditimbulkan oleh dua hal, yaitu: (1) Makna kata berdasarkan hubungan referensial yang dibedakan menjadi makna denotatif, makna konotatif, dan makna idiomatik (ungkapan). (2) Makna kata berdasarkan hubungan antarmakna yang terdiri atas Makna kata berdasarkan hubungan antarmakna terdiri atas: sinonim, antonim, dan hiponim. D. Penggunaan Kamus dalam Mencari Bentuk, Kategori, dan Makna Kata Kamus dapat membantu seseorang bukan saja untuk mencari seperti variasi bentukan kata, kelas kata dan contoh-contoh pemakaiannya, termasuk pelafalan, pedoman kata, dan bentuk ungkapannya. 84
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

E. Pemakaian Kata , Frasa, dan Kalimat yang Kurang Tepat Dalam kegiatan berkomunikasi secara lisan atau tulisan masih terdapat pemakaian bahasa yang kurang cermat dalam memilih kata yang digunakan pada kalimat sehingga kalimat tidak sesuai dengan kaidah bahasa yang benar. Ketidakcermatan dapat terjadi pada pemilihan bentuk kata (proses morfologi, pemakaian kelompok kata (frasa), pemilihan ungkapan, atau keefektivitasan kalimat. Kesalahan juga bisa terjadi karena bentukan kata yang baru atau tidak lazim.

TUGAS MANDIRI
Agar Anda lebih memahami materi pelajaran ini, kerjakanlah tugas berikut. 1. Bacalah bacaan atau artikel di awal bab ini. 2. Daftarkanlah kata yang terdapat dalam bacaan berdasarkan kelas katanya. 3. Carilah kata yang bermakna denotatif, konotatif, dan berbentuk ungkapan. 4. Daftarkanlah kata yang bersinonim. 5. Tulislah antonim dari kata bersinonim pada no. 4. 6. Tulislah kalimat yang menurut Anda kurang tepat pemakaian kata atau frasanya. Lalu, perbaikilah kalimat tersebut.

UJI KOMPETENSI
I. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! 1. Kata bulan yang dipakai dalam arti denotatif terdapat pada kalimat a Ia kejatuhan bulan. b. Jangan mau menjadi bulan-bulanan. c. Ia berbulan madu ke Bali. d. Telah dua bulan ia pergi. e. Bulan muda dua hari lagi.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

85

Ketika berjumpa denganku. Kalimat di bawah ini bermakna konotatif. mobil. Deretan kata berikut yang termasuk kata sifat a. kecuali a. makan. b. sulit. murah. d. 6. e. c. jiwa ini milikMu juga. c. pertunjukan 86 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Karena setetes darah.2. timbulah bentukan kata di bawah ini. Gerombolan perampok itu telah diringkus polisi. Sudah sepuluh tahun ia menjadi karyawan disebuah perusahaan swasta. mainan d. pemandangan. 3. Dari frasa alih bahasa. Bini Pak Ahmad bernama Ani. Ayahnya bekerja sebagai buruh pabrik. alih ilmu b. alih teknologi c. banyak jiwa yang diselamatkan. Dokter Sadikin memeriksa jiwa pasien yang bernama Sinyo. mudah b. pemuda. 5. melatih. e. Tampaknya ia tidak ambil pusing terhadap masalah yang dihadapinya. Sepasang merpati itu bertengger di atas genting rumah tetangga. Oh Tuhan. d. Bu Aziz hanya dapat mengurut dada melihat tingkah laku anaknya yang tidak senonoh. Jiwa anak itu terganggu. baik-buruk c. b. Zainab menjadi bunga desa tempat ia dilahirkan. Daerah itu sudah bebas buta huruf. Arti kata jiwa dalam kalimat di atas sama artinya dengan kata jiwa dalam kalimat a. ia membuang muka. berusaha. alih haluan 4. alih kuasa e. Dokter penyakit jiwa sedang memeriksa pasiennya. b. lari. d. c. Kalimat berikut yang berkonotasi halus (positif) ialah a. alih-alih d. luas e. e. kecuali a. Sebaiknya badan dan jiwa kita harus sehat.

d. anjur b. kunang-kunang. kecuali a. tumpuan kesalahpahaman b. 10. buku-buku d. tumpuan ketidakadilan e. menganjur c. Penderitaan dan kebahagiaan adalah irama hidup. tumpuan kesalahan d. 11. anjurkan d. matanya bagai bintang timur d. tua-muda berbondong-bondong ke lapangan menyaksikan pertandingan itu. b. ubur-ubur e. sampah masyarakat 8. c. gerak-gerik Ungkapan lama yang jarang digunakan lagi adalah a. Pamanku menjadi kambing hitam dalam masalah itu. dibesar-besarkan b. ia selalu menganjur-anjurkan kedisiplinan kepada bawahannya. porak-poranda. tumpuan kemarahan c. menganjurkan e. anak-anak. Biaya transpor pulang-pergi ditanggung panitia. Bentuk dasar kata menganjur-anjurkan pada kalimat di atas adalah a. Sebagai pemimpin. huru-hara c. e. ranjau pers e. tunawisma c. Besar-kecil. Kalimat berikut yang mengandung kata berantonim. berjalan-jalan. gerak-gerik. Orang itu miskin harta namun kaya hati.7. Menjenguk atau mengunjungi orang sakit itu menumbuhkan rasa kesetiakawanan. tumpuan harapan Kata-kata di bawah ini yang termasuk kata ulang kata dasar a. hilang ingatan b. kambing hitam pada kalimat di atas bermakna a. menganjur-anjur Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 87 . 9.

ibu-bapa 15. Hasan Basri rohaniawan yang rendah hati. 88 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Kepada hadirin. e. 17. Dalam pembangunan gedung itu menggunakan baja tahan karat. Prof.J. d. Penulisan kata majemuk di bawah ini yang benar a. gadis-jejaka d. kami ucapkan selamat datang. c. sapu tangan e. sabtu-minggu 13. marah-hijau b. c. 16. Para hadirin sekalian dimohon berdiri. Prof.H. Prof. b. Masalah-masalah sosial perlu didiskusikan sedini mungkin. Habibie ilmuwan kebanggaan bangsa. 14. c. siap tempur b. Nugroho Susanto sejarahwan terkenal. Ayahnya seorang geologiawan. Ia menggambar mobil-mobilan. Adik sedang belajar menggambar. Digambarnya pula gunung-gunung. Pertandingan antara PSIS dan Persija berakhir seri. b. Kalimat yang menggunakan kata dalam makna umum adalah a. Pasangan antonim komplementer a. Contoh kalimat yang hemat kata (tanpa kata-kata mubazir) adalah a. K. ibu-bapak e. matahari c. d. d. e. Sumintro ekonomiwan terkemuka di Indonesia. b. Para pejabat-pejabat perusahaan sedang mengadakan rapat.12. b. Daftar nama-nama karyawan perlu dibagikan hari ini. Kalimat berikut yang termasuk kalimat rancu adalah a. Dr. Novel ini mengisahkan pelarian seorang gadis. e. B. c. Sekolah kami akan mengadakan bazar dalam rangka ulangan tahun yang ke-35. kaca mata d. mur-baut c. Penggunaan akhiran yang tepat terdapat pada kalimat a. Sekretaris adalah merupakan tangan kanan bosnya.

Di bawah ini terdapat kalimat yang menggunakan kata khusus kecuali a. Jika ada perbaikilah sehingga menjadi tepat! 4. polarasi b. d. Carilah kata-kata yang bersinonim dalam wacana di atas! Carilah kata-kata berantonim dalam wacana tersebut! 3. atau idiom yang kurang tepat. e. Setiap hari Sabtu dan Minggu kami sekeluarga selalu berkumpul di rumah Nenek. Sarjana itu sedang mengamati hasil temuannya. Peraturan itu berlaku bagi seluruh mahasiswa tanpa kecuali. berlaku d. seluruh b. Kejanggalan kalimat itu terjadi akibat penggunaan kata a. Adakah pemakaian kata. Bunga mawar adalah bunga kesukaannya.d. Amir sedang menengok bibinya yang sakit. Mereka melihat pemandangan yang indah. tanpa kecuali e. kelompok kata. membawa pengaruh buruk pada ahlaknya. biner II. Adakah penggunaan kata berkonotasi dan berdenotasi dalam wacana tersebut? Kelompokkanlah mana kalimat yang bermakna denotasi dan Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 89 . 18. Jawablah soal-soal di bawah ini dengan tepat dan benar! 1. Ia menoleh kepada adiknya. e. 2. c. b. Kalimat tersebut menggunakan antonim a. resasional c. Kadang-kadang menggambar pohon-pohon. 19. hierarki d. seluruh tanpa kecuali c. bagi 20. Karena pergaulannya kurang baik. suksesif e.

Jelaskan penyebab terjadinya kesalahan penggunaan kalimat dalam bentuk lisan dan tulisan! 9. Jelaskan klasifikasi kata berdasarkan kelas kata! 10. Sebutkan jenis-jenis ungkapan! Buatlah masing-masing dua kalimat yang menggunakan kata umum dan kata khusus! Carilah 5 contoh pembentukan kata yang dipengaruhi oleh imbuhan asing. − Yang naik sepeda jalannya pelan-pelan dikarenakan banyak anak-anak. 6. 7. − Pacar saya paling tercantik sendiri di kota ini. 90 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .mana yang bermakna konotasi! 5. 8. − Peristiwa itu terjadi disebabkan karena kekurangwaspadaan kita. Perbaikilah kalimat berikut agar menjadi kalimat yang benar! − Banyak murid-murid pergi berdarma wisata ke Bali.

mengajak. misalnya untuk memantapkan pemahaman (klarifikasi). seperti: memohon. merayu.BAB 5 MENGGUNAKAN SECARA LISAN KALIMAT TANYA/PERTANYAAN DALAM KONTEKS BEKERJA Standar Kompetensi Kompetensi Dasar - Berkomunikasi dengan bahasa Indonesia setara tingkat madya Menggunakan secara lisan kalimat tanya/pertanyaan dalam konteks bekerja - Indikator - Mengajukan pertanyaan yang sesuai dengan topik pembicaraan untuk menggali informasi secara santun Mengajukan pertanyaan yang memerlukan jawaban ya atau tidak . meminta kepastian (konfirmasi) Menggunakan pertanyaan retorik dengan menerapkan konsep dan ciri kalimat retorik Mengajukan pertanyaan secara tersamar dengan kalimat tanya untuk tujuan selain bertanya. atau menyanggah Materi kalimat tanya telah kita pelajari pada kelas X. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 91 . meminta. meyakinkan. Setelah mempelajari materi ini. menyuruh. kita diharapkan akan makin memahami hal-hal yang berkaitan dengan kalimat tanya dan dapat menggunakannya dengan benar dan tepat dalam berkomunikasi. kembali akan dipelajari kalimat tanya sebagai pengingat dan penguat. Pada bab ini. menyindir. menyetujui.

92 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Angka ini paling tinggi di wilayah Karesidenan Surakarta. Pemkab Sragen berupaya memacu pergerakan sektorsektor ekonomi. pada kuartal pertama 2007. terbukti pertumbuhan ekonomi terus mengalami peningkatan. Angka kemiskinan secara riil juga terus mengalami penurunan setiap tahunnya. Didukung SDM berkualitas yang bertumpu pada ilmu pengetahuan dan teknologi. Kebijakan ini diarahkan agar dapat mengurangi penduduk yang hidup di bawah garis kemiskinan. Mengupas strategi yang dijalankan Pemkab Sragen. kesehatan. industri. Untung Wiyono. dalam rangka mewujudkan keadilan dan kesejahteraan lahir batin. Tercatat.8%. kemajuan. Untuk itu. Bagaimana efektivitas program-program tersebut? Sangat efektif. hasil pertanian. wawasan lingkungan. Melihat kenyataan itu. pariwisata. perdagangan/jasa. dan penegakan supremasi hukum.Wacana Pertumbuhan Kami Paling Tinggi Pertumbuhan ekonomi berkaitan erat dengan kesejahteraan masyarakat. infrastruktur yang sebelumnya belum memadai. program dan kegiatan harus diarahkan pada kebutuhan mendasar bagi masyarakat miskin. pertumbuhan ekonomi Sragen mencapai 6. Apa program-program Pemkab untuk mengentaskan kemiskinan? Pemkab membuat program dan kegiatan yang secara langsung maupun tidak langsung dapat meningkatkan pendapatan masyarakat sekaligus dapat mengurangi jumlah pengangguran. Apa kendala yang dihadapi dalam menjalankan program-program itu? Kendala awal adalah data yang kurang akurat. Selain itu. Bagaimana visi Anda dalam membangun Sragen? Kami berkeinginan menjadikan Sragen sebagai kabupaten cerdas yang dilandasi kemandirian. berikut petikan wawancara SINDO dengan Bupati Sragen.

Perhatikan contoh keragaman kalimat tanya berikut. kemajuan harus terus ditingkatkan untuk mewujudkan masyarakat Sragen yang sejahtera. Selain itu. Satu PNS adalah Petugas Penyuluh Lapangan (PPL) yang tugasnya mengarahkan petani di desa untuk membangun ekosistem pertanian. Anda puas dengan hasil yang telah diperoleh? Yang jelas. Dua PNS lainnya fokus pada program pemberdayaan masyarakat desa. Program ini berbasis desa. Kemudian. (Sumber: Berita Kota Minggu. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 93 . 6 Januari 2008) A. Kalimat tanya juga digunakan untuk tujuan-tujuan tertentu yang disebut kalimat tanya tersamar. untuk menggali informasi. penjelasan. kami akan terus menjalankan program one-stop service. peternakan. atau pernyataan. dan perikanan yang ideal. Namun.Apa rencana Anda selanjutnya terkait program pengentasan kemiskinan? Desentralisasi desa dan kecamatan yang berorientasi pada pelayanan masyarakat. Pada pelajaran ini. serta menempatkan tiga PNS di tiap-tiap desa. Pemkab berharap proses sertifikasi tanah di Sragen bisa dilakukan secara serempak. keberadaan pelayanan terpadu satu pintu hanyalah salah satu sarana untuk meningkatkan kualitas pelayanan masyarakat. Jawaban atas kalimat tanya dapat berbentuk jawaban pendek atau panjang. Ke depan tetap diperlukan berbagai inovasi lain. ada juga kalimat tanya yang diajukan tanpa memerlukan jawaban yang disebut kalimat tanya retoris. Apa program terobosan yang akan dilakukan pada masa mendatang? Salah satunya membuat program pendataan tanah. atau konfirmasi. Dengan berbasis desa. Manajemen pemerintahan harus inovatif. Kalimat tanya berfungsi untuk meminta jawaban berupa penjelasan. tidak boleh berhenti. untuk klarifikasi. macam-macam kalimat tanya seperti itu akan kita pelajari kembali. Pengertian dan Fungsi Kalimat Tanya Kalimat tanya adalah kalimat yang disampaikan dengan maksud mendapat jawaban berupa informasi.

5. Di bawah ini adalah tabel yang berisi macammacam kata tanya dan tujuan penggunaannya berikut jawaban yang diinginkan oleh penanya. 4. 2. 8. mana yang Anda pilih? (pilihan) Di manakah alamat Anda? (menggali informasi tentang tempat) Apakah kita tidak malu menjadi bangsa yang terkenal karena korupsinya? (retorik) Siapa yang tidak hadir hari ini? (menanyakan orang) Bagaimana perasaannya. Perhatikan dengan saksama. Siapakah yang tidak ingin sukses? (retorik) B. Apakah Anda bersedia ditugaskan di sini? (konfirmasi) Dari semua barang yang ditawarkan ini. dan kalimat tanya tersamar. 3. 6. 7. Kalimat Tanya Biasa Salah satu ciri kalimat tanya ialah menggunakan kata tanya. 1. kalimat tanya dapat dibedakan menjadi kalimat tanya biasa. 94 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .1. kalimat tanya bertujuan untuk klarifikasi atau konfirmasi. 9. tanya retoris. Kata tanya biasanya digunakan untuk pertanyaan yang bertujuan meminta penjelasan atau menggali informasi. hanyalah Tuhan yang tahu. (retorik) Diakah orang yang kemarin mencarimu? (klarifikasi) Sudahkah Anda terima kiriman saya kemarin? (konfirmasi) Dapatkah Anda menyelesaikan tugas ini dengan cepat? (menyuruh) 10. Jenis Kalimat Tanya Dilihat dari pemakaian secara lisan maupun kalimat.

atau kritik. Contoh kalimat tanya retorik: 1. 4. 3.Kata Tanya Partikel (-kah) ? Menanyakan Jawaban yang di inginkan pa suatu benda/binatang ya/tidak/bukan cara/proses jumlah w aktu arah/asal tempat w aktu urutan arah/tujuan pilihan alasan orang/manusia alat menjelaskan cara/proses kerja sesuatu menjelaskan jumlah tertentu (yang pasti) menjelaskan w aktu/kurun w aktu tertentu menjelaskan arah/asal muasal sesuatu menjelaskan nama/lokasi/posisi tempat menjelaskan w aktu/kapan peristiw a terjadi me nje laskan urutan ke be rapa dari se jumlah angka agaimana (-kah) ? (-kah) ? (-kah) ? (-kah) ? (-kah) ? (-kah) ? (-kah) ? (-kah) ? (-kah) ? (-kah) ? (-kah) ? erapa lamana ari mana mana pan berapa mana menjelaskan arah/tujuan yang dituju menjelaskan satu/beberapa dari sejumlah pilihan menjelaskan alasan/sebab terjadinya sesuatu menyebutkan nama dan penjelasan seperlunya menyebutkan alat yang digunakan ana engapa apa engan apa (-kah) ? Kalimat tanya untuk menggali informasi umumnya digunakan pada saat wawancara atau dalam dialog yang membahas tentang suatu hal. 5. Saya tidak habis pikir mengapa dia menolak penugasan itu. kerjaanmu hanya bermalas-malasan. Siapa yang bekerja keras. 2. Mana mungkin kita mampu membalas jasa kedua orang tua kita. dialah yang akan menjadi orang sukses. Kalimat Tanya Retorik Kalimat tanya retorik ialah kalimat tanya yang tidak memerlukan jawaban atau tidak mengharuskan adanya jawaban. Kalimat tanya retorik sering digunakan dalam pidato-pidato atau orasi. 2. Kalimat tanya retorik cenderung bersifat pernyataan hanya untuk mencari perhatian atau bermaksud memberi semangat. Apakah kita harus kembali dijajah? Bagaimana bisa tugasmu selesai. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 95 . gugahan. Pertanyaan diajukan kepada narasumber yang diharapkan dapat memberikan informasi atau penjelasan yang lebih dalam sesuai dengan yang ditanyakan.

2. Contoh: 1. dan jadi. terkadang menggunakan kata tanya. Bapak yang berada di belakang ini semua? 2. 1. Contoh: 1. Ada beberapa hal yang menandai bentuk pertanyaan untuk konfirmasi atau klarifikasi. Minuman ini beralkohol atau bukan? Sebagai penegasan benar tidaknya. Kamu jadi berangkat ke Bandung atau tidak? 2. Dia yang memukulmu kemarin? 2.Ciri-ciri pertanyaan retorik: (1) (2) (3) (4) berbentuk pertanyaan dan penegasan. yaitu seperti berikut. menggunakan kata bantu: benar. atau ya atau bukan. Contoh: 1. jadi benar. kita perlu mengajukan pertanyaan yang jawabannya cukup perkataan ya atau tidak. 5. Kalau begitu. 3. betul. Menggunakan informasi tanya dengan menekankan kata-kata yang dipentingkan. Contoh: 1. Apa Bapak bersedia hadir pada acara peresmian kantor baru? Apakah Anda masih sekolah? 4. orang yang bertanya dan yang ditanya sama-sama mengetahui jawabannya. Inikah yang dinamakan cinta? Anak itukah yang dicari polisi? Menggunakan kata tanya apa atau apakah. Menggunakan kata tidak atau bukan sebagai unsur penegas. Menggunakan partikel –kah. Kalimat Tanya untuk Konfirmasi dan Klarifikasi Untuk melakukan klarifikasi (penjernihan) maupun konfirmasi (pembenaran/penegasan). 2. tidak memerlukan jawaban. 3. 96 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .

Siapkah Anda berangkat sekarang? 3. kan kamu membawa koper ini? 3. Saya sangat senang jika Anda yang mengerjakan proyek ini. Benar dia adik kandungmu? 4. dan konfirmasi melainkan mengandung maksud-maksud lain. Kalimat Tanya Tersamar Kalimat tanya tersamar adalah kalimat yang berisi pertanyaan yang diajukan secara tidak langsung bukan untuk menggali informasi. d. Beberapa model kalimat tanya tersamar antara lain seperti berikut. Dapatkah Anda membantu saya hari ini. Bolehkah makanan ini saya cicipi? Kalimat tanya tersamar untuk tujuan menyeluruh Contoh: 1. Bisakah membuat kopi untuk kakek? Kalimat tanya tersamar untuk tujuan merayu Contoh: 1. klarifikasi. Siapa yang menolak berteman dengan orang sebaik kamu? Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI b. 2. Betul kamu yang mengambil uangnya? 3. Terima kasih Anda tidak membuang sampah di sini. 2. Jadi dia yang mendapat rangking satu? 2. Tidak keberatan. Bukankah Bapak bersedia untuk menyumbangkan tenaga dan pikiran dalam kegiatan amal ini? 2. Tentunya Anda yang pantas menduduki jabatan ini. Kalimat tanya tersamar untuk tujuan memohon Contoh: 1. Kamu orang yang sangat handal dalam mengatasi berbagai masalah.Contoh: 1. c. Sudikah Anda mampir ke rumahku? Kalimat tanya tersamar untuk tujuan meminta Contoh: 1. Masakan Anda kelihatannya lezat sekali? 2. 3. Sebaiknya kamu jangan berangkat sekarang. 3. 2. a. 3. e. 97 . Jadi benar ayahnya seorang pembunuh bayaran? 4. Maukah adik membantu saya menyelesaikan tugas ini? Kalimat tanya tersamar untuk tujuan mengajak Contoh: 1.

Mana mungkin saya menolak ajakanmu? 3. mengejek) Contoh: Memang ya pekerjaannya luar biasa sulit sehingga kamu bisa menyelesaikannya dengan cepat.f. Anda setuju dengan usulnya. kan? h. Kalimat tanya tersamar untuk tujuan menyanggah Contoh: 1. Mengapa kamu datang lagi ke sini? j. mencela. Saya kira kita sama-sama sependapat bukan? 2. Kalimat tanya tersamar untuk tujuan menyetujui Contoh : 1. Haruskah aku bersumpah agar kamu percaya? 3. g. Pekerjaan semudah ini tidak bisa diselesaikan dengan benar. Kalimat tanya tersamar untuk tujuan menyindir (mengkritik. i. Kalimat tanya tersamar untuk tujuan meyakinkan Contoh: 1. Kalimat tanya tersamar untuk menawarkan sesuatu Contoh: 1. Anda membutuhkan bantuan saya? 3. Masih adakah yang perlu saya bawakan? 98 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Inikah hasil usahamu. Boleh saya bantu? 2. Apakah tidak lebih baik kita tanyakan dulu masalah yang sebenarnya? 2. Saya rasa kamu mampu mengerjakannya hari ini? 2. Kamu ke sini tidak takut dimarahi ayahmu? 3.

semua itu konsepnya lain. bagaimana peranan pemuda dalam memberantas penyalahgunaan narkoba?” (7) Pertanyaan tidak bersifat memaksa.. Rafiq : “Bagaimana Bang Rafiq membina keluarga dan berhasil awet hingga sekarang?” : “Pertama begini. (3) Pilihlah kata-kata yang baik dan santun agar mendapat respons yang baik dan mendapatkan jawaban yang memuaskan. (1) Pertanyaan yang diajukan harus relevan dengan topik yang akan ditanyakan. menekan. saya punya satu prinsip dalam mengurus dan memelihara rumah tangga. kita perlu memperhatikan adab bertanya karena hal ini berhubungan dengan si penanya dan pihak yang ditanya. atau cenderung bertujuan mencari kesalahan narasumber.C. Contoh: Berikut ini contoh sebuah wawancara reporter Berita Kota dengan penyanyi dangdut legendaris A. (2) Pertanyaan yang diajukan benar-benar mengesankan keingintahuan terhadap sesuatu yang menjadi topik pertanyaan.” Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 99 . ada baiknya jika pertanyaan diawali dengan kata ”menurut pendapat . Mengutarakan Pendapat dengan Kalimat Tanya yang Santun Dalam melakukan tanya jawab. (4) Hindari pertanyaan yang bersifat subjektif/pribadi. (6) Jika pertanyaan menuntut sebuah tanggapan atau penilaian dari narasumber. Wartawan A. Adab bertanya yang baik menjadi faktor utama sebagai penentu respons pihak yang ditanya. Rafiq seputar keluarga dan rumah tangganya.”. Misalnya. Teknik atau cara mengajukan pertanyaan adalah seperti berikut.. ”Menurut pendapat Bapak. (5) Pertanyaan yang diajukan harus bersifat menggali informasi sebelum berlanjut ke pertanyaan yang bersifat konfirmasi atau penegasan.

Nah itu saya bawa dalam kehidupan saya. Toh orang tidak akan percaya kalau lihat penampilan saya bahwa saya nggak mabuk. satu pun nggak ada. jangan gitu. orang pendidikan yang betul-betul dididik oleh keluarga yang baik yang menurut saya cukup terhormat dan dengan landasan agama. terlambat saja saya pukul langsung. Istri saya orang rumahan. bahwa saya nggak doyan perempuan. Soal kualitas dan perkembangannya itu masing-masing. Rafiq : : Wartawan A. Bahkan katanya. wasyukurillah. Anak saya itu nggak ada satu pun yang berani ninggalin shalat. Saya menikah dengan jalur agamis.” “Maksudnya?” “Sampai saat ini saya dekenal orang. tetapi saya tekankan. lalu memberi nasihat-nasihat. Anak saya. jangankan ninggalin. Kenapa? Karena faktor agama.” “Anak-anak bagaimana?” “Apakah mereka juga mengikuti keteladanan yang Anda buat?” “Alhamdulillah. Saya ngomong. Saya nggak ada ampun kalau soal shalat. Orang nggak percaya bahwa sampai hari ini saya nggak penah kenal setetes minuman. belum ada yang bisa ngalahin saya. Itu kata orang. Tapi kalau soal shalat.” Wartawan A. jangan gini. sampai hari ini untuk penyanyi skill on the scope. Rafiq : : Wartawan A. Rafiq : : “Jadi. Rafiq : : 100 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . kita nggak boleh takabur. Anak-anak saya itu yang namanya persoalan mendekati narkoba. Langsung itu. Tapi soal yang lain saya dudukin. bagaimana dulu waktu memilih istri?” “Istri saya itu tipe orang yang tidak pernah ke sana kemari.Wartawan A. lagsung saya pukul.” “Keras sekali Anda mendidik anak?” “Ooh saya keras soal shalat.” “Hal apalagi yang Anda tekankan dalam mendidik anak?” “Masalah shalat dan mengaji. Rafiq : : Wartawan A. Merokok pun jika mungkin terjadi dilakukan secara sembunyi-sembunyi di belakang saya. nggak pernah macam-macam. ya.

Tapi bukankah tadi engkau bersama abangmu?” “Ya. Bungsu Bapak Bungsu Bapak Bungsu : : : : : Bapak : 101 .. usulnya dapat kumengerti. betapa celakanya. bahkan jiwa raganya. sehari kami tamasya mengitari seluruh penjuru kota. Dalam sangkar. Celaka. He heh. Dan sebuah usul diajukan segera mengungsi ke daerah penduduk yang serta aman tenteram. Sayang sekali kami tidak berhasil menjumpai ma. Selano “Dia putra sulungku. mana abangmu sekarang?” Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI Si bungsu senyum memandang. Dan dalam keadaan ini bagi seorang prajurit.” “Ah. ketika kami mendatangi asramanya.” “Ya. ya. dampaknya pun luar biasa kalau mau berpegang pada agama. nomor satu shalat. Bertahun-tahun mata hatinya digelapbutakan oleh nina bobok.. Oo.. Karena ia sudah terbiasa bertahuntahun hidup di sana.. ia tidak ada. dia selalu sibuk dengan urusan kemiliteran melulu. terkadang orang lebih suka ngomong sendiri. Anakku.Wartawan A. Bapak rupanya lagi ngomong seorang diri. Si anak hilang telah kembali ulang. seolah seluruh hidupnya tersita untuk urusan-urusan militer saja. Nak. Bertahun-tahun semangatnya dijinakkan oleh suap roti keju. ia sedang rapat dinas. Di mana saja mereka mesti shalat.. Kata mereka. Boleh dibuktiin. kepentingan negara ada di atas segalanya. Hem ya. lelabuai oleh si penjajah. Jauh dari debu prahara. Bukan saja seluruh waktunya. Rafiq : : “Efeknya bagaimana ke anak-anak?” Ooh luar biasa.” “Kita sedang dalam keadaan darurat perang. Bahkan. eh.” “Tunanganmu?” “Ah. Tapi. 27 April 2008) Drama Bapak Bapak : Karya: B. (Sumber: Berita Kota Minggu.

ya. pertimbangan bukanlah karena masa depan adikmu Bapak Sulung : : Bapak Sulung Bapak Bungsu Sulung : : : : : Bungsu : Bapak 102 : Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Tapi maaf. Seluruh penjuru kota dipotreti semua. kaubegitu capek tampaknya.Bungsu : “Oo.” Sibungsu pergi. bagaimana dengan putusan Bapak atas usulku itu?” “Menyesal sekali.” “Begitulah. kota tercintaku ini rupanya sudah berubah wajah dipenuhi baju seragam menyandang senapan. tidak mengapa. “Nak. Dan mumpung masih keburu waktu. Tapi.” “Jawaban Bapak sangat bijaksana. Bapak. berganti huru-hara keonaran. Dipagari lingkaran kawat berduri dan wajahnya kini menjadi garang berhiaskan laras-laras mesin. itulah yang hendak kuputuskan sekarang ini.” “Ya. Mengasohlah dulu. Setidak-tidaknya demikianlah anggapanmu karena bukankah secara kebetulan tunanganmu adalah seorang perwira TNI di sini. Mengasolah. bukan maksudku menyindirmu. kurasa abang akan segera tiba dan sudahkah Bapak menjawab usul yang diajukannya itu?” “Itulah. kaubenar. Si sulung mengantar dengan senyum. Abang..” “Bapak menjawab dengan penolakan.” “Nah.” Bapak Bungsu : : Sulung : “Huhuh. Nak. Tapi. Kauhanya sedang keletihan. Nak. bukan?” “Ya. pertanda akan hilang keamanan. biar aku pergi belanja dulu untuk hidangan makan siang nanti. itu dia!” Si sulung datang dengan mencangklong pesawat potret mengenakan kata mata hitam. Nak. suasana kota yang sedang dikecam keadaan darurat perang. adik sayang.” “Bijaksana? Ya. manisku. rupanya dia begitu rindu kepada bumi kelahirannya. Terus duduk melepas kaca mata dan meletakkan pesawat potret di meja. kota tercintaku ini masih tetap memperlihatkan kejelitaannya. di atas segalanya..” “Ah.

Dapatkah itu kauartikan suatu kemerdekaan?” “Baik. apa mesti dituntut. Nak. Di atas segalanya. segala lapangan kerja terbuka lebar-lebar bagi bangsa awak. Ketahuilah. Di sana kami punya wali negara. Juga bukan karena masa depan sisa usiaku.” “Oo. kita bukan politisi.seorang. lambang kuasa. ya Bapak. Bapak?” “Kemerdekaan. penjajahan. alat negara bangsa awak. seorang negarawan.” “Bebaskah kamu menuntut kemerdekaan?” “Hoho. “Sesungguhnyalah.” “Bagaimana kemerdekaan menurut kau. Dan justru. tidak pernah merasa menjadi budak belian ataupun tawanan perang.” Sulung Bapak Sulung Bapak Sulung Bapak Sulung : : : : : : : “Hem. Rukun berdampingan antara si putih dan bangsa awak. setiap patriot pada hakikatnya adalah seorang politisi juga. Di sana. di sana si Putih menjadi dipertuan.” “Dan di atas segalanya pula. karena kesadaran dan pengertian politiknya itulah seorang patriot akan senantiasa membangkang terhadap tiap politik penjajahan. Pak.. Bertahun sudah aku di daerah pendudukan sana bersama beribu bangsa awak tercinta.” “Kemerdekaan? Kemerdekaan siapa?” “Bangsa dan bumi pusaka ini. Lalu? Karena rumah dan tanah pusaka ini barangkali. Dan aku seperti juga mereka. Kendati tidak harus berarti menjadi seorang diplomat. baik. ya? Apa itu ya. Nak?” “Hem. Bapak. bagian terbesar tentara polisi.” Si Sulung tertawa. Lebih dari itu. Kami di sana manusia-manusia merdeka. di sana hidup merdeka. Dan sebuah bendera asing jadi lambang kedaulatan. kami di sana hidup dalam damai.” “Nak. “Bapak yang baik. Tapi ya.. bangsa awak. Di sana. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI Bapak Sulung Bapak Sulung : : : : Bapak : Sulung Bapak : : 103 .

. Renungkanlah itu. Macam-Macam Kalimat Tanya Dilihat dari pemakaian secara lisan maupun tulisan. atau konfirmasi.. keluarga dalam suasana aman tenteram dan masa pensiun yang enak. Kalimat tanya berfungsi untuk meminta jawaban berupa penjelasan. renungkanlah kebenaran ucapan ini. Kalimat tanya juga digunakan untuk tujuan-tujuan tertentu yang disebut dengan kalimat tanya tersamar. atau pernyataan. anakku. Dan marilah kuambil contoh masa lalu..” RANGKUMAN A. Bukankah dulu semasa kita masih hidup. Kemerdekaan adalah soal harga diri kebangsaan. untuk menggali informasi. Pengertian dan Fungsi Kalimat Tanya Kalimat tanya adalah kalimat yang disampaikan dengan maksud mendapat jawaban berupa informasi. kita perlu memperhatikan adab bertanya karena hal ini berhubungan dengan si penanya dan pihak yang ditanya. soal kehormatan kebangsaan. B.. sudah dengan sendirinya berarti hidup dalam kemerdekaan? Tidak Anakku! Kemerdekaan tidak ditentukan oleh semua itu.. apakah suatu bangsa menjadi yang dipertuan mutlak atas bumi pusakanya sendiri atau tidak. Ia ditentukan oleh kenyataan. penjelasan. Nak. untuk klarifikasi. kita perlu mengetahui teknik104 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Mengutarakan Pendapat dengan Kalimat Tanya yang Santun Dalam melakukan tanya jawab.Betapapun manis bentuk lahirnya. Adab bertanya yang baik menjadi faktor utama sebagai penentu respons pihak yang ditanya. Renungkanlah . kalimat tanya dapat dibedakan menjadi beberapa macam. yaitu: (1) (2) (3) (4) Kalimat tanya biasa Kalimat tanya retorik Kalimat tanya untuk konfirmasi dan klarifikasi Kalimat tanya tersamar C. Untuk itu. Ya.

UJI KOMPETENSI I. bagaimana 2. partikel -lah Kata tanya yang tepat untuk menanyakan terjadinya suatu peristiwa adalah a. TUGAS KELOMPOK 1. Klasifikasikanlah berdasarkan macamnya! Buatlah dialog singkat dengan menggunakan beberapa kalimat tanya! Jelaskanlah kalimat tanya yang Anda gunakan dalam dialog tersebut! 2. satunya lagi sebagai narasumber. Satu orang sebagai pewawancara. Partikel -kah b. apa d. bilamana b. Yang bukan unsur pembentuk kalimat tanya/ciri kalimat tanya adalah a. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! 1. mengapa c. Bacalah wacana dialog di awal bab bersama teman sebangku Anda dengan penghayatan. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 105 . kata tanya e. Lakukanlah secara bergantian! Analisislah bersama teman Anda.teknik mengajukan pertanyaan agar tujuan kita tercapai. 3. tanda tanya d. siapa e. intonasi tanya c. Ucapkanlah secara lisan kalimat tanya dengan intonasi yang tepat. 4. pemakaian kalimat tanya yang terdapat pada naskah drama di atas.

dan konfirmasi disebut kalimat tanya a. Mengapa ayahnya menjodohkan anaknya? d. e. ke mana d. Sudikah Anda mampir ke rumahku? d. Dapatkah Anda membantu saya hari ini? Kalimat tanya yang berisi pertanyaan diajukan secara tidak langsung bukan untuk menggali informasi. retorik b. 6. klarifikasi 106 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 4. retorik c. tersemar d. 7. menggali informasi Kata tanya yang tidak baku pemakaiannya dalam kalimat adalah a. Saya sangat senang jika Anda menjalankan proyek ini.3. bukan. kapan c. siapa e. Apakah anaknya dijodohkan oleh ayahnya? c. tersamar d. Siapakah yang mencarikan jodoh anaknya? e. kenapa b. belum disebut kalimat tanya a. konfirmasi c. tidak. konfirmasi b. apa Kalimat tanya tersamar untuk tujuan menyuruh a. Ayah Amirudin mencarikan jodoh anaknya? b. Anaknya dicarikan oleh ayahnya jodoh? Kalimat tanya yang hanya memerlukan jawaban singkat berupa ya. Masakan Anda kelihatannya lezat sekali? c. klarifikasi. Maukah adik membantu saya menyelesaikan tugas ini? b. memerintah e. berita e. Ayah Amirudin akhirnya mencarikan jodoh anaknya seorang gadis dari marga Siregar. 5. . Pertanyaan yang sesuai dengan kalimat tersebut adalah a.

d. Siapkah Anda berangkat sekarang? c. b. Kalimat tanya tersamar untuk tujuan menyindir adalah ….. Anda membutuhkan bantuan saya? e. a. Bukankah kita tidak punya dana sebesar itu? d. Inikah hasil usahamu? e. Anak itu dicari polisi? 11. Pekerjaan semudah ini tidak bisa kamu selesaikan dengan benar? c. Kalimat tanya tersemar untuk tujuan merayu adalah a.8. Masih adakah yang perlu saya bawakan? e. Apakah Bapak bersedia hadir pada acara itu? 12. 10. Saya tidak habis pikir mengapa ia menolak penugasan itu. Mana mungkin saya menolak ajakanmu. Benarkah makanan ini saya cicipi? c. Jadi dia yang mendapat rangking satu? e. Anda setuju. kan dengan usulnya? d. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 107 . 9. Bukankah naskah ini harus diketik? b. Apakah Anda masih sekolah? e. Kamu orang yang sangat handal dalam mengatasi berbagai masalah. Boleh saya bantu? c. Betul kamu yang mengambil uangnya? c. Kalimat tanya tersamar untuk tujuan menyanggah a. Terima kasih Anda tidak membuang sampah di sini. Mana mungkin saya menolak ajakanmu. Kalimat tersamar untuk tujuan meyakinkan adalah a. Saya rasa kamu mampu menjalankannya hari ini. Siapa yang menolak berteman dengan orang sebaik Anda? d. b. Haruskah aku bersumpah agar kamu percaya? b. Dia yang memukul kemarin? d. Kalimat tanya yang menggunakan intonasi dengan menekankan katakata yang berkepentingan adalah a. Berapakah usiamu sekarang? b.

Tentunya Bapak bersedia untuk menjadi pembicara dalam diskusi besok. Tidak keberatan. Sudikah Anda mampir ke rumahku? b. Inikah hasil usahamu? b.13. Kalimat tanya tersamar untuk tujuan meminta a. 14. Di bawah ini merupakan kalimat tanya yang santun. Berkenankah Bapak menjadi pembicara dalam diskusi besok? d. b. Minuman itu pahit apa tidak? d. bukan? 17. Kalimat tanya tersamar untuk tujuan menyetujui a. wawancara dialog pidato diskusi percakapan 16. c. Bolehkah saya istirahat sebentar di sini? e. e. kan membawakan koper ini? d. Anda membutuhkan bantuan saya! 15. d. Apakah Bapak bersedia menjadi pembicara dalam diskusi besok? b. Kalimat tanya tersamar untuk tujuan mengajak a. Maukah adik membantu saya menyelesaikan tugas ini? b. e. Siapa yang bekerja keras dialah yang akan sukses. Kalimat tanya retorik sering digunakan pada situasi a. Bersediakah Bapak menjadi pembicara dalam diskusi besok? c. Boleh. Tentunya Anda yang pantas menduduki jabatan itu. Anak itulah yang dicari polisi. Terima kasih Anda tidak merokok di ruangan ini. kan makanan ini saya cicipi? e. Benar ia adik kandung saya? c. kecuali a. 108 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Siapkah Anda berangkat sekarang? c. d. Siapkah Anda berangkat sekarang? c. Mau tidak Bapak menjadi pembicara dalam diskusi besok? e.

Sebaiknya Anda berangkat sekarang. Jadi benar ayahnya seorang pembunuh bayaran? d. 3. Kamu jadi membeli baju atau membeli sepatu? e. Apakah kamu sudah mengirimkan surat untuk Nenek di kampung? c. Paman setuju atau tidak ia kuliah di Bandung? c. Bagaimana cara Bapak membangun usaha ini? II. Bukankah dia yang membawa bukumu? b. Kalimat tanya yang bertujuan untuk menggali informasi a. Masih adakah yang perlu saya bawakan? b. jelaskan topik pembicaraan dalam naskah drama tersebut! Adakah sikap-sikap yang menyimpang dari ketentuan dalam menerapkan pola gilir dalam berkomunikasi dalam dialog drama tersebut? Buatlah kalimat tanya tersamar dengan tujuan mengajak. menyuruh. Sudikah kiranya Bapak membantu kami? d.18. Maukah kamu mampir ke rumah ku? c. 109 . Untuk apa kita hidup bila harus terus menderita? e. meminta. 2. Kalimat tanya yang bertujuan untuk menawarkan sesuatu a. Carilah kalimat pertanyaan yang bersifat retoris dari cerita drama di atas! Temukan kalimat tanya yang bersifat konfirmasi dari cerita drama di atas! Setelah kamu membaca percakapan dalam naskah drama. Mana surat yang harus saya tanda tangani? e. Kapan kamu bisa main ke rumahku? d. Kalimat tanya tidak baku di bawah ini adalah a. Benarkah barang ini milik Bapak? b. 20. masing-masing satu kalimat! Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 5. 4. Jawablah soal-soal di bawah ini dengan tepat dan benar! 1. Bagaimana kalau kamu yang melanjutkan tugas itu? 19.

Kegiatan ekstrakurikuler sekolahku menarik. a. d. 9. Sebutkan empat cara untuk mengubah pernyataan menjadi pertanyaan yang memerlukan jawaban ya atau tidak atau ya atau bukan! 110 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Bapaknya mempunyai sawah yang luas. e. 7. Pamannya seorang montir. Sebutkan hal-hal yang menandai kalimat konfirmasi dan klarifikasi! Buatlah dua contoh kalimat tanya yang bersifat klarifikasi! 8.6. 10. c. b. Kepala sekolah sedang mengikuti seminar. Jelaskan teknik atau cara mengajukan pertanyaan yang baik! Ubahlah pernyataan di bawah ini menjadi pertanyaan yang memerlukan jawaban ya atau tidak dan ya atau bukan. Kenalannya manajer koperasi.

khususnya parafrasa lisan. Tujuan pembelajaran ini agar kita makin memahami dan terlatih membuat parafrasa.BAB 6 MEMBUAT PARAFRASA LISAN DALAM KONTEKS BEKERJA Standar Kompetensi Kompetensi Dasar - Berkomunikasi dengan bahasa Indonesia setara tingkat madya Membuat parafrasa lisan dalam konteks bekerja - Indikator - Memparafrasakan informasi secara lisan dari hal yang telah dibaca dengan menggunakan bahasa sendiri Memparafrasakan informasi secara lisan dari hal yang sudah didengar dengan menggunakan bahasa sendiri Materi kalimat parafrasa telah kita pelajari di kelas X. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 111 . Pada bab ini akan dipelajri kembali materi tentang membuat parafrasa secara lisan dari sumber yang dibaca maupun yang didengar.

Dari kota marmer ini. kolam diberi ganggang air 112 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .Wacana Pemijahan Ikan Mas Koki Ala Tulungagung Masih Menekankan Kuantitas daripada Kualitas Siapa pun orangnya pasti sudah tidak asing lagi dengan jenis ikan ini. Tempat yang ideal untuk mengawinkan ikan mas koki adalah bak air atau kolam berukuran 1 x 4 meter persegi dan diisi air sedalam 30 cm. Kemudian. cukup melihat sirip bawah bagian depan. ribuan mas koki bahkan diekspor ke luar negeri. kualitas induk harus benar-benar diperhatikan. biasanya ikan mas koki betina yang siap kawin akan selalu berenang di tepi kolam mencari tempat untuk meletakkan telurnya. Induk yang baik hendaknya dipilihkan dari ikan mas koki yang berumur minimal 6 bulan ( kira-kira sebesar kepalan tangan orang dewasa ) dan maksimal 10 bulan karena pada umur itu telur maupun sperma dari induk dianggap sudah matang dan ikan ini mulai menunjukkan birahinya. ikan tersebut harus dipilih yang benar-benar siap kawin. Tahap pertama yang paling penting dalam proses pemijahan ikan mas koki adalah pemilihan induk. langkah selanjutnya adalah menyiapkan tempat untuk mengawinkan. sirip yang sempurna (tidak robek atau kusut). ikan ini juga lebih mudah untuk dipijahkan. gerak harus lincah. Jika betina. bagian tepinya ada gerigi kecil-kecil. Setelah ditentukan induk yang baik. Perut mas koki betina akan membesar dan terkesan lunak jika disentuh. Salah satu sentra budi daya ikan hias adalah Kota Tulungagung. Mas Koki adalah salah satu ikan hias paling populer sejak dulu. sirip tersebut akan bertekstur halus. indukan berkualitas harus memenuhi berbagai kriteria lainnya lagi. dan bentuk tubuhnya langsing. Selain hal tersebut di atas. Jika kita ingin menghasilkan anakan mas koki yang baik. dan bagian tepinya rata serta memiliki bentuk tubuh yang lebih besar daripada mas koki jantan. Selain perawatannya mudah. Menurut Sayuti. seperti sisik harus gena. salah satu peternak ikan mas koki dari Tulungagung. asalkan proses pemijahannya benar. kita harus bisa membedakan mana ikan jantan dan mana ikan betina. Jika ikan mas koki betina sudah menunjukkan ciri-ciri tersebut. Ciri ikan mas koki betina siap kawin biasanya akan terlihat pada usia sekitar 6 bulan. Jika mas koki jantan. sirip tersebut akan bertekstur kasar. Pertamatama. panjang. bebas dari penyakit. segeralah carikan induk jantan yang berkualitas untuk dikawinkan. dan yang paling penting. Selain itu. untuk mengetahui ciri-ciri jantan atau betina. pendek.

00. Anakan yang berumur 2 hari sebaiknya diberi makanan kutu air sampai berumur 9 hari. induk harus diberi pakan jentik-jentik nyamuk. Pemasaran ikan mas koki tidaklah sesulit yang dibayangkan karena pada dasarnya penggemar jenis ikan ini masih cukup banyak. Dan penghobi-penghobi di Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 113 . Kalau tidak ada. indukan mas koki bisa dipindahkan ke kolam lainnya. telur ikan mas koki yang baik berwarna putih kecokelatan dan berbentuk butiran kecil-kecil.per ekor. Dalam waktu kurang dari 24 jam atau setelah tampak telur yang menempel pada gagang/kain kasa. Dapat dihitung berapa keuntungan yang diperoleh dari budi daya ikan ini. Menurut Hariyanto atau dikenal Ari.untuk tempat maskoki menempelkan telur. anakan ikan mas koki sudah bisa dipasarkan.000 ekor anakan. Agar tetasan yang dihasilkan baik. sedangkan satu pasang induk yang baik rata-rata bisa menetaskan sampai 5. Pada saat itu diusahakan agar kolam tidak terkena sinar matahari langsung. atau kalau tidak ada ganggang air. sepasang induk mas koki selama waktu produktif 4 bulan (antara 6 bulan sampai 10 bulan) bisa menghasilkan 30. Caranya kolam ditutupi bagian atasnya karena anakan ikan mas koki sangat rentan terhadap perubahan suhu yang drastis. Akibatnya. induk sudah bisa dikawinkan lagi. Menurut Sayuti.” jelas Sayuti. bisa digantikan dengan cacing darah. Menurut Sayuti. sampai berumur 10 bulan. Hasil anakan yang baik bisa diketahui dari telurnya. Setelah semua persyaratan tersebut terpenuhi. bisa disiasati dengan memberi kain kasa atau kelambu. koki dari Tulungagung kualitas dan harga jualnya tidak bisa tinggi. anakan bisa diberikan pakan berupa cacing darah yang kecil-kecil. Setelah itu. penghobi mas koki di Jakarta. Setelah 18-20 hari berikutnya. Jika dihitung-hitung. calon induk bisa segera ditempatkan dalam kolam pengawinan tersebut.000 ekor sekali tetas. Tapi sangat disarankan pemberian pakan jentik-jentik nyamuk. pakan untuk induk saat pengawinan juga harus diperhatikan. “ Supaya anakan yang dihasilkan bisa berkualitas baik. “Mereka masih menekankan kuantitas. Telur ikan mas koki menetas dalam jangka waktu kurang lebih 3 hari. sayangnya petani Tulungagung masih kurang memerhatikan kualitas ikan yang dihasilkannya. anakan ikan mas koki sebesar batang korek api dengan panjang 1 cm (umur kurang dari 2 minggu) bisa laku sampai Rp 40. Setelah berumur 12 hari.00-/Rp 50. dan tidak memerhatikan penanganan saat panen.

” (Sumber : Majalah Ikan+Mancing. langkah membuat parafrasa ialah dengan cara meringkasnya terlebih dahulu. Januari 2003) A. B. Untuk mereka yang baru dalam taraf belajar. Parafrasa tampil dalam bentuk lain dari bentuk aslinya. parafrasa adalah seperti berikut. dengan maksud untuk dapat menjelaskan makna yang tersembunyi. Parafrasa cenderung diuraikan dengan menggunakan bahasa si pembuat parafrasa bukan diambil dari kalimat sumber aslinya apalagi membuat parafrasa secara lisan. Hal itu lazim dilakukan oleh orang yang sudah terbiasa membuat parafrasa. Pengertian Parafrasa Berdasarkan Kamus Besar Bahasa Indonesia. (1) Bacalah naskah yang akan diparafrasakan sampai selesai untuk memperoleh gambaran umum isi bacaan/tulisan. bentuk puisi ke prosa. misalnya sebuah wacana asli menjadi wacana yang lebih ringkas. harus diingat parafrasa disusun dengan bahasa sendiri. Parafrasa mengandung arti pengungkapan kembali suatu tuturan atau karangan menjadi bentuk lain namun tidak mengubah pengertian awal. (1) Pengungkapan kembali suatu tuturan dari sebuah tingkatan atau macam bahasa menjadi macam yang lain tanpa mengubah pengertiannya. bukan dengan bahasa asli penulis. dan sebaliknya. Cara Membuat Parafrasa Berikut adalah hal yang perlu dilakukan untuk membuat parafrasa dari sebuah bacaan. 114 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .Jakarta masih menyukai koki impor. (2) Penguraian kembali sebuah teks (karangan) dalam bentuk (susunan kata-kata) yang lain. Memparafrasakan suatu tuturan atau karangan secara lisan bisa dilakukan setelah mendengar tuturan lisan atau setelah membaca suatu naskah tulisan. Padahal harga koki impor jauh lebih mahal dibandingkan koki lokal. Namun. drama ke prosa.

sedikit sekali sekolah-sekolah yang mempunyai perpustakaan.(2) Bacalah naskah sekali lagi dengan memberi tanda pada bagian-bagian penting dan kata-kata kunci yang terdapat pada bacaan. kurangnya mutu keahlian dan fasilitas. kurangnya kerja sama dan tiada sistem informasi. alat-alat peraga ataupun laboratorium dan tempat praktik. Demikian pula jumlah anak yang putus sekolah (drop out) adalah jauh lebih besar daripada mereka yang berhasil menyelesaikan suatu tahap pendidikan. Demikian pula belum ada sistem informasi pendidikan untuk keperluan perencanaan yang terarah. Banyak masalah berat yang dihadapi pada awal Repelita I: masalah kurikulum. mutu keahlian tenaga-tenaga tersebut perlu ditingkatkan. Prasarana pendidikan seperti gedung dan ruang sekolah sangat tidak mencukupi. Wacana di atas dapat diparafrasakan sebagai berikut. Kecuali itu. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 115 . (3) Catatlah kalimat inti dan kata-kata kunci secara berurut. (4) Kembangkan kalimat inti dan kata-kata kunci menjadi gagasan pokok yang sesuai dengan topik bacaan. Akhirnya. terdapat ketidakseimbangan baik di antara berbagai tingkat pendidikan vertikal maupun di antara berbagai jenis pendidikan. Jumlah anak yang tidak tertampung di sekolah jauh lebih besar daripada jumlah anak yang bersekolah. (5) Uraikan kembali gagasan pokok menjadi paragraf yang singkat dengan bahasa sendiri. Di bidang kurikulum terasa sekali kebutuhan akan pembaharuan agar sistem pendidikan dapat memenuhi tuntutan pembangunan dan kemajuan. kekurangan tenaga pendidikan. Agar lebih jelas perhatikanlah contoh di bawah ini. Wacana asli Masalah-masalah yang dihadapi di bidang pendidikan pada saat akan dimulainya pelaksanaan Repelita I adalah sangat berat dan mendesak. Sementara itu. tenaga-tenaga yang bekerja di bidang pendidikan baik teknis maupun administratif sangat kurang jumlahnya. Di samping itu. organisasi dan pengelolaan pendidikan dan kebudayaan di pusat maupun di daerah belum mencerminkan kerja sama yang serasi. Di samping itu. penampungan murid dan masalah putus sekolah. ketidak-seimbangan tingkat dan jenis pendidikan. Buku-buku sangat sedikit jumlahnya.

(5) Sampaikan secara lisan atau dibacakan. (7) Jika kesulitan menguraikannya. Memparafrasakan Puisi Menjadi Prosa Puisi merupakan salah satu karya sastra yang bentuknya tidak sama dengan prosa atau karangan biasa. Hal-hal yang perlu diperhatikan dalam memparafrasakan puisi menjadi prosa ialah seperti berikut. Bacalah atau dengarkan pembacaan puisi dengan seksama. 116 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI (1) (2) (3) (4) . (b) Gunakan ungkapan yang sepadan jika terdapat ungkapan untuk membedakan dengan uraian aslinya. Mengembangkan kalimat inti atau kata-kata kunci menjadi pokokpokok pikiran yang sesuai dengan tema/topik informasi sumber. Menulis inti atau pokok informasi dengan kalimat sendiri. Jelaskan kata-kata kias atau ungkapan yang terdapat dalam puisi. diungkapkan kembali secara lisan dengan kalimat sendiri dengan menerapkan teknik membuat parafrasa sama seperti di atas. Uraikan kembali isi puisi secara tertulis dalam bentuk prosa dengan menggunakan kalimat sendiri. Teknik membuat parafrasa lisan adalah seperti berikut. Oleh karena itu. Memahami isi informasi secara umum. Pada puisi banyak terdapat kata-kata yang bermakna kias atau konotasi. (d) Jika berbentuk narasi. C. bisa menggunakan kata ganti orang ketiga. (1) (2) (3) (4) (5) Membaca informasi secara cermat. hal di bawah ini dapat membantu: (a) Gunakan kata-kata yang bersinonim dengan kata aslinya. Pahami isi kandungan puisi secara utuh. isi atau tema puisi biasanya tersirat. Puisi terbagi ke dalam larik-larik atau bait.Membuat parafrasa lisan berarti uraian tertulis yang telah dibaca atau yang telah didengar. Mencatat kalimat pokok atau inti secara urut. (c) Ubahlah kalimat langsung menjadi tidak langsung atau kalimat aktif menjadi pasif. (6) Menyampaikan atau menguraikan secara lisan pokok pikiran tersebut dengan menggunakan kata atau kalimat sendiri.

menuju ke arah padang bakti. miskin harta (tidak berilmu dan tidak mempunyai harta apa-apa). ia merasa miskin ilmu. Akan tetapi. Ali Hasyimi Setelah kita mendengarkan pembacaan puisi tersebut. ia tidak berhenti dalam sesalnya. Ia bangkit dan mengajak generasi muda: atur barisan di hari pagi. Puisi “menyesal”. miskin harta Ah. Ia lalai dan lengah. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 117 ... dapat kita parafrasa sebagai berikut. apa guna kusesalkan Menyesal tua tiada berguna Hanya menambah luka sukma Kepada yang muda kuharapkan Atur barisan di hari pagi Menuju ke arah padang Bakti Puisi Baru. karya Ali Hasymi mengisahkan seseorang yang menyesali masa mudanya tidak dimanfaatkan dengan sebaik-baiknya.Contoh parafrasa puisi Menyesal Pagiku hilang sudah melayang Hari mudaku sudah pergi Sekarang petang datang membayang Batang usiaku sudah tinggi Aku lalai di hari pagi Beta lengah di masa muda Kini hidup meracun hati Miskin ilmu. Kini di hari tuanya. Ia merasa tidak ada guna menyesali diri.

Naskah drama terdiri atas uraian cerita dan dialog. atau perasaan si tokoh yang ditulis di dalam kurung.” Kurdi Rurin Kurdi : : : 118 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . pa! ” (makin keras menabuh meja). Dalam naskah drama. (1) Pahami setting atau latar cerita. Bacalah naskah drama berikut! Kudri sedang asyik memukul-mukul meja dengan irama dangdut. Rurin Kurdi Rurin Yadi : : : : (kesal) “Hentikan!” (belagak bodoh) “Ha. lalu masuk ke kelas dan menari-nari lagi) “Enak juga menari-nari begini. tokoh ditulis berjajar di sebelah kiri diikuti dengan percakapan tokoh tersebut. Jika dalam puisi banyak terdapat simbol..... ya Kur!” “Asyi iiiiiik!” (membentak lagi sambil menutup kedua telinganya) “Hei. Sesekali terdapat penjelasan mengenai gerakan. perilaku.. namun lebih banyak unsur dialognya. (3) Pahami penjelasan tentang tokoh yang ada di dalam kurung. (2) Pahami dialog dan ambil simpulannya secara menyeluruh. kita harus memperhatikan unsur berikut. Mereka berdua sedang belajar. pikiran. Yadi menarinari di depan kelas. berhenti!” “Aaa . pada naskah drama.?” (terus memukul-mukul meja guru lagi) (bangkit lalu menarik lengan Yadi seraya membentak) “Keluar kau!” (keluar sebentar dan ketika mendengar Kurdi menabui meja lagi. Memparafrasa naskah drama sama dengan puisi. uraikan kembali cerita drama ke bentuk prosa singkat dengan menggunakan bahasa sendiri. Setelah mendapatkan kesan secara umum jalan cerita dalam naskah drama.. yaitu kita harus membacanya untuk memahami jalan ceritanya secara utuh. Rurin dan Mini duduk di bangku deretan paling depan.D.. Memparafrasakan Naskah Drama Menjadi Prosa atau Cerita Naskah drama juga termasuk karya sastra memiliki ciri khas tersendiri. “Ayo kita ganti irama jaipongan.

Kur! Kita kan sedang istirahat. kenapa kami tidak boleh?” “Sudahlah. tak usah ribut! Kita ini teman sekelas. asy. pukul saja. Lalu. Kurdi didorong-dorong keluar. (setelah menatap Yadi. Rin! Biarkan saja! Nanti kalau sudah bosan akan diam sendiri!” “Berhenti atau tidak?” (mengancam) “Teruskan. lalu berkacak pinggang menantang Rurin) “mau apa?” “Jangan pukul begitu”. beraninya sama anak perempuan! Tak tau malu!” “Sudahlah. bukan?” “Bagus Kur! Ayoh lawan saja”. Bangkit mengambil penggaris.. kok ikut marah?” “Kalian memang suka mengganggu!” “Mengganggu?” “Jangan tabuh meja itu! Kalau mau menari-nari dan tabuhtabuhan sana di depan toko atau di pasar!” “Hei. (tidak sabar lagi. (memberi semangat) “Ayo.Yadi Kurdi Yadi Mini Kurdi Mini Kurdi Mini Kurdi Mini Rurin Yadi Kurdi Rurin Yadi Rurin Mini Yadi Mini Kurdi Rurin : “Oke. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 119 .” “Asy i i i i i i i k!” (agak terkejut) “Ooo..” (berhenti menabuh meja.. berlagak jago ya !” (menunjuk keluar). “Kalau mereka boleh ribut. ya?” “Lho.. lalu kepada Kurdi) “Mereka bermain di luar kelas tau” “Ayo.... rupanya kalian memang sudah bersekongkol. kita mulai. lalu mengancam) “Kalian mau keluar atau tidak!” Mini juga bangkit membantu Rurin. Sebuah pukulan mengenai punggung Kurdi. Suasana di kelas makin riuh. Yad!” (menabuh meja lagi). terjadi perebutan penggaris. oke !” (mulai menari lagi) : : : : : : : : : : : : : : : : : : : : “Asy. Yadi bersorak-sorak sambil bertepuk tangan. Kur!” “Heh.

bukan?” Yadi menjawab. Rurin dengan nada mengancam berkata. “Ha?” sambil terus memukul mukul meja guru lagi. kita ganti irama Jaipongan. berlagak jago ya?” “Kalau mereka boleh ribut. “Asyiiik!” Mini datang.. Kita ini teman sekelas. Kur!” Rurin menjawab. Ri! Biarkan saja! Kalau sudah bosen. pukul saja.. Kurdi berkata. Rurin tidak sabar lagi melihat kelakuan Kurdi dan Yadi. dengan berkata. “Berhenti atau tidak?” Yadi malah menyuruh Kurdi untuk terus menabuh meja. “Jangan pukul begitu.” Dengn kesal. Ia bangkit mengambil penggaris. Kurdi berkata. Mini menatap Yadi dan Kurdi bergantian seraya berkata. “Asyiiik. “Hei. “Teruskan. mereka saling berebutan penggaris. asy. “Hei. ya?” Kurdi membalas Mini dengan berkata. ya Kur!” Kurdi membalas dengan berkata. Rurin membentak lagi sambil menutup kedua tangannya sambil berteriak. ”Keluar!” Kemudian.. rupanya kalian sudah bersekongkol. “Enak juga menari-nari begini. Mini melarang Kurdi. akan diam sendiri. “Kalian mau keluar atau tidak?” Mini bangkit membantu Rurin dengan mendorong-dorong Kurdi keluar. sebuah pukulan mengenai punggung Kurdi. agak terkejut dan berkata kepada Kurdi dan Yadi. Rurin kesal dan bangkit lalu menarik lengan Yadi seraya membentak dan berkata. sedangkan Yadi sedang menari-nari di depan kelas. “Jangan tabuh meja itu!” “Kalau mau menari-nari sana di depan toko atau di pasar!” sambil menunjuk ke luar.” dan terus mengajar Yadi menari. “asy. Yadi keluar sebentar dan ketika mendengar Kurdi menabuhi meja lagi.” Kurdi akhirnya berhenti menabuh meja sambil berkacak pinggang menantang Rurin dan berkata.” Namun. “Sudahlah. Kur! Kitakan sedang istirahat. Rurin dan Mini duduk di bangku deretan depan. “Ayo.Parafrasanya adalah Kurdi sedang asyik menabuh-nabuh meja dengan irama dangdut. Mereka berdua sedang belajar. lalu Yadi menjawab.” Yadi memberi semangat kepada Kurdi dengan berkata.. “Mau apa?” Rurin menjawab. “Ayo. “Sudahlah tak usah ribut.” Yadi membalas.. “Lho kok ikut marah?” ”Kalian memang suka mengganggu?” Dengan suara keras. Rurin dengan kesal berkata. “Oke-oke!” Sambil mulai menari lagi.” Mini melerai. tahu!” Kurdi mengajak Yadi menabuh meja lagi. lalu mengancam. “Hentikan!” Namun dengan berlagak bodoh. Kurdi berkata. “Mereka bermain di luar kelas. sambil berkata kepada Kurdi.. Yadi bersorak-sorak 120 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .. “Heh! Beraninya sama anak perempuan! Tak tau malu. berhenti!” Kurdi membalas dengan berkata “Aa. ayo lawan saja!”. “Bagus Kur.pa!” dan menabuh meja makin keras dan kembali menabuh meja lagi sambil mengajak Yadi. “Oo. kenapa kami tidak boleh?” Mini menjawab sambil menghampiri Rurin.

Ungkapkan kembali cerita drama dengan bahasa sendiri. 3. aduk sampai rata jagung dan bumbu-bumbu tersebut sampai layu. masukkan larutan maizena sedikit demi sedikit sambil diaduk-aduk kurang lebih lima menit dan sisihkan. dengan memerinci cara kerja. Contoh: Pohon pisang merupakan pohon yang banyak fungsinya. 1. Ketiga. Keempat. jamur kancing. 2. masukkan daun bawang dan ayam cincang. bayam. lada. dan bumbu penyedap secukupnya. langkah-langkah atau tahapan pelaksanaan. Contoh: Berikut ini adalah proses pembuatan lumpia.sambil bertepuk tangan menambah riuh suasana kelas. Kedua. Pertama. E. Pola Sebab Akibat Parafrasa dengan pola ini diawali dengan mengemukakan atau menggambarkan hal-hal yang menunjukkan sebab dan akhiri dengan suatu akibat. Terakhir. Pola Contoh Parafrasa dengan pola contoh dikembangkan memerinci atau memberikan ilustrasi untuk menjelaskan ide pokoknya. masak selama kurang lebih tiga menit. Pola Proses Parafrasa diuraikan dalam bentuk proses. masukkan jagung manis. yaitu dengan mengubah dialog atau percakapan para tokoh menjadi kalimat tidak langsung. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 121 . sedangkan batangnya dimanfaatkan untuk membuat perhiasan dalam pernikahan. tumis bawang bombai dan bawang putih sampai harum. Parafrasa dengan pola ini berbentuk uraian ekspositoris. daun dan batangnya dapat dimanfaatkan. Uraian parafrasa naskah drama dapat berbentuk tidak langsung. gula pasir. Pola Penyajian Informasi Lisan Beberapa pola penyajian atau penyampaian informasi secara lisan adalah seperti berikut. Daun pisang dapat digunakan untuk membungkus. Selain buahnya.

Pakaian lusuh tidak layak untuk dipakai. Pengungkapan kembali tersebut bermaksud menjelaskan makna yang tersembunyi. langkah-langkahnya adalah membaca informasi secara cermat. Ia berhenti. saya memberikan uang lima ribu rupiah untuk membayar bakmi kepada pedagang keliling itu. RANGKUMAN A. Setelah bakmi selesai dibuat. ungkapan yang sepadan. “Mau pesan berapa porsi?” Saya jawab “Satu porsi saja. 4. dan pedagang berlalu dari depan rumah saya. Pola Urutan/Kronologis Parafrasa pola ini pemaparannya diuraikan berdasarkan urutan waktu dan rangkaian kejadiannya. Gunakan sinonim. menyampaikan pokok pikiran dalam bentuk uraian lisan dengan kalimat sendiri. Pedagang itu seorang laki-laki. Memudarnya warna pakaian terlihat seperti lusuh dan usang. sepertinya itu pedagang bakmi lewat. Untuk membuat parafrasa lisan.” Kemudian. laki-laki itu menyiapkan bakmi sesuai pesanan saya. Pengertian Parafrasa Parafrasa adalah pengungkapan kembali satu tuturan bahasa ke bentuk bahasa lain tanpa mengubah pengertian. Dia bertanya. Contoh: Saya mendengar suara kentongan. Akibatnya. banyak orang tidak menggunakan lagi sabun deterjen untuk mencuci pakaian. lalu memanggilnya. mencatat kalimat inti. Saya pergi keluar dan membuka pintu pagar. kemudian saya masuk ke rumah. Cara Membuat Parafrasa Ada beberapa hal yang harus dilakukan dalam membuat parafrasa dari sebuah bacaan.Contoh: Mencuci dengan sabun deterjen dapat memudarkan warna tekstil atau bahan pakaian. Parafrasa pada pola urutan/kronologis bersifat narasi. B. mengembangkan kalimat inti menjadi pokok pikiran. mengubah kalimat langsung 122 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .

C. E. Bacalah atau dengarkan pembacaan puisi dengan seksama. Memparafrasakan Puisi Menjadi Prosa Hal-hal yang perlu diperhatikan dalam memparafrasakan puisi menjadi prosa. pola proses. 3. Jelaskan kata-kata kias atau ungkapan yang terdapat dalam puisi. Memparafrasakan Naskah Drama Menjadi Prosa atau Cerita Jika dalam puisi banyak terdapat simbol. Pahami setting atau latar cerita. dan pola urutan/kronologis. 5. 2. Uraikan kembali isi puisi secara tertulis dalam bentuk prosa dengan menggunakan kalimat sendiri. 4. 2. Sampaikan secara lisan atau dibacakan. Pola Penyajian Informasi Lisan Penyajian atau penyampaian informasi secara lisan dapat menggunakan pola contoh. Pahami penjelasan tentang tokoh yang ada di dalam kurung. kerjakanlah tugas berikut: 1. serta menggunakan kata ganti orang ketiga untuk narasi jika kesulitan menguraikan. D. 2. Bacalah bacaan di awal bab ini dengan cermat! Buatlah parafrasanya sesuai dengan langkah-langkah membuat parafrasa. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 123 . 3. Pahami dialog dan ambil simpulannya secara menyeluruh. Ungkapkan secara lisan parafrasa tersebut. pada naskah drama kita harus memperhatikan unsur berikut : 1.menjadi kalimat tidak langsung. pola sebab akibat. ialah : 1. TUGAS MANDIRI : Agar lebih memahami dan terlatih membuat parafrasa. Pahami isi kandungan puisi secara utuh. mengubah kalimat aktif menjadi kalimat tidak aktif. 3.

e. c. ikhtisar b. rangkuman c. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! 1. Kalimat yang menggunakan kata bermakna konotasi ialah a. Mintalah salah seorang siswa membacakan wacana yang terdapat pada awal bab ini. Mintalah teman mengomentarinya. 124 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . silakan menyampaikan respons-respons bermakna a. Pengungkapan kembali suatu tuntunan atau karangan menjadi bentuk lain yang dilakukan bukan oleh penulisnya diistilahkan dengan a. 3. Dengarkan dengan saksama! Buatlah parafrasa bacaan yang didengarkan tersebut. Lakukan secara bergantian! UJI KOMPETENSI I. Pelayan toko itu kebanyakan masih gadis. pengkajian e. 2. tanggapan 2. Ia benar-benar sudah tidak waras lagi. ringkasan e. parafrasa d. b. umpan balik d. masukan b. lalu sampaikan secara lisan. Rombongan kesenian itu sudah datang sejak tadi malam.TUGAS KELOMPOK 1. 3. gubahan Usai mendengarkan siaran. himbauan e. d. Buku itu jatuh dari meja tulis karena disentuh Anti. Surat itu dimasukkan ke dalam bus surat.

perubahan teks menjadi ikhtisar d. perubahan prosa menjadi drama c. e. 8. Parafrasakan naskah dengan memadatkan ringkasan yang dibuat dengan bahasa sendiri. kesan b. mantap Di bawah ini adalah cara membuat parafrasa tulis. 6. Parafrasa puisi yaitu a. tidak goyah d. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 5. perintah e. sudut pandang Teks drama biasanya menggunakan bentuk kalimat a. topik c. perubahan teks menjadi cerpen e. langsung b. tangguh c. dan kalimat menjadi kata. tak langsung c. c. perubahan puisi menjadi prosa b. tetap e. Kata stabil pada kalimat di atas dapat diganti dengan kata a. Parafrasakan naskah sesuai dengan bahasa aslinya. paragraf menjadi kalimat. 7. Baca naskah asli sekali lagi dengan memberi tanda pada bagianbagian penting. pesan d. berita d. kecuali a. ide tokoh e. b. Sinonim kata amanat adalah a. d.4. pasif Kita menghendaki pemerintah yang stabil dan berwibawa. Ringkaslah naskah dengan cara memadatkan sub-bab menjadi paragraf. perubahan teks menjadi puisi Sebuah cerpen mengandung amanat tertentu. Bacalah naskah yang akan diparafrasa sampai selesai. kokoh b. 125 .

dijual di muka umum b. dijual dengan perjanjian yang ditandatangani kedua belah pihak 13. Penumpang pesawat terbang akan sangat diuntungkan jika kereta tersebut berhenti di dekat bandara. Makna kata kolusi adalah a. d. akibat sebab 126 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Jika kereta api dapat berhenti di dekat bandara. Dibangunnya stasiun dekat bandara akan menguntungkan penumpang kereta api. Kemungkinan parafrasa yang muncul adalah a. menyelewengkan anggaran pembangunan 11. Jika kereta tersebut berhenti dekat bandara. penumpang pesawat sangat diuntungkan. Sebagai bangsa yang berjiwa besar. Baik penumpang pesawat maupun kereta api sama-sama untung. kerja sama yang tersembunyi untuk maksud yang tidak terpuji e. dijual tanpa perantara e. dijual dengan angsuran c. c.9. kerja sama yang saling menguntungkan d. proses c. penumpang pesawat tidak nyaman. pandangan gelap b. Pola perjanjian parafrasa yang penerapannya diuraikan berdasarkan urutan waktu dan kejadiannya disebut a. e. perbandingan b. 10. Penumpang pesawat terbang akan sangat tidak diuntungkan. Rumah itu dijual di bawah tangan. Makna ungkapan di bawah tangan adalah a. kronologis d. dijual dengan harga murah d. kongsi dagang ilegal c. sebab akibat e akibat sebab 12. b. Pola perjanjian yang mendahulukan fakta-fakta sebagai suatu sebab kemudian diikuti akibat-akibat dikenal dengan pola a. kita menghindarkan segala kolusi. Jika kereta berhenti di dekat bandara.

b. c. d. e.

sebab akibat contoh proses kronologis

14. Mulanya hewan ini lahir berwarna merah. Beberapa hari kemudian tubuh kecil sebesar sepertiga jari kelingking itu mulai merona warna kulit aman. Bulu-bulu halus menghiasi tubuhnya. Setelah seminggu makin jelas bulu hitam di tubuhnya. Pada usia dua minggu sempurnalah tubuhnya dengan sepasang matanya yang hitam mulai terbuka. Hewan ini disebut hamster. Wacana di atas dihadirkan dengan pola a. proses b. sebab akibat c. contoh d. kronologis e. akibat sebab 15. Pola penyajian parafrasa yang menekankan urian pada langkahlangkah kerja disebut a. contoh b. sebab akibat d. proses d. kronologis e. analogi 16. Parafrasa dengan pola mengembangkan rincian atau ilustrasi untuk menjelaskan ide pokoknya disebut pola a. contoh b. proses c. sebab akibat d. urutan e. perbandingan 17. Kepandaian merupakan talenta yang sebaiknya didukung oleh fasilitas yang memadai. Makna kata talenta dan fasilitas adalah a. bakat sarana b. kebiasaan, jaminan c. sifat perlengkapan
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

127

d. e.

kekayaan, penunjang pembawaan, kepandaian

18. Penggunaan idiom dalam kalimat di bawah ini benar, kecuali a. Ia jatuh hati pada dara jelita anak Pak Lurah. b. Tabiatnya yang kurang baik sudah mendarah daging. c. Kami berusaha menyelesaikan persoalan itu dengan kepala dingin. d. Ia lepas tangan dalam persoalan itu. e. Kabar burung itu belum tentu kebenarannya. 19. Parafrasa yang disampaikan secara lisan dapat menggunakan pola penyajian di bawah ini, kecuali a. sebab akibat d. proses b. kronologis e. perbandingan c. contoh 20. Di bawah ini adalah cara meringkas naskah bila membuat parafrasa tulis, kecuali a. padatkan subbab menjadi paragraf b. hilangkan bagian-bagian yang tidak penting c. padatkan paragraf menjadi kalimat d. padatkan kalimat menjadi kata-kata e. satukan bagian penting dan yang tidak penting II. 1. 2. 3. 4. 5. 6. Jawablah soal-soal di bawah ini dengan tepat dan benar!

Jelaskan pengertian parafrasa! Jelaskan cara membuat parafrasa! Jelaskan cara membuat parafrasa lisan! Hal apa saja yang dapat diparafrasa! Carilah sebuah puisi, kemudian buatlah parafrasa puisi tersebut! Temukan dialog berupa drama, kemudian buatlah parafrasa dari dialog drama tersebut! 7. Carilah sebuah wacana, kemudian parafrasa wacana tersebut! 8. Jelaskan cara meringkas naskah bila membuat parafrasa tulis! 9. Jelaskan pendapatmu mengapa bila membuat parafrasa tulis, naskah yang akan diparafrasa harus dibaca sampai selesai! 10. Hal apa sajakah yang dapat digunakan untuk membantu memudahkan parafrasa sebuah wacana? 128
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

BAB 7 MENERAPKAN POLA GILIR DALAM BERKOMUNIKASI

Standar Kompetensi Kompetensi Dasar

-

Berkomunikasi dengan bahasa Indonesia setara tingkat madya Menerapkan pola gilir dalam berkomunikasi

-

Indikator

-

Berkomunikasi dengan menggunakan kata, bentuk kata, dan ungkapan dengan santun Memanfaatkan pola gilir dalam berkomunikasi secara efektif

Ada banyak hal yang perlu dipahami oleh seseorang dalam berkomunikasi. Selain cakap memilih kata dan menyusun kalimat yang baik, dalam berkomunikasi, seseorang juga harus mempertimbangkan penggunaan bahasa secara santun. Di samping itu, ia juga harus memahami pola gilir dan dapat menerapkannya jika ingin komunikasi berjalan lancar. Pada bab ini, kita akan mempelajari berkomunikasi yang baik dengan bahasa yang santun serta memahami pola gilir dalam berkomunikasi dan penerapannya. Akhir pelajaran diharapkan kita sudah dapat memahami pola gilir dalam berkomunikasi dan dapat menerapkannya saat berkomunikasi.

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

129

Wacana Gebyar Busana Daerah Sesuai Pakem

Padu padan lintas kepulauan. Tema besar inilah yang diusung Himpunan Ratna Busana (HRB) ketika mengadakan pergelaran busana di Jakarta. Tema tersebut menyimpan makna tersendiri. Para perancang seperti Carmanita, Chossy Latu, Denny Wirawan, Ghea Panggabean, Oscar Lawalata, Reshna Sapto, Samuel Wattimewa, Susi Lucon diminta menghadirkan kreasi pada sejumlah busana tradisional seperti busana Aceh, baju kurung, baju bodo, kebaya panjang, dan kebaya tradisional Jawa. Namun, ada pakem yang tak boleh dilanggar. Pakem-pakem itu di antaranya adalah para perancang harus mempertahankan siluet yang sama dengan aslinya. Selain itu, perancang pun tidak boleh mengadopsi detail rancangan yang berasal dari luar Indonesia. “Seperti detail lengan, tidak boleh meniru model kimono dari Jepang,” ujar Ratna Maida Ning, penasehat HRB. Perubahan sedikit boleh dilakukan oleh para perancang, tukas Ratna, tetapi tidak boleh menggantikan siluet baju itu sendiri. Misalnya, perubahan bentuk lengan yang tidak meninggalkan kaidah berbusana sesuai asalnya tetap diperbolehkan. Hasilnya? “Ini benar-benar hasil desain saya yang keluar dari desain populer yang sedang digemari saat ini,” papar Chossy Latu. Namun, Chossy mengatakan bahwa busana yang ditampilkan dengan jalan memadu padankan kekayaan busana Indonesia ini bisa menjadi alternatif bagi siapa pun yang ingin tampil dengan busana daerah. Untuk memenuhi paket tersebut, Chossy melakukan alternatif modifikasi busana pada warna. Pada salah satu rancangannya, Chossy padu padan baju bodo dengan selendang padang. Ketika menyelaraskan, Chossy tidak hanya mempertimbangkan warna. Siluet baju bodo yang aslinya sangat longgar, ia buat lebih ramping. Hal ini, ungkap dia, agar busana yang terpadu padan bisa selaras dan enak dilihat dan juga dikenakan oleh pemakainya. Berbagai modifikasi bentuk lengan serta tambahan detail payet juga dilakukan oleh para perancang. Selain modifikasi baju bodo yang tampil ramping, ada pula yang membuat dengan model jahitan bawah yang lebih bervolume. 130
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

Berbagai kain asli Indonesia turut tampil seperti kain tenun Bali, tenun Sulawesi Selatan, kain tenun Lampung, batik Palembang, dan tenun ikat Ende Flores hadir dalam padu padan ini. Tak ketinggalan kain batik rancangan dari Keraton Solo tampil dalam pergelaran ini di antaranya motif parang karya KPH Sawonggaling, koleksi batik antik HRB. Padu padan tersebut juga diperindah balutan selendang dari beberapa pulau yang ada di Indonesia, seperti selendang berbahan kain songket tiga negeri dari Palembang, selendang jepri yang biasa digunakan masyarakat Jambi, Palembang, dan Padang, serta selendang lokcan yang juga berasal dari Pulau Sumatra. Uniknya, konsep padu padan ini juga berlaku pada paduan busana dua potong plus selendang yang berasal dari tiga pulau yang berbeda. Meski belum pernah dipopulerkan sebelumnya dan masih terasa asing, HRB berharap pergelaran ini bisa memperkenalkan budaya dan melestarikan tanpa harus jauh meninggalkan pakem.
(Sumber : Republika, 10 Juni 2007)

A. Menggunakan Kata, Bentukan kata, serta Kalimat yang Santun dalam Berkomunikasi
Dalam berkomunikasi yang baik seseorang dituntut untuk mempertimbangkan situasi berbicara. Pertimbangan ini memunculkan bentuk ragam berbahasa. Situasi resmi tentu berbeda dengan situasi tidak resmi. Pembicaraan pada situasi resmi cenderung menggunakan kata, bentukan kata, serta ungkapan yang baku. Berbeda dengan ragam tidak resmi yang digunakan saat santai, saat bergaul, dan dalam suasana akrab (konsultatif) tidaklah harus menggunakan bentukan kata dan susunan kalimat yang baku. Perhatikan contoh berikut! 1. 2. 3. Terima kasih saya ucapkan atas kehadiran Bapak dan Ibu sekalian di tempat ini dalam rangka memenuhi undangan kami Makasih, ya, atas kedatangan kamu semua pada perayaan hari ulang tahunku! Thanks berat, ye! Akhirnya, lu pada dateng juga ke sini tuk menuhin undangan gue.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

131

Kalimat nomor satu digunakan dalam situasi resmi. Menghargai mitra bicara. kata-kata kasar juga menyinggung perasaan orang lain. sikap saling menghargai dan menerapkan pola gilir dengan memberikan kesempatan berbicara akan menciptakan kelancaran serta suasana yang lebih nyaman. bentukan kata maupun susunan gramatikal kalimatnya. Beberapa sikap yang harus dimiliki ketika menerapkan pola gilir dalam berkomunikasi antara lain seperti berikut 1. Dengan adanya pola gilir diharapkan komunikasi akan seimbang dan berjalan lancar karena adanya proses pergantian bicara sesuai topik pembicaraan atau sesuai keperluan. Di samping itu. Pada situasi santai atau akrab. Dalam kegiatan berkomunikasi. Memahami Pola Gilir dalam Berkomunikasi Pemahaman terhadap pola gilir sangat penting dalam keberhasilan berkomunikasi. Peka terhadap kesempatan Dalam kegiatan berkomunikasi secara lisan. dalam situasi komunikasi yang terdiri atas dua atau lebih orang. Kata-kata kasar sebaiknya dihindari. bagaimanapun keadaan lawan bicara tetap kita hormati dan hargai. Untuk mencapai komunikasi yang efektif proses penyampaian dan etika berbahasa yang santun tetap harus diperhatikan. seseorang lebih bebas memilih kata dan bentukannya daripada saat situasi resmi atau formal. B. . sering terjadi dominasi satu pihak saat bicara terhadap pihak lain. Selain kurang pantas. Komunikasi harus berjalan dua arah (ada yang mendengarkan dan ada yang berbicara). Berkomunikasi dalam kondisi dan situasi apa pun. kita tidak boleh meremehkan lawan bicara. sedangkan kalimat kedua dan ketiga dalam bentuk situasi umum atau akrab.Kalimat nomor satu sangat berbeda dengan nomor dua dan tiga. yang terpenting adalah bisa menciptakan komunikasi yang efektif dan lancar. Kita harus sadar dan mengetahui kapan saatnya kita bicara dan kapan saatnya kita diam untuk mendengarkan sehingga proses komunikasi berlangsung lancar dan nyaman. 132 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2. baik pada tataran pilihan kata.

dan sanggar.3. di sekolah. (1) Pemimpin/Moderator. Komunikasi berjalan dengan lancar dan mencapai tujuan jika pembicaraan sesuai dengan permasalahan sehingga tercipta komunikasi yang efektif dan lancar. kita harus memahami lebih dahulu hal-hal yang berkaitan dengan diskusi. pemecahan masalah. Untuk dapat memahami pola gilir berkomunikasi dalam satu diskusi. Memilih kata yang tepat Memilih dan menggunakan kata bentukan kata dan ungkapan yang santun sesuai dengan situasi komunikasi. (1) Suasana kehidupan sehari-hari. seperti di rumah tangga. Penerapan Pola Gilir dalam Diskusi Diskusi adalah bentuk kegiatan berbicara dalam rangka membahas sesuatu masalah secara teratur dan terarah. 1. Sadar akan relevansi pembicaraan. adalah sebgai berikut. demi kelangsungan dan kenyamanan komunikasi. Hal-hal yang berkaitan dengan kegiatan diskusi. (3) Film atau sinetron (4) Naskah drama dan pementasan drama Berikut beberapa contoh penerapan pola gilir dalam berkomunikasi. kurang pantas yang dapat menyinggung perasaan pihak yang diajak bicara. di pasar. Berkomunikasi dalam kondisi dan situasi apa pun tetap memperhatikan etika berbahasa yang santun hindari kata-kata kasar. kegiatan pramuka. a. antara lain sebagai berikut. (2) Diskusi kelompok. bertugas merencanakan dan memperBahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 133 . di kantor . C. 4. Diskusi bertujuan mencari jalan keluar. di arisan. Penerapan Pola Gilir dalam Berbagai Situasi Menerapkan pola gilir komunikasi dapat terjadi pada situasi-situasi berikut. dan di dunia kerja. Unsur-Unsur Diskusi Unsur-unsur yang terlibat dalam diskusi. seperti di sekolah dan di kampus. atau simpulan. membuat keputusan.

serta menutup diskusi. (8) Sarasehan adalah pertemuan yang diselenggarakan untuk mendengarkan pendapat para ahli mengenai suatu masalah dalam bidang tertentu. adalah diskusi yang dilakukan oleh sekelompok orang (yang disebut panel) yang membahas suatu topik yang menjadi perhatian umum di hadapan khalayak/pendengar. Jenis-jenis diskusi Berdasarkan ruang lingkupnya. b. membuka diskusi. (1) Diskusi kelompok. adalah pertemuan dengan beberapa pembicara yang mengemukakan pidato singkat tentang topik tertentu atau tentang beberapa aspek dari topik yang sama. adalah pertemuan untuk membahas suatu masalah di bawah pimpinan ahli (misalnya guru besar atau pakar) (4) Simposium. Khalayak diberi kesempatan untuk bertanya atau memberikan pendapat. mudah dipahami. adalah jenis diskusi yang biasa dilakukan di dalam kelas untuk membahas suatu masalah. bertugas mencatat jalannya diskusi.siapkan dengan teliti topik diskusi. (4) Peserta diskusi. dan bersikap objektif dalam meninjau suatu persoalan.penonton. dan lain-lain. (6) Konferensi adalah rapat atau pertemuan untuk berunding atau bertukar pendapat mengenai suatu masalah yang dihadapi bersama. bertugas menanggapi. mengatur jalannya diskusi. (7) Lokakarya adalah pertemuan antara para ahli atau pakar untuk membahas masalah praktis atau yang bersangkutan dengan pelaksanaan di bidang keahliannya. terbuka. (3) Seminar. 134 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . adalah pertemuan wakil organisasi untuk mendiskusikan dan mengambil keputuan mengenai pelbagai masalah. masalah-masalah yang dilakukan peserta. bertugas menyampaikan pembahasan dengan sistematis. tidak menyinggung peserta. diskusi dibedakan seperti berikut. saran maupun jawaban penyaji dari awal sampai akhir. (3) Penyaji/pemakalah/pemrasaran. (2) Diskusi panel. (5) Kongres. (2) Sekretaris. memberi masukan.

Teknik dan Tahapan dalam diskusi X MEJA S S S S S S X S S S S S X S MEJA S S S S S S S S S S S X X S S S MEJA S S S S S S Keterangan gambar X Pimpinan Diskusi X S S Keterangan gambar .85 Ada dua tahap dalam pelaksanaan diskusi. Lokakarya adalah pertemuan antara para ahli atau pakar untuk menghasilkan atau memutuskan suatu modul.. Peserta Diskusi → Pimpinan Diskusi Pendengar → Peserta Diskusi 1) Tahapan Persiapan a. Tahap persiapan dilaksanakan dengan tujuan memperoleh kesepakatan mengenai hal yang akan dibicarakan. bersifat umum dan cukup bersifat umum dan sederhana. yaitu tahap persiapan dan tahap pelaksanaan atau penampilan. Untuk tatanan sekolah tatanan sekolah. g.. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2) b) 135 . Membagikan tugas kepada para calon pembicara atau penyaji jika pembicara lebih dari satu... h.. dapat dilihat pada skema tersebut: S S S c.. Tahap Pelaksanaan Ada empat tahap yang harus dilalui dalam pelaksanaan diskusi. 3.. Contoh ucapan moderator: 1. Teknik dan Tahapan dalam diskusi Teknik diskusi berkaitan dengan bentuk dan jenis diskusi. Sarasehan adalah pertemuan yang diselenggarakan untuk mendengarkan pendapat para ahli mengenai suatu masalah dalam bidang tertentu. Susunan tempat duduk dalam diskusi Susunan tempat duduk dalam diskusi dapat dilihat pada skema berikut. Saya perkenalkan pembicara dalam diskusi ini ialah Saudara . Pelaksanaan diskusi Pemimpin diskusi mempersilakan para pembicara menyampaikan pandangannya... pendapat atau karya bersama. notulis Saudara . Konferensi adalah rapat atau pertemuan untuk berunding dan bertukar pendapat atau pertemuan untuk berunding mengenai suatu masalah yang dihadapi bersama. a) Pembukaan Pimpinan diskusi mengemukakan pokok masalah yang akan disampaikan dan memperkenalkan calon pembicara... Dalam diskusi kali ini. Untuk Teknik diskusi berkaitan dengan bentuk dan jenis diskusi.f. b. bentuk diskusi cukup bentuk diskusi sederhana. 3). Marilah kita buka diskusi ini dengan membaca/berdoa . kita akan membicarakan . 2. Selanjutnya sanggahan atau dukungan dari pembicara disampaikan sesuai dengan aturan yang telah disepakati.

c) Contoh ucapan moderator: 1.. Contoh ucapan moderator: 1.... Penanya pertama silakan . 3.. Penyaji silahkan memberikan jawaban atau tanggapan balik (peserta yang mengacungkan jari lebih dahulu yang diberikan kesempatan pertama dan bergilir selanjutnya) Contoh ucapan peserta : 1. 2. .. Naskah drama adalah cerita yang ditulis dalam bentuk dialog disertai gerak-gerik dan tingkah laku para tokoh dalam drama. menyajikan makalahnya. Tadi saudara pembicara menjelaskan . Terima kasih atas kesempatan yang diberikan moderator kepada saya untuk ... demikian usulan dari saya. Penerapan Pola Gilir dalam Pementasan Drama Naskah drama dipersiapkan sebelum drama diperankan atau dipentaskan. Contoh Ucapan penyaji : 1. seorang pemain harus memahami isi 136 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . 3.. d) Penutup Pembacaan simpulan pembahasan diskusi yang telah berlangsung oleh pemimpin diskusi. Contoh ucapan penyaji: 1.. Saya mohon kepada pembicara pertama untuk menjelaskan .. 2... Saya beri kesempatan 3 orang peserta mengajukan pertanyaan... pendapat atau tanggapannya. tentang .. Pertanyaan saya yaitu . dan jawaban saya sebagai berikut . 2. Terima kasih atas pertanyaan Saudara .. pembicara/penyaji...... Untuk mementaskan sebuah drama..... 4.. Terima kasih atas kesempatan yang diberikan moderator. kedudukan pelaku sangat penting. Acara tanya jawab Pemimpin diskusi mempersilakan para pendengar/peserta mengajukan pertanyaan kepada pembicara dipandu oleh pemimpin diskusi... menurut pendapat saya ..... 2. Terima kasih atas tanggapan Saudara . Saya persilahkan Sdr .. Dalam sebuah drama.

mendekati kedua temannya) ”Ada apa ini? Fani. Setiap tokoh telah diatur kapan saat menjawab. Dalam dialog. menanggapi. hentikan sebentar tangismu! 03. mengapa menangis? Mengapa? Katankanlah. Beberapa hal yang harus diperhatikan jika memerankan tokoh dalam drama adalah seperti berikut. Hana : (muncul dan tertegun. para pelaku harus menyampaikan dialog dengan jelas. merespons tokoh lainnya. atau menegang saat marah. telah diatur penggiliran pembicaraan diantara para tokoh. Fani dan Gina tidak menggubris Hana. dengan suara yang enak didengar. ucapan harus wajar. 01. tidak dibuat-buat. 02. Hana : ”Ya. Ada tekanan keras atau lembut dalam ucapan. a. Meskipun unsur spontan (improvisasi) ada dalam dialog drama.drama termasuk proses dialog. dengan komposisi yang sedap dipandang. Contoh naskah drama: Pentas TANGIS : Menggambarkan sebuah taman atau halaman. Teknik Berdialog Agar penonton menangkap jalan cerita drama. b. c. namun tokoh yang berimprovisasi tetap harus memerhatikan dengan cermat saat melakukan improvisasi dialog agar tidak bertabrakan dengan perkataan tokoh lain. Mereka terus menangis secara memilukan. siapa tahu aku dapat membantu. dan tekanan nada menaik atau menurun. Mimik Mimik merupakan perubahan raut muka. Ayolah Fani. tempo. 04. Fani dan Gina sedang menangis. mengerutkan dahi ketika sedang berpikir. misalnya tersenyum karena senang. Tuhan! Duka macam apakah yang Kaubebankan Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 137 . Gina. apa yang terjadi? Ayolah Gina. Intonasi Intonasi ialah lagu atau irama dalam mengucapkan kalimat.

Hana : (menahan Inu seraya memberikan selembar kertas) 09. Jati. dan oleh karena itu pula. dan tak punya daya. miskin. dan sekaligus akan mengancam kelangsungan persahabatan kita!” 05. manusia! Mungkin kini mereka akan gentar pada tekad perlawanan kita. apa lagi kita. lalu Gina memberikan selembar kertas kepada Hana. Hana membaca tulisan pada kertas itu. Inu : (muncul tergopoh-gopoh)” Ada apa? Ada apa ini. Tidak ada apa-apa!” : ”Enak saja! Senang. (Menangis) Baiklah. Jati 11. Fani dan Gina tertegun sejenak mendengar kata-kata Hana. ya. bengong sesaat. cacing pun mengeliat jika diinjak. sudahlah! Kita memang wanita sejati. heran melihat situasi itu. Inu 12. tanpa ada seorang pun yang berani meragukan. Kita mengakui bahwa kita memang makhluk lemah (mulai menangis). dapat membuat orang lain menangis? Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 08. saling bertatapan. Mereka menghentikan tangis. Keduanya meneruskan tangisan mereka. kemudian geleng-geleng kepala dan tertawa sendiri. : (muncul. membacanya. 07. Kalau tidak. hentikan tangisan kalian.kepada kedua temanku ini? Dan apa yang harus kulakukan bila aku tidak tahu sama sekali persoalannya semacam ini? Fani. bodoh. Tetapi. Gina. sementara kalian berdua menikmati indahnya tangisan dengan enaknya. Namun apa pun persoalannya. aku yang akan menghadapinya! (mencari batu untuk senjata) Tenanglah kalian. Jati 138 . Ayolah. tidaklah wajar membiarkan seorang sahabat kebingungan semacam ini. Inu 10. geleng-geleng kepala. Diamatinya temantemannya satu per satu sambil tersenyum-senyum). ini akan kuanggap sebagai penghinaan yang tidak termaafkan. Tetapi jangan puas. kemudian ikut menangis pula. itu tidak berarti bahwa kita dapat mereka hina secara semena-mena. : (menerima kertas itu. akan kucari mereka dengan batubatu di tanganku! (beranjak pergi). (sambil menangis) berapa kali mereka melakukannya? Huh. 06. kita juga berhak istimewa untuk menangis. Ia termangu beberapa saat. mereka harus diberi pelajaran agar tahu benar-benar bahwa kita bukanlah barang mainan. mereka menganggu lagi? Gila! Mereka memang terlalu! Sudahlah. kemudian marah kepada Inu) ”Inu! Kauapakan mereka? : ”Tenang.

Jati 19. jangan nganggu.13. Inu!” : ”Ampun. biasanya dipandu oleh dua orang MC atau pembawa acara.” (memberikan selembar kertas). kemudian tertegun ketika membacanya) ”Maaf. Inu?” : ”Jati. mereka jelas nampak menderita!” : (tertawa) ”Tampak menderita tidak sama dengan nyata menderita!” : ”Gila! Tidak kusangka! Aku kini tahu mutu pribadimu yang sesungguhnya. Jati ! Nih. berjudul tangis oleh A. Inu 14. Inu 16. sementara Jati salah tingkah. : (dengan segan menerima. dapat diterapkan pola gilir agar tak terjadi saling ingin bicara dan mendominasi. Jati!” (tertawa) : ”Kamu mampu tertawa sementara ketiga sahabatmu menangis duka. ya!? Trim’s!” Gila! Sudah! Selesai! Hentikan latihan gila-gilaan ini!” 21. kami sedang latihan akting menangis. (dikutip dari Buku Kumpulan drama Remaja. Untuk acara hiburan yang cukup banyak dan panjang. Jati 17.Rumadi) Pola gilir juga dapat dilakukan dalam membawakan acara. Jati 15. bukan aku penyebabnya. Inu 18. apakah setiap tangis itu duka?” : ”Tetapi. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 139 . Dalam memberikan pengantar atau komentar. Jati! Sabar. Di mana perasaanmu. Inu 20 Jati : ”Hai. Semua tertawa terbahak-bahak. Kedua pembawa acara tersebut saling bergantian berbicara mengantarkan setiap acara yang akan dipertunjukkan dan mengomentarinya. coba baca.

Situasi resmi tentu berbeda dengan situasi tidak resmi. serta Kalimat yang Santun dalam Berkomunikasi Dalam berkomunikasi yang baik seseorang dituntut untuk mempertimbangkan situasi berbicara. dan dalam suasana akrab (konsultatif) tidaklah harus menggunakan bentukan kata dan susunan kalimat yang baku. Berbeda dengan ragam tidak resmi yang digunakan saat santai.RANGKUMAN A. Pembicaraan pada situasi resmi cenderung menggunakan kata. Film atau Sinetron. 140 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . saat bergaul. 4. Pertimbangan ini memunculkan bentuk ragam berbahasa. Bentukan kata. 3. 2. Menggunakan Kata. Naskah drama dan pementasan drama. Memahami Pola Gilir dalam Berkomunikasi Beberapa sikap yang harus dimiliki ketika menerapkan pola gilir dalam berkomunikasi ialah menghargai mitra bicara. serta ungkapan yang baku. C. demi kelangsungan dan kenyamanan komunikasi. Diskusi kelompok. serta memilih dan menggunakan kata bentukan kata dan ungkapan yang santun sesuai dengan situasi komunikasi. Untuk mencapai komunikasi yang efektif proses penyampaian dan etika berbahasa yang santun tetap harus diperhatikan. sadar akan relevansi pembicaraan. Penerapan Pola Gilir dalam Berbagai Situasi Menerapkan pola gilir komunikasi dapat terjadi pada: 1. bentukan kata. peka terhadap kesempatan. Suasana kehidupan sehari-hari. B.

percakapan yang terjadi harus berjalan dua arah b. dan ungkapan santun sesuai komunikasi Pola gilir dalam berkomunikasi adalah a. pembicaraan yang mengarah pada diskusi kelompok Menerapkan pola gilir dalam berkomunikasi dapat terjadi pada peristiwa berikut. Bentuklah kelompok yang terdiri atas 4–5 orang. tetapkanlah masing-masing anggota menjadi pemeran tokoh drama berjudul “Tangis” di atas. Lakonkanlah naskah drama tersebut dengan penghayatan dan penerapan pola gilir yang tepat! Buatlah daftar acara dengan pengantar dan komentar di setiap acara. kemudian 2 orang anggota kelompok menjadi pembawa acara yang membacakan acara dengan menerapkan pola gilir yang tepat. pembicaraan yang terjadi antara dua sahabat karib d. percakapan antara tiga orang saja e. UJI KOMPETENSI I. menggunakan kata. 3. 2. menghargai mitra bicara b. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! Sikap yang harus dimiliki ketika menerapkan pola gilir dalam berkomunikasi tertera di bawah ini. kecuali a. Kemudian. bahasa harus jelas dan terperinci e. kecuali a. bentuk kata. film dan sinetron Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2. sadar akan relevansi pembicaraan d. 141 . percakapan tentang suatu topik secara mendalam c. suasana kehidupan sehari-hari b. 1. peka terhadap kesempatan c.TUGAS KELOMPOK 1.

6. saya tidak setuju dengan ide yang dikemukakan b. . lokakarya e. diskusi panel Orang yang bertugas menanggapi. menyajikan makalah bila diminta pendengar d. dari tadi saya ingin menanggapi karena saya belum paham e. menambah. membela penyaji yang pendapatnya disanggah d. d. menguasai masalah yang disajikan b. mengatur proses diskusi b. dan memperbaiki ide. serta pendapat penyaji disebut a penyaji 142 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 5. mematuhi dan menjalankan peraturan diskusi c. kecuali a. e. membatasi waktu bicara Perbuatan yang harus dihindari oleh pemandu diskusi pada waktu berlangsungnya diskusi adalah a. kecuali a. menguasai pokok-pokok masalah yang didiskusikan Kalimat yang sopan untuk menyanggah pendapat dalam diskusi adalah a. pementasan di dunia kerja monolog Berikut ini adalah langkah-langkah yang harus diperhatikan oleh seorang penyaji dalam diskusi. rasanya janggal bila penyaji berpendapat seperti apa yang disampaikan tadi c. berbicara tetap pada temanya e.c. rapat d. 8. menyusun kesimpulan diskusi dan mengumumkan hasilnya e. seminar c. saya sama sekali tidak mengerti apa yang disampaikan penyaji d. 4. 7. gagasan. saya menemukan beberapa hal yang kiranya dapat dipertimbangkan Di bawah ini merupakan jenis-jenis diskusi. simposium b. berbicara dengan jelas dan objektif c.

c. sidang c.b. menghargai pendapat orang lain 10. pidato kenegaraan d. peserta diskusi moderator ketua diskusi wakil ketua Yang bukan merupakan manfaat diskusi a. Yang tidak memerlukan penggunaan bahasa resmi adalah pada suasana di bawah ini a. diskusi b. ruang praktik dokter 13. d. Yang berhak menyimpulkan hasil diskusi adalah a. b. melaksanakan sikap demokrasi c. penyaji d. Perbedaan pokok antara diskusi panel dan simposium terletak pada a. keresmian pidato Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 143 . 9. e. moderator c. mengembangkan kebebasan pribadi e. d. menguji sikap toleransi b. penyelenggara 12. d. peserta e. makalah yang dibahas c. mengembangkan latihan berpikir d. notulis b. e. konferensi lokakarya kongres simposium sarasehan 11. peserta yang hadir b. waktu yang disediakan d. forum ilmiah e. ada tidaknya pendengar e. Pertemuan wakil suatu organisasi untuk membahas masalah tertentu disebut a.

membuat makalah c. Semoga usul saya ini mendapat dukungan dari peserta lain. Kenapa Yayuk Basuki tidak diikutsertakan pada kejuaraan ini? c. 17. menjawab pertanyaan dengan singkat dan tepat 15. 18. kecuali a. cara penyampaian c. Kalimat di bawah ini yang paling santun untuk menyanggah pendapat seseorang ketika berdiskusi adalah a. tangkas d. panjang waktu pembicaraan e. b. Jangan-jangan mereka tidak sampai ke puncak gunung itu. Saudara seharusnya memikirkan terlebih dahulu apa yang akan Saudara katakan. b. saling menghargai b. c. Saudara sungguh tidak logis.14. Saya rasa pendapat Saudara mustahil untuk dilaksanakan. Bukan hal yang menentukan keefektifan sebuah proses komunikasi adalah a. berani mengemukakan pendapat 16. cepat tanggap b. mengarahkan dan mengatur jalannya diskusi d. sering bertanya e. Dalam berdiskusi kita harus terlibat aktif artinya a. e. Saya kurang setuju dengan usul Saudara. mempresentasikan makalah e. d. bahasa santun penutur 144 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Saya menolak pendapat Saudara. agresif c. Mari kita menghadapi masa depan kita dengan optimis. Saudara Andi. saya tidak setuju dengan pendapat Saudara karena kurang didukung fakta dan data yang logis. Kalimat yang hanya dapat dipergunakan dalam ragam tak resmi adalah a. penerapan pola gilir d. Berikut ini adalah tugas seorang pemrasaran dalam diskusi. d. menaati waktu yang diberikan b. e.

menjelaskan secara terperinci usul tersebut b. 3. 8. tawar-menawar b. kecuali a. 9. isi diskusi II. 4. 2.19. Jadi pendapat Saudara tidak relevan dengan masalah yang kita bicarakan. Maaf yang kita diskusikan sekarang adalah masalah program kerja. Buatlah contoh susunan tempat duduk dalam diskusi dalam bentuk skema! Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 145 . Jawablah soal-soal di bawah ini dengan tepat dan benar! 1. menyangkal secara halus terhadap usul itu 20. memberikan fakta-fakta secara umum e. menjawab pertanyaan penyanggah d. 5. 7. Jelaskan pendapatmu mengapa pemahaman konsep pola gilir sangat penting dalam keberhasilan komunikasi! Jelaskan apa yang dimaksud pola gilir dalam berkomunikasi! Jelaskan beberapa sikap yang harus dimiliki ketika menerapkan pola gilir dalam komunikasi! Jelaskan dalam situasi apa saja kita perlu menerapkan pola gilir! Jelaskan manfaat diskusi! Sebutkan jenis-jenis diskusi yang kamu ketahui! Jelaskan unsur-unsur yang terlibat dalam diskusi! Jelaskan empat tahap yang harus dilalui dalam diskusi! Carilah penggalan drama. pendapat yang tidak relevan e. Di bawah ini termasuk beberapa cara menyetujui usul diskusi. mengembangkan pendapat lain yang mendukung c. 6. Penggalan diskusi tadi berisi a. setuju d. perankan drama tersebut dengan menerapkan pola gilir! 10. Kemudian. penolakan c.

peta c. perincian e. visualisasi b. tabel e. 5. denah b. persentase c. informasi nonverbal Informasi nonverbal diperlukan bila data informasi membutuhkan a. mendengarkan dengan saksama d. argumentasi b. tabel e. visualisasi c. 6. narasi d. memahami makna informasi yang disampaikan Keberhasilan menyimak dapat diukur dari hal berikut. mencatat kata-kata kunci yang dianggap penting c. dapat mengaktualisasikan informasi baik lisan maupun tulisan 146 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! 1. 4. penjelasan d. denah b. memparafrasakan informasi sumber e. informasi verbal e.TES SEMESTER GANJIL I. grafik d. Wacana yang berisi uraian kalimat-kalimat informasi disebut a. alasan-alasan Gambaran klasifikasi data yang disusun berdasarkan baris dan kolom disebut a. dapat mengutarakan kembali informasi yang didengar dengan makna yang sesuai c. matrik c. memahami informasi yang didengarkan b. mencatat hal-hal pokok dari narasumber b. kecuali a. diagram Gambaran informasi yang berbentuk garis-garis menaik dan menurun disebut a. grafik lingkaran d. . grafik garis Di bawah ini yang bukan termasuk kegiatan menyimak adalah a. 3.

Tataplah masa depanmu! c. Berhati-hatilah selama dalam perjalanan! b. intonasi menurun di akhir c. intonasi menaik di awal b. 7. kalimat 4 dan 5 e. 10. e. kalimat 1 dan 3 c. Simpanlah baik-baik surat wasiat ini! d.d. Di bawah ini yang bukan perintah berisi nasihat ialah a. Berikut ini adalah ciri-ciri kalimat perintah. Apakah cerita berbentuk narasi atau bukan (3). Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 147 . Itulah yang harus kamu lakukan (5). kalimat 5 dan 2 Kalimat perintah yang menuntut respons tindakan langsung ialah a. Hadirin dimohon duduk kembali. Titiplah barang-barangmu kalau kaupergi! d. Jagalah bicaramu di mana saja kauberada. Kalimat perintah yang berpola inversi ialah a. Mimpi indahlah dalam tidurmu! c. Kalimat yang berbentuk perintah ialah a. kecuali a. kalimat 2 dan 4 d. Jangan pulang dulu sebelum bel! b. Keluarkan semua pikiran kotormu agar kau tenamg! e. Bapak dan Ibu silakan berdiri! c. Kemudian catatlah ide-ide pokoknya (4). Ikuti aturan sekolah kalau kau mau berhasil! 8. berpola kalimat inversi (P-S) 11. Hendaknya selalu waspada dalam segala suasana. Sebagai langkah pertama adalah membaca cerita ringan (1). menekankan kata yang dipentingkan d. Setelah itu. kalimat 3 dan 4 b. menggunakan partikel -lah e. 9. membuat kesimpulan dengan menguraikan inti pokok informasi yang disampaikan e. Tutuplah pintu itu! b. mengemukakan tanggapan sesuai dengan intruksi yang disampaikan. pahami isi cerita tersebut (2).

kepala bagian 13. Buanglah sampah ini di tempatnya! 12. judul. memorandum d. undangan e. Bagian-bagian surat perintah adalah a. bagian isi. nomor. buku pedoman e. syarat pengumuman b. kaki surat d. undang-undang e. alamat. manajer e. pertimbangan. bagian kepala. nama. konsideran 17. surat b. bagian surat pengumuman c.d. manual kerja c. isi perintah e. judul. Surat-menyurat intern kantor adalah surat a. Penyusunan pengumuman hendaknya jelas. e. bentuk perintah umumnya disampaikan secara tertulis dalam bentuk a. buku manual kerja 14. Kalimat yang lazim digunakan dalam memorandum adalah a. Surat ini harap segera diselesaikan. badan surat. penawaran b. dasar. isi pengumuman e. tujuan pengumuman 16. nomor urut surat perintah c. buku petunjuk d. Tolong sampaikan surat ini kepadanya. singkat. buku keterangan b. 148 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Dalam dunia kerja. Yang berhak mengisi lembar disposisi ialah a. primbon c. pedoman d. pimpinan d. Buku petunjuk cara melakukan sesuatu berkaitan dengan penggunaan benda atau alat disebut a. peraturan 15. tata usaha c. pesanan 18. fungsi pengumuman d. telegram c. dan padat merupakan a. bagian kaki b. kepala biro umum b.

c. Untuk mempercepat pengurusan dokumen-dokumen impor itu. e. Kata yang bergaris bawah merupakan kata yang bermakna a. Bolehkah saya pinjam teleponmu sebentar? e. Dokter itu telah makan garam. idiom b. d. d. Dokter itu benar-benar seorang yang bertangan dingin. Kapan diadakan rapat staf? Harap diinformasikan. Sikapnya selalu mengkambinghitamkan orang lain. polisemi d. 19. Kepalanya berisi angin. Kekuasaan pemerintah ada di tangan rakyat. a. 21. Perahu itu dikandaskan angin topan. b. Ban yang berisi angin telah diciptakan sejak tahun 1830. Anak itu mengendarai sepeda sambil berlepas tangan. sinonim c. Frasa idiomatik terdapat dalam kalimat a. 20. Supaya cepat beres. Adik jatuh bangun saat belajar berjalan. Apakah pemerintah akan menaikan harga BBM? b. c. Apa kata dunia? d. Di mana ia tinggal sekarang? c. Berikut ini merupakan kalimat yang menggunakan ungkapan dengan tepat. c. Kehadiran Anda sangat ditunggu-tunggu. Demikianlah pemberitahuan dari kami. d. b. b. Orang itu adalah tangan kanan majikan rumah ini. 22. e. Di bawah ini yang merupakan kalimat tanya tersamar adalah a. e. konotasi 23. Tangan kanan Pak Budi harus diamputasi. denotasi e. Para pelajar itu sedang praktik lapangan di swalayan.b. berikan saja amplop kepada staf Biro Umumnya. d. e. Makna konotatif dari kata angin terdapat pada kalimat a. Harap disiapkan laporan bulanan untuk bahan rapat. Berapa lama Jepang menduduki Indonesia? Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 149 . c. Curah hujan di Jakarta dipengaruhi oleh angin Muson. Angin barat menggerakkan kapal-kapal nelayan. Tempat itu dipakai arena mengadu domba.

perubahan bentuk teks kepada puisi b. Haruskah kumati karnamu? d. proses e. kecuali a. kronologis 28. kronologis e. akibat-sebab d. Parafrasa yang disampaikan secara lisan dapat menggunakan pola penyajian di bawah ini. akibat-sebab e. perubahan teks kepada bentuk ikhtisar/rangkuman e. perubahan prosa kebentuk drama d. Sudahkah ia minta maaf kepada ibunya? Kalimat tanya yang sepadan dengan kalimat di atas adalah a. Apakah Bapak bersedia diwawancarai? e. sebab-akibat c. contoh 29. Kapankah ia datang dari kampung? b. kronologis 27. Kalimat tanya yang tak perlu dijawab ialah a. akibat-sebab d. Pola penyajian parafrasa yang menggambarkan rangkaian waktu disebut dengan penyajian a. perubahan puisi kepada prosa c. sebab-akibat c. contoh b. Parafrasa wacana atau teks yaitu a. contoh d. sebab-akibat c. Siapa yang sedang bicara dengan Bapak? b. Pola penyajian parafrasa yang menekankan uraian tentang langkahlangkah kerja disebut a.24. perbandingan b. proses b. Yang mana barang kepunyaanmu? c. Ke manakah gerangan perginya orang itu? e. Apa penyebab penyakit cikungunya? 25. perubahan teks kepada bentuk cerpen 150 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Siapakah pahlawan wanita dari Aceh? 26. Perlukah ia dengan kartu kredit ini? d. Sudah jam berapa sekarang? c.

donatur b.. moderator c.. notulis d.. peserta e.. Orang yang bertugas membahas topik permasalahan dalam diskusi ialah a... b. sarana 34.. Jawablah soal-soal di bawah ini dengan tepat dan benar! 1. 2. Berikut adalah unsur-unsur yang berkaitan dengan kelancaran sebuah diskusi. penyaji b. peserta e. penyanggah 31. Marilah kita buka diskusi ini dengan berdoa . c. topik masalah yang dipilih e. Ungkapan pembuka diskusi yang santun ialah di bawah ini.. kecuali a. aturan/teknik berdiskusi c. Terima kasih sudah pada ngumpul untuk membahas .. II. notulis d... Jelaskan apa yang dimaksud dengan kegiatan menyimak! Hal apa saja yang harus dilakukan agar menyimak mencapai hasil yang baik? 151 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . penyanggah 32. komponen diskusi b. Yang termasuk komponen diskusi berikut ini. Pihak yang baik secara aktif maupun pasif ikut terlibat di dalam diskusi diebut a.. moderator c. d.30.. Marilah kita memulai diskusi ini dengan . Dalam diskusi kali ini. kita akan membicarakan . peserta e.. posisi duduk dalam diskusi 33.. kecuali a. materi diskusi d... penyaji b. modeator c. e... penerapan pola gilir pada diskusi d. kecuali a. Terima kasih atas kehadiran Saudara pada diskusi kali ini ..

8. upah 7. 5.3. 6. Sebutkan contoh ungkapan membuka pembicaraan dalam ragam tak resmi! 152 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . khusus c. 9. rumah b. 4. formal d. Sebutkan ciri-ciri kalimat perintah! Apa perbedaan surat edaran dan pengumuman? Sebutkan macam-macam surat yang berisi perintah kerja yang kalian ketahui selain contoh di atas! Tuliskanlah sinonim dari kata-kata ini: a. Buatlah 2 buah contoh kalimat tanya yang bersifat klarifikasi! Tuliskan 2 kalimat pertanyaan yang tersamar dan jelaskan! Jelaskan apa yang dimaksud dengan parafrasa! 10.

dan mengungkapkan perbedaan pendapat dengan santun. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 153 . Tujuan pembelajaran adalah agar kita dapat menerapkan hal-hal tersebut dengan baik saat bercakap-cakap dengan mitra bicara dalam kondisi dan situasi apa pun. mengalihkan topik pembicaraan secara halus. atau menyatakan penghargaan Mengalihkan topik pembicaraan (topic switching) secara halus dengan menggunakan ungkapan yang tepat Menyatakan pendapat yang berbeda tanpa menimbulkan konflik secara halus dan santun Bagaimana bercakap-cakap secara sopan dengan mitra bicara akan dibahas pada Bab 8 ini yang meliputi bagaimana memilih kata untuk memulai atau mengakhiri percakapan. penerapan pola gilir dalam bercakap-cakap. tanggapan. pendapat.BAB 8 BERCAKAP-CAKAP SECARA SOPAN DENGAN MITRA BICARA DALAM KONTEKS BEKERJA Standar Kompetensi Kompetensi Dasar Berkomunikasi dengan bahasa Indonesia setara tingkat madya Bercakap-cakap secara sopan dengan mitra bicara dalam konteks bekerja - Indikator - Menggunakan kata atau ungkapan dalam memulai atau mengakhiri suatu pembicaraan baik formal maupun non-formal secara tepat dan efektif Menerapkan pola gilir percakapan secara aktif untuk keperluan mengajukan pertanyaan.

Setelah dihitung ternyata omzet yang dihasilkan dari berbisnis tebu bisa mencapai Rp. ia terjun ke bidang mesin khususnya mesin motor. masih mendingan jika harus digunakan untuk menyogok bila ingin menjadi pegawai negeri. Topo memang sudah menyukai mesin.500-Rp 2.000 per gelas. ia dapatkan dari penyuplai tebu dari Bengkulu atau Jambi. Bisnis yang ia geluti ini terinspirasi makin banyaknya minuman instan yang kini dilarang karena mengandung zat kimia dan pewarna. pria kelahiran Bengkulu. menurutnya ialah di dekat sekolah atau depan supermarket yang banyak dilalui orang atau anak-anak. Sejak lulus SMA. Ia harus membeli peralatan giling tebu seharga Rp 5 juta per set. Roby mencoba membuat bisnis minuman sari tebu yang ia lihat saat masih menjadi santri. Dari satu batang dapat diperoleh 5 -6 gelas sari tebu yang dijual Rp 1. Modal seadanya yang membawa sukses Lain lagi dengan wiraswastawan bernama lengkap Topo Goedel Atmodjo (32) yang memiliki bengkel motor modifikasi “Tauco Custom” di Jalan Raya Kebagusan Jagakarsa. Berangkat dari hobinya terhadap mesin motor. Padahal bahan baku yang digunakan sangat sederhana hanya batang tebu seharga Rp 4. Modal yang dikeluarkan semua tak kurang dari Rp. atau gelas. katanya.Wacana Pria Punya Usaha Dengan modal kecil membangun usaha Roby Siswanto (22). Jombang. Sekarang tinggal mencari tempat yang tepat untuk berjualan sari tebu. sudah termasuk mesin kompresor berbahan bakar bensin yang ia peroleh dari seorang bos. wadah. Tempat yang paling pas. Tebu dari kedua daerah tersebut mempunyai rasa yang manis dan tak membuat batuk. 200 ribu per hari. Banyak pekerjaan yang mematok persyaratan ijazah sarjana. hampir menyamai keuntungan bisnis angkot atau warung makan. bosan berkeliling Jakarta mencari lowongan yang berujung pada ketidaksesuaian syarat ijazah. seperti yang banyak dilakukan teman-temannya. tahun 1994 dan mengalami kesulitan mencari kerja. Dari SMA. Selain itu. 154 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . ia juga harus menyiapkan gerobak. ia kemudian mencoba membuka bengkel motor modifikasi. Untuk penyediaan tebu.500 per batang. 7 juta. mungkin karena dulu kakeknya punya bengkel. serta payung besar. Berbekal pengalaman saat menjadi santri di Pesantren Tebu Ireng. Mulailah ia menyiapkan peralatan yang diperlukan.

Karena krisis moneter beberapa waktu yang lalu. Dengan modal semangat dan uang seadanya. bagi penggemar motor modifikasi. pelanggan biasanya mempunyai keinginan sendiri. Sebelum menjalani bisnisnya yang sekarang. Jadi. perusahaannya tutup. bengkel modifikasi motor masih jarang dan prospeknya cukup bagus. Kemudia. berkali-kali pula ia bangkit. Untuk perbaikan motor modifikasi ini. itu pun gulung Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 155 . Setelah itu. sport. ia selalu berusaha memberikan yang terbaik buat pemilik motor agar puas. Bengkelnya dibuat pertama kali dengan menumpang pekarangan rumah orang di gang sempit. ia berencana ingin membuka lapangan kerja lebih luas lagi. pria kelahiran Jakarta ini termasuk interpreneur atau wiraswastawan yang mau memetik hikmah kegagalan. Banyak yang memakai jasanya. memang relatif bergantung pada konsepnya. harga yang tinggi sudah mencapai Rp 70 juta. Ia pun kemudian mengembangkan usaha minimarket. Berkali-kali usahanya jatuh. Kalau mengenai harga. thunder. dan lain-lain. ia memulai bisnis ini. maunya seperti apa. ia menyewa lahan. Ada juga yang Rp 15 juta bergantung modelnya. Untuk memodifikasi motor. ia membuatkan konsepnya sesuai dengan permintaan. ia akan menjelaskan sedetail mungkin mengenai konsepnya. Modifikasi itu dibuat karena hobi sehingga berapa pun biaya tidak jadi masalah bagi mereka. Tetapi. ia pernah bekerja di salah satu lembaga penunjang pasar modal di Jakarta karena latar belakang pendidikannya berkaitan dengan perbankan. sekitar seribu lebih desain telah dihasilkannya selama 13 tahun buka bengkel. Ia mendiskusikannya dengan pemilik motor. Ia menerima semua jenis motor yang bisa dimodifikasi untuk semua aliran. ia mencari barang-barang atau onderdil ke lapak-lapak lalu ia memanfaatkan bahan-bahan reject dari lapak tersebut untuk memperbaiki motor orang. itu sudah biasa. Bengkel modifikasinya makin dikenal orang lewat mulut ke mulut. Ke depan. Pengalamannya selama mengerjakan motor modifikasi. Kini. super. sedangkan motornya bisa jenis tiger. Setiap gagal selalu bangkit Kemal Rozandi (42). dan klasik. Semua alat-alat bengkel. bersama temannya yang ingin membuka bengkel mobil. Selain harganya murah. bahkan ia pun tidur di tempat itu. shogun. bengkel modifikasi juga tepat untuk orang yang mau memperbaiki motor bermodal cekak. Ada aliran trel. apa yang diinginkannya. ia rakit sendiri. Kalau orang tersebut tidak tahu sama sekali tentang modifikasi. mio. scorpio.Menurutnya. Setiap orang yang datang ke sini pasti ditanyakan dulu.

seseorang harus memiliki satu jaket agar lebih aman dan nyaman. nyaman. ia berpendapat bahwa bisnis jaket cukup prospektif. Ed. misalnya. berkat ketekunan dan kesabarannya. Biasanya ia mencoba hasil produksinya dulu. Selain itu. Sebelum jaket dibuat. segala hal yang berkaitan dengan proses komunikasi harus diperhatikan. dan punya nilai jual. Kemal sudah mampu memproduksi tidak kurang dari 300 jaket setiap bulan. ia kemudian menjahit dan memproduksi dalam jumlah terbatas. Kemal tertarik membuat jaket karena ia hobi naik sepeda motor. Setelah berkalikali gagal. April 2007) A. ia segera memproduksi dalam jumlah banyak dan dipasarkan. Agar dapat terjadi hubungan komunikasi timbal balik yang sesuai dengan tujuan komunikasi. ia membuat desainnya terlebih dahulu. perlu dipertimbangkan pula aspek situasi. Dengan pikiran itu. saat membuka percakapan. Pilihan Kata atau Ungkapan untuk Memulai Percakapan Proses penyampaian bahasa Indonesia dalam berkomunikasi secara lisan dapat dilakukan dalam dua cara. Apa pun caranya. Secara langsung maksudnya berhadapan atau bertatap muka dengan mitra bicara dan tidak langsung ialah dengan menggunakan sarana seperti telepon atau media komunikasi yang lainnya. yang jelas setiap proses komunikasi dilakukan dengan tujuan agar pesan yang disampaikan dapat dipahami oleh kedua pihak sehingga terjadi hasil yang efektif dan memuaskan. 156 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Saat ini. Unsur utama dalam komunikasi adalah bagaimana seseorang dapat menggunakan bahasa yang baik dan tepat. jumlahnya luar biasa besar. (Sumber: Wirausaha &Keuangan. dan ketika akan menutup pembicaraan. Setelah desain dibuat. Setidaknya untuk naik sepeda motor. yaitu secara langsung dan tidak langsung. Jaket menurut Kemal juga merupakan kebutuhan yang cukup penting. saat menyampaikan pesan.024. Dalam benaknya. ia melihat pengendara motor.tikar karena tak kuat bersaing dengan ritel-ritel yang ada. jika dirasakan cukup enak. ia lalu mencoba berbisnis jaket. Hal ini biasanya memengaruhi pilihan kata dan ungkapan yang digunakan dalam percakapan. dan hubungan pembicara mitra atau kawan bicaranya. tempat. waktu.

Rahmat.... Pak. Yang terhormat dewan guru . 3. Teman-teman yang saya cintai. Saya Ahmad.. 1... selamat datang. 7. Selamat pagi. Halo. Wa’alaikum salam. 5. Atau ucapan pembuka dengan sapaan: 1. PT. apakah saya bisa bertemu dengan Bapak . Bisa bertemu dengan . gimana kabarnya? Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 157 . Ungkapan pembuka lewat telepon dalam ragam formal: 1... Selamat malam. Selamat siang. Assalamu’alaikum.. Selamat datang... Para pendengar setia radio Sonora. selamat pagi .. Selamat pagi. ada yang bisa dibantu? 8... 9.. ada yang bisa saya bantu? 4.. Assalamu’alaikum . Assalamu’alaikum pemirsa di mana saja Anda berada.. Selamat malam.. 5. 6. Para pemirsa. 2. 7. selamat malam..... Para karyawan PT. kita berjumpa lagi selama tiga puluh menit ke depan . Yayasan Restu Ibu. Selamat pagi.. Assalamu’alaikum… 2. 14. 10. Saudara-saudaraku ..Untuk memulai percakapan dalam situasi formal biasanya menggunakan ungkapan sebagai berikut. Cafe Halal. Selamat sore.. 4.. 3. Bisa bicara dengan… saya dari… 3. 12.. 13. Salam sejahtera bagi kita semua. 11. Bisa bicara dengan. 6. selamat siang . Sejahtera. Selamat pagi... selamat siang… 5... Selamat malam para pendengar radio. Sahabat yang dimuliakan Allah. 2. bisa bicara dengan. Hadirin yang berbahagia. ada yang bisa kami bantu? 7... Bapak-Bapak dan Ibu-Ibu serta hadirin . saya Ardi.. selamat malam . Assalamu ‘alaikum.... Yang saya hormati Kepala Sekolah . Ungkapan atau salam pembuka pada percakapan di telepon dalam situasi nonformal: 1. 6. Halo. Siswa-siswi yang saya sayangi . Maaf mengganggu. 4.. 8.. Para tamu undangan yang kami muliakan. Selamat sore. Selamat Malam... 9. selamat berjumpa.

9.. Oke. 6. ingat ... ya. Sampai minggu depan. 3.. .. jika ada saran dan kritik.2. Demikian yang bisa saya sampaikan. Sebelum ditutup. Bu? Halo. Baiklah. Rahmatnya ada? Halo. 3... kita simpulkan bahwa . Salam dan Ungkapan dalam Mengakhiri Percakapan Ketika akan mengakhiri percakapan biasanya seseorang akan menegaskan kembali hal-hal pokok yang berkaitan dengan materi pembicaraan yang dianggap penting untuk diingat atau dilakukan kepada kawan bicaranya. Sekian saja pertemuan kita hari ini. 11.. ingat kita masih ada urusan 5. 5. kita akan mengadakan pertemuan kembali . kan besok? 4. 3... jadi. Sip deh. Baiklah pemirsa di rumah.. 4.. 2. Sebelum mengakhiri diskusi ini. Sebelum menutup rapat ini. kirimkan ke . Sebagai penutup.. saya ingatkan kembali . 7... Udah dulu. sampai bertemu besok di rapat... jangan sampai lupa rencana kita.. 158 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 1. Jadi.. Dalam situasi nonformal Contoh: 1. Oke. Bisa dengan Zulkifli? B... Menegaskan kembali yang hal penting dari apa yang telah dibicarakan agar tetap diingat atau tak lupa untuk dilakukan... ada Wiwin. jangan lupa datang di acara wisudaku.. jangan lupa besok ketemu .. 4. jadi kita besok berangkat . jangan lupa . saya tegaskan kembali . 8. Pak. pokoknya besok . Saat akan mengakhiri percakapan... Dalam situasi formal Contoh: Baiklah. 1. Halo.. saya ingatkan kembali . biasanya pembicara mengucapkan hal-hal seperti di bawah ini. Selanjutnya baru menyampaikan ucapan penutup pembicaraan. 10... 2.. Insya Allah..

5. Makasih. 4. Permintaan maaf Dalam situasi formal Contoh: 1. semoga kita bertemu lagi.. Atas perhatian Bapak dan Ibu sekalian.. 2.. sampai jumpa. mohon dibukakan pintu maaf jika ada kesalahan ucapan . Dalam situasi nonformal Contoh: a. Selamat jalan semoga sampai ditujuan. Trims. kami mengucapkan terima kasih. Mohon maaf atas keterlambatan . ya. 3. Terima kasih atas waktu dan kesempatannya. Terima kasih untuk pesan-pesannya. kalau ada salah ucap. 3. Thanks sudah mau kasih saran! 3. Terima kasih atas segala bantuan yang telah diberikan. 4. 3. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 159 . Selamat berpisah. yuk! d... 5.. Semoga berhasil. Ungkapan perpisahan serta harapan Dalam situasi formal Contoh: 1. Maafin ya. kalau ada salah kata. 2. ya! c. Mengucapkan terima kasih Dalam situasi formal Contoh: 1.. 3. Maaf. Kami mohon maaf jika ada pelayanan yang tak berkenan. Makasih banyak! b. 2. Sebelumnya kami mohon maaf bila tak berkenan .2.. Maaf. Mohon maaf jika ada kata-kata yang tak pantas. 2. ya! 4. Dalam situasi nonformal Contoh: 1.. Terima kasih atas kesedian waktunya.

5.ya . C. Anda bisa meminta anggota lainnya memberikan pendapat. Salam penutup biasanya disesuaikan dengan salam pembuka atau berdaarkan waktu. yuk! 6. Apalagi jika Anda moderator atau pemimpin dalam diskusi. Malam. Salam buat keluarga. ya! 7. Goodbye . Assalamu’alaikum.. Sampai di sini dulu pertemuan kita. Dada . Penerapan Pola gilir dalam Percakapan secara Aktif Dalam percakapan terkadang terjadi pola satu arah diakibatkan oleh seseorang mendominasi pembicaraan. Dah.4. 3. 3. Menutup percakapan dengan salam penutup.. Sampai berjumpa dalam kesempatan yang lain. Bye . Penerapan pola gilir dapat dilakukan dengan cara melemparkan pertanyaan.. Agar percakapan dapat berlangsung dengan merata dalam arti setiap orang yang terlibat percakapan mendapat giliran yang sama dalam berbicara. 4. 2. 4. gagasan. Sampai nanti.. 3. 5.. atau penilaian. Ucapan perpisahan nonformal Contoh: 1. Assalamu’alaikum. 2. Selamat siang. semoga sukses. Selamat malam. Salam penutup dalam situasi nonformal Contoh: 1.. Siang. dapat diterapkan sistem pola gilir. ya! 5. Dalam situasi formal Contoh: 1. Met malam! 2. 160 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Sampai nanti.

. Pengalihan topik dapat dilakukan dengan ungkapan berikut. Mengalihkan Topik Pembicaraan secara Halus Dalam suatu percakapan baik formal. Pengalihan topik dalam suatu diskusi bisa saja menyimpang dari pokok persoalan semula...... Hal ini tidak boleh dibiarkan. 3. Jika Anda moderator.. Persoalan ini berkaitan juga dengan masalah. Mungkin menyimpang sedikit. Wah... pengalihan topik dapat dilakukan secara halus dan santun agar tak mengganggu kenyamanan proses percakapan yang tengah berlangsung. 2. pengalihan topik pembicaraan dapat dilakukan dengan menyatakan ungkapan: 1. pengembangan gagasan atau meluasnya pembicaraan kepada pokok pembicaraan yang lain masih dianggap wajar jika tetap pada pokok persoalan yang sedang dibahas. 6. Proses pengalihan topik pembicaraan bisa disadari dan juga tidak disadari. Dalam situasi nonformal.. D. beberapa contoh ungkapannya...... 3.Di bawah ini. Mungkin ada kaitannya dengan .. tapi . Jika memang harus dilakukan.. seperti . Maaf.. Bagaimana jika kita meninjau sisi lain misalnya .. maupun nonformal. Hal ini bisa diakibatkan karena adanya keterkaitan antara satu masalah terhadap masalah lainnya atau satu topik terhadap topik lainnya. 3. Boleh tau pandangan Ibu tentang . semi formal. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 161 ... 5. 6. Dalam suatu pembicaraan. 1. 2... Bagaimana menurut Anda mengenai faktor lain seperti .. 4.. 4. saya dengar Ibu suka juga pada . 2. pengalihan pembicaraan ke topik lain biasa terjadi. 5. makin seru kalau kita bicara soal . Saya dengar Bapak bisa melakukan hal lain.. 1. Bagaimana menurut pendapat Anda? Mungkin di antara kalian ada yang berpendapat lain? Menurut pandanganmu gimana? Adakah yang memiliki pendapat lain? Mungkin ada yang mempunyai gagasan lain? Saya yakin ada yang mempunyai pendapat yang lebih baik.

” bukan kata-kata “tidak”. Mencari solusinya bisa lebih variatif. 162 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . (2) Berikan kesan mendukung gagasan yang akan disanggah sebelum menyertakan kekurangannya. dan itu gagasan orang bodoh harus dihindari.. pertanyaan langsung ke pokok permasalahan. Ungkapan seperti.. Maaf. Menggungkapkan Halus Perbedaan Pendapat secara Perbedaan pendapat di antara pembicara baik pada forum diskusi atau situasi semiformal sudah biasa terjadi. (4) Ungkapkan kekurangan pendapat mitra bicara dengan alasan yang logis.Anda harus bisa mengembalikan pembicaraan yang menyimpang tersebut kembali pada topik pembicaraan yang sebenarnya. Maaf. E. 4. Perbedaan pendapat dapat semakin memberi wawasan yang lebih luas tentang suatu pokok permasalahan. Menyampaikan pendapat yang berbeda atau menyanggah pendapat orang lain yang berbeda dengan pendapat kita dapat dilakukan secara halus dengan mempertimbangkan hal-hal berikut. Masing-masing orang memiliki pandangan atau pemikirannya sendiri. (3) Ungkapkan kekurangan dengan perkataan yang halus seperti. Segala unsur yang berbeda dicarikan sudut persamaannya atau disinergikan untuk mengarah pada satu kesimpulan atau penyelesaian.. Tidak setiap orang selalu menyetujui pendapat mitra bicaranya. Pertanyaan agar terfokus pada topik pembicaraan . setiap perbedaan pendapat harus dihormati dan disikapi secara santun. “kurang” atau “belum.. dengan mengucapkan: 1. (1) Nyatakan permohonan “maaf” dahulu. 3. Tetapi. Saya ingatkan kembali bahwa topik pembicaraan kita adalah . itu tidak benar. perbedaan pendapat itu tak boleh menjadi pemicu konflik. pertanyaan agar dipersingkat. Bukan hanya itu saja.. tetapi juga bisa merendahkan harga diri orang. pendapatnya tidak masuk akal. 2. Ungkapan itu bukan saja dapat menyinggung mitra bicara.. mustahil.

atau nonformal. (1) Menegaskan kembali yang hal penting dari apa yang telah dibicarakan agar tetap diingat atau tak lupa untuk dilakukan. Mengalihkan Topik Pembicaraan Secara Halus Dalam suatu percakapan baik formal. pengalihan pembicaraan ke topik lain biasa terjadi. yaitu secara langsung dan tidak langsung. (2) Mengucapkan terima kasih. dapat diterapkan sistem pola gilir dengan cara melemparkan pertanyaan supaya mitra bicara yang lain mendapatkan kesempatan. semiformal maupun nonformal. C. B. (3) Permintaan maaf. semi formal. (5) Menutup percakapan dengan salam penutup. Penerapan Pola gilir dalam Percakapan secara Aktif Agar percakapan dapat berlangsung dengan merata dalam arti setiap orang yang terlibat percakapan bisa berbicara. Ragam yang digunakan dapat ragam formal. biasanya pembicara melakukan hal-hal seperti di bawah ini. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 163 . Hal ini bisa diakibatkan karena adanya keterkaitan antara satu masalah terhadap masalah lainnya atau satu topik terhadap topik lainnya. Pengalihan topik tetap harus secara santun dan halus agar tak mengganggu kenyamanan proses percakapan yang tengah berlangsung. D. Secara langsung maksudnya berhadapan atau bertatap muka dengan mitra bicara dan tidak langsung ialah dengan menggunakan sarana seperti telepon atau media komunikasi yang lainnya. Salam dan Ungkapan dalam Mengakhiri Percakapan Saat akan mengakhiri percakapan. Pilihan Kata atau Ungkapan untuk Memulai Percakapan Proses penyampaian bahasa Indonesia dalam berkomunikasi secara lisan dapat dilakukan dalam dua cara. (4) Ungkapan perpisahan serta harapan.RANGKUMAN A.

Beri keterangan waktu penayangan dan nama acara serta stasiun televisi atau media elektronik yang meliputnya! UJI KOMPETENSI I. TUGAS MANDIRI Amatilah acara debat atau diskusi di televisi kemudian tulislah ungkapan-ungkapan yang menandakan hal-hal berikut 1. hubungan antarpembicara c. menutup perbincangan. mengalihkan topik pembicaraan (jika ada) 5. menyatakan pendapat yang berbeda dengan santun 6. usia penutur b. tempat dilakukannya pembicaraan e.E. Menyampaikan pendapat yang berbeda atau menyanggah pendapat orang lain yang berbeda dengan pendapat kita dapat dilakukan secara halus. membuka percakapan 2. suasana pembicaraan 164 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Menggungkapkan Perbedaan Pendapat secara Halus Perbedaan pendapat di antara pembicara baik pada forum diskusi atau situasi semiformal wajar terjadi. menerapkan pola gilir 3. waktu berlangsungnya pembicaraan d. kecuali a. memberi tanggapan 4. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini ! 1. Faktor yang menyebabkan komunikasi menjadi efektif adalah di bawah ini.

b. d. Para hadirin kami mohon agar berdiri . bagaimana kabarmu? d.. 6. c. apa kabar. Selamat datang para undangan . Sampai nanti malam di acara yang sama e. Di bawah ini. kecuali a. 7. Salam jumpa di mana saja kamu berada . e. Para hadirin yang kami muliakan. Halo semuanya yang lagi pada ngumpul . daa . Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 3.. saling sepaham c. Ungkapan membuka percakapan dalam situasi semiformal... Selamat malam permisa di mana saja Anda berada Manusia melakukan percakapan dengan tujuan di bawah ini. c. kecuali a. c. yang merupakan pembuka percakapan lewat telepon ialah a. nih.. Baiklah. Salam kangen dari fans kamu. Udah dulu ya. d.. Yang tidak termasuk contoh ungkapan memulai percakapan dalam situasi formal adalah a. Gimana. Selamat jumpa di mana saja kamu berada . 4.. Demikianlah sambutan Bapak Kepala Sekolah . e. selamat pagi .. saling memahami b. nih? d. Gimana kabarnya? c. dah lama nggak ketemu? Ucapan membuka acara pada situasi formal yaitu a. acara selanjutnya adalah ... Salam sejahtera bagi kita semua c.. Halo semuanya. 5. Assalamu’alaikum b.. Hai semuanya ... apa kabar semuanya? b..2.. mendapatkan tanggapan memuaskan Di bawah ini.. b. selamat malam . mencapai hasil yang diidamkan d. kabarnya. e.. Halo Rudi. 165 . saling mengerti e.... ucapan menutup acara dalam situasi formal adalah a. Demikianlah acara hari ini .. b.. Buat kamu-kamu. Halo. Selamat siang semuanya..

d. Sampai bertemu lagi. Beribu-ribu maaf kami haturkan . Pak.. asalamu’alaikum . Oke para pemirsa sekian dulu ... c. menyampaikan salam penutup 12. menyampaikan permohonan maaf d.. ya. udah dulu..d. Salam kompak selalu. e.. Numpang nanya.. b. Berjumpa lagi dengan saya di . bye-bye. 11.. sampai berjumpa lagi . menyapa hadirin atau mitra bicara e. 8. Pak.. ya. c. Sampai jumpa lagi di lain kesempatan.. 166 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Di bawah ini ucapan pembuka wawancara ialah a. b. good luck. Apa kabar.. e. kecuali a.. mengucapkan terima kasih c. Assalamu’alaikum.. d..... boleh? c. c... ya .. kecuali a.. Selamat tinggal. Sampai jumpa lagi.. e. Dah dulu. Ungkapan permohonan maaf yang baku adalah a. sayonara. Daa . semoga sukses. Mohon maaf yang sebesar-besarnya. Sekali lagi kami mohon dengan sangat pintu maaf. 10.. mohon maaf jika ada kesalahan. d.. Yang bukan merupakan ucapan atau salam perpisahan adalah a.. 9.daa .. Ucapan penutup percakapan lewat telepon dalam situasi nonformal. Hal-hal yang biasanya disampaikan ketika seseorang mengakhiri acara atau percakapan. mohon maaf mengganggu . Kami akhiri acara ini. e.see you Good bye. b. Maaf banget. Selamat jalan. d. menyimpulkan materi atau hal-hal pokok b. Akhirnya kita tutup acara ini dengan doa .! b. Pak? Boleh nanya .. Halo apa kabar Bapak di sana? e.. adalah di bawah ini.. ya.

. kecuali a.13. c. Sebelum diakhiri. Ungkapan yang tepat untuk memberikan mitra bicara kesempatan mengajukan pendapat ialah a. ingat rapat berikutnya . Demikianlah acara ini. kita ketemu lagi lusa . terima kasih. 14. menggunakan kata-kata yang santun e. Terima kasih banyak.. Atas perhatiannya. Jika ingin menyanggah pendapat secara halus.. Ada yang ingin ditanyakan? b. Pak. Terima kasih atas kehadiran Bapak. Bagaimana pandangan Anda tentang hal ini? e. kami ucapkan terima kasih. d.. Makasih banget. c. Ungkapan untuk menutup wawancara secara formal. Ada pertanyaan lainnya? Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 167 . Terima kasih atas nasihatnya.. Terima kasih atas waktunya. saya tutup dengan doa.. jangan lupa kita bertemu lagi minggu depan . ya! 15. Oke teman-teman.. d. Sampai di sini pertemuan kita. Saya setuju dengan pendapat Anda. kecuali a. e. e. c. e. d. saya ingin ingatkan kembali. ya.. Saya sependapat dengan usulan Saudara. ya! b. Trims berat buat semua! c. Ungkapan dalam mengakhiri acara dengan menegaskan kembali hal penting yang tepat. menyatakan maaf terlebih dahulu b. Ucapan terima kasih dalam mengakhiri percakapan yang baku adalah a. yaitu a. perlu diperhatikan di bawah ini. 16. mengungkapkan kekurangan pendapat orang lain dengan objektif c. b. Terima kasih atas kesediaan Bapak membantu. menyatakan penolakan terhadap pendapat tersebut 17. d. Baiklah. Baik. Trims sekali lagi. b. menghindari kata-kata menghina atau menjatuhkan d.

Buatlah contoh ucapan perpisahan dalam situasi formal! 8. memberikan variasi pada materi pembicaraan d..18.. kecuali a. memohon maaf. memberikan waktu pada mitra bicara untuk menyampaikan ide d. Maaf sedikit menyimpang namun .. Hal apa saja yang biasa diucapkan untuk mengakhiri percakapan? 10. II. mengajukan pertanyaan. kecuali a. c. memberikan kesempatan mitra bicara untuk berpendapat c. Jawablah soal-soal di bawah ini dengan tepat dan benar! Buatlah tiga ucapan pembuka percakapan lewat telepon! Buatlah tiga contoh ungkapan pembuka dalam percakapan formal! Buatlah tiga contoh ungkapan pembuka dalam percakapan nonformal! Apa tujuan dalam berkomunikasi secara lisan? Buatlah tiga contoh ungkapan mengakhiri percakapan secara formal! Buatlah tiga contoh ungkapan dalam mengakhiri ucapan secara nonformal! 7.. kecuali a. 2. 6. b. Pengalihan topik pembicaraan kadang diperlukan untuk hal di bawah ini. Hal yang bisa dilakukan untuk menerapkan pola gilir pada percakapan adalah berikut ini. e. 4. Beberapa seperti .. Hal-hal apa yang harus diperhatikan dalam mengungkapkan perbedaan pendapat secara santun? 9. Berikan dua contoh ungkapan untuk mengalihkan topik pembicaraan secara halu! 168 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . 1. 5. Penyebab lain juga bisa karena .. memberikan kesempatan untuk bertanya e. mengganti topik yang sedang dibicarakan e.. 19. memberi sedikit penyegaran 20... mengurangi kebosanan c. Tolong pertanyaan jangan melebar ke mana-mana. Fakta lain yang berkaitan dengan hal ini ada juga seperti . b. berkaitan juga dengan masalah ini. d. 3. Ungkapan halus untuk mengalihkan topik pembicaraan di bawah ini. mengembangkan topik b..

BAB 9 BERDISKUSI YANG BERMAKNA DALAM KONTEKS BEKERJA

Standar Kompetensi Kompetensi Dasar

-

Berkomunikasi dengan bahasa Indonesia setara tingkat madya Berdiskusi yang bermakna dalam konteks bekerja

-

Indikator

-

Menyampaikan gagasan yang tepat dengan topik diskusi Menyanggah pendapat tanpa menimbulkan konflik dalam suatu forum diskusi dengan santun dan ekspresif Menyampaikan argumentasi terhadap topik diskusi yang dibicarakan Menghargai mitra bicara yang menyampaikan argumen terhadap topik diskusi Menyusun simpulan berdasarkan fakta, data, dan opini dengan tepat

Pada bab ini, kita akan mempelajari hal-hal yang berkaitan dengan diskusi: manfaat diskusi, tugas dan peranan unsur diskusi, cara menyampaikan pendapat, gagasan, sanggahan sesuai topik diskusi dengan tepat dan argumentatif; cara menghargai pendapat orang lain dalam diskusi, serta menyusun simpulan diskusi. Setelah mempelajari materi ini, diharapkan kita dapat memahami proses diskusi dan dapat terlibat aktif dalam diskusi yang meliputi kemampuan menyampaikan pendapat serta alasan yang logis, memberikan sanggahan yang santun dan tepat sesuai topik diskusi, dapat menghargai pendapat orang lain, dan dapat menyusun simpulan diskusi dengan tepat.
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

169

Wacana Dunia Sedang Lapar
Saat ini, dunia mengonsumsi minyak 225 juta barrel per hari. Dengan pertumbuhan ekonomi dunia seperti sekarang, diperkirakan bakal ada penambahan konsumsi rata-rata per tahun 1,6 persen atau setara 4 juta barel. Mengacu perkiraan Badan Energi Internasional (IEA), konsumsi minyak dunia tahun 2030 akan naik 50 persen. Konsumsi boleh saja meningkat seiring dengan pertumbuhan sosial dan ekonomi global, tetapi dari mana kebutuhan minyak dunia akan dipenuhi mengingat produksi minyak ada batasnya. Minyak fosil sendiri memberikan kontribusi 80 persen dari kebutuhan energi dunia. Penurunan suplai minyak fosil akan mengimbas pada penurunan pasokan energi. Apabila permintaan dan penawaran minyak dunia makin timpang, mobilitas akan terhambat, akan melemahkan persaingan, menurunkan produksi, mengurangi invertasi, serta berdampak pada penurunan kesejahteraan dan kualitas hidup. Saat ini, harga minyak mentah dunia mendekati 100 dolar AS per barel. Harga minyak mentah dunia yang makin fluktuatif dan sensitif menjadi indikasi makin menipisnya cadangan minyak dunia, yang mendorong terus berkurangnya exportable surplus. Kondisi ini tak bisa dianggap angin lalu. Pernahkah Anda membayangkan bagaimana bila mendadak pabrik-pabrik berhenti beroperasi karena tidak ada pasokan minyak? Tranportasi darat, udara, dan laut macet, serta pembangunan infrastruktur terhenti karena tidak ada bahan bakar minyak? Tak bisa dibayangkan berapa miliar pekerja yang mendadak menjadi pengangguran. Lantas, bagaimana caranya agar mobilitas sebagai faktor penggerak penting kehidupan masyarakat modern bisa terus dipertahankan atau bahkan ditingkatkan? Tantangan ini yang dicari jawabannya dalam Challenge Bibendum Shanghai 2007, yang berlangsung 14-17 November 2007 di Shanghai, China. Acara ini digelar untuk yang kesembilan kalinya sejak 1998 dan untuk kedua kalinya di Shanghai.

170

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

Gerakan Penyadaran Menurut David Pirret, Wakil Direktur Utama Shell Lubricants, salah satu anak perusahaan Petroleum Company Ltd, Challenge Bibendum merupakan sebuah gerakan penyadaran bersama dari pemain otomotif dunia. Mereka antara lain pabrik kendaraan, rekan teknis, pemasok energi, dan lembaga penelitian. Inisiatif gerakan ini datang dari produsen ban ternama Michelin. Tujuan gerakan ini antara lain bagaimana menyadarkan warga dunia agar mau menggunakan teknologi kendaraan dan energi tercanggih agar tercapai penggunaan bahan bakar yang efisien, ramah lingkungan, dan aman. Shell sebagai bagian dari pemain otomotif dunia, khususnya sebagai pemasok energi dn pelumas, amat menyadari pentingnya pasokan energi yang berdampak rendah pada emisi gas buang. “Shell menyadari bahwa perseteruan antara kebutuhan energi untuk mendukung mobilitas dan bahaya yang ditimbulkannya bakal terjadi di planet ini,” kata David, di Shanghai. Apa yang dikatakan David mengenai penggunaan minyak fosil berdampak pada perubahan iklim global benar adanya. Setidaknya penelitian dari Intergovernmental Panel on Climate Change (IPCC) yang dirilis Februari 2007 menunjukkan bahwa Bumi makin memanas. Sepanjang abad ke-20, suhu bumi naik 0,7 derajat celcius. Apabila manajemen pengelolaan lingkungan, pencemaran udara, dan emisi gas buang tidak bisa ditekan, kondisi akan lebih buruk lagi. Setidaknya akan ada penambahan suhu Bumi 0,2 derajat celcius tiap dasawarsa. Naiknya suhu Bumi berdampak serius pada iklim global. Iklim amat dipengaruhi suhu panas Bumi sebagai akibat perubahan tekanan udara, yang menyebabkan terjadinya arus angin. Iklim yang berubah memengaruhi produksi pertanian karena sektor pertanian amat bergantung pada kondisi iklim di suatu kawasan. Upaya yang paling mungkin dilakukan adalah menjaga populasi warga dunia menetapkan pilihan yang tepat dalam penggunaan teknologi, seperti penggunaan bahan bakar batubara, minyak fosil, dan pengembangan energi nuklir, atau penggunaan energi dari bahan bakar nabati yang dapat diperbaharui.

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

171

Dampak perubahan iklim global akan sangat merepotkan negaranegara di dunia. Australia misalnya, akan mengalami masa kekeringan, dan ini mengancam pertanian mereka seperti peternakan sapi perah dan sapi potong. Dampak kekeringan di Australia tahun 2006 menyebabkan kenaikan harga susu bubuk hingga lebih dari 10 persen. Harga gandum melonjak, begitu pula daging sapi. Negara-negara di Eropa juga akan mengalami masalah serius akibat berubahnya iklim global. Hujan akan banyak turun di wilayah utara Eropa, sementara di sebelah selatan akan terjadi kekeringan. Kondisi akan memicu pencairan es dan berdampak pada kurangnya kunjungan wisatawan pada musim dingin. Afrika juga akan mengalami ancaman kelaparan, bencana erosi dan banjir sehingga kondisi negara-negara di Afrika bakal makin buruk. Amerika Selatan pun tak lepas dari ancaman banjir, sementara produk pertanian di kawasan Amerika Utara bakal terganggu. Indonesia juga tidak bisa menghindar dari pengaruh perubahan iklim global. Buktinya, pada akhir tahun 2006, kemarau panjang melanda sebagian besar wilayah Indonesia. Akibatnya, produksi beras jatuh, harga beras melonjak, dan masyarakat pun menjerit. Daya beli yang tetap sementara harga komoditas pertanian cenderung meningkat, akibat permintaan dan penawaraan tidak seimbang secara permanen dan terus-menerus, akan menyebabkan kualitas hidup warga Indonesia merosot. Perubahan iklim global yang ditandai dengan peningkatan suhu Bumi memiliki dampak ekonomi dunia yang serius. Nicholas Stern, mantan ekonom dari Bank Dunia seperti dikutip Research Eu, sebuah majalah penelitian di Eropa, mengungkapkan bahwa perubahan iklim global akan memekan biaya 5.500 miliar euro pada tahun 2050. Biaya Biaya harus ditanggung sebagai dampak perubahannya iklim global itu melebihi biaya akibat Perang Dunia II. “Dengan catatan, ongkos perubahan iklim yang besar terjadi bila warga dunia tidak melakukan tindakan pencegahan apa-apa,” katanya. Lalu, siapa yang harus menanggung beban biaya yamg amat besar itu? Jawabannya, seluruh warga dunia. Dampak perubahan iklim akan mengimbas seluruh negara di dunia. Negara miskin akan makin miskin 172
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

karena kalah bersaing dalam perebutan minyak dunia. Negara berkembang akan menanggung beban pengangguran yang makin membengkak akibat lemahnya perputaran roda ekonomi. Daya beli masyarakat juga bakal merosot tajam karena semua produk untuk memenuhi kebutuhan hidup sehari-hari menjadi amat mahal. Untuk mengantisipasi itu, Uni Eropa telah mengalokasikan anggaran 50,5 miliar euro dalam kurun 2007-2013. Mereka berkosentrasi pada program tujuh kerangka kerja atau Seventh Framework Programme yang dikenal dengan istilah FP7, yang fokusnya pembangunan, penelitian, dan teknologi. Dari anggaran tersebut, 32 miliar euro di antaranya untuk mendukung penelitian, yang meliputi 10 bidang, yaitu kesehatan; pangan, pertanian, dan bioteknologi; teknologi informasi dan komunikasi; nanosciences, nanotechnologies, materials and new production techologies; energi; lingkungan meliputi perubahan iklim; transportasi; pengetahuan sosial-ekonomi dan kemanusiaan; ruang; dan masalah keamanan. Juga disediakan anggaran 7,4 miliar euro untuk pembuatan ide cemerlang untuk landasan kerja. Selain itu, 4,7 miliar euro untuk kegiatan ilmiah dan 4,2 miliar euro untuk kegiatan ilmuwan. Sementara 2,4 miliar euro untuk jaminan energi pada masa pendatang. China sebagai negara yang sedang tumbuh pesat juga tak mau ketinggalan. Pekan lalu mereka membangun stasiun bahan bakar hidrogen sebagai upaya untuk menekan emisi gas buang. Maklum, pembangunan industri yang pesat di China menyumbang polusi udara yang hebat. Indonesia tentu saja bergiat menekan pencemaran udara. Misalnya dengan berkomitmen melakukan revitalisasi kehutanan. Indonesia sebagai negara yang memiliki hutan terbesar kedua di dunia, selama ini penyumbang oksigen yang besar untuk dunia. Bagaimanapun, setiap negara harus berperan aktif untuk menekan penggunaan energi berbahan bakar minyak fosil. Caranya dengan sedini mungkin melakukan tindakan nyata dengan mengonversi energi fosil ke bahan bakar nabati. Kalau tidak, dunia yang sedang lapar energi ini bakal menyulitkan kita.
(Sumber: Kompas, 24 November 2007)

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

173

174 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Manfaat diskusi ialah: (1) (2) (3) (4) (5) (6) (7) membiasakan sikap saling menghargai menanamkan sikap demokrasi mengembangkan daya berpikir mengembangkan pengetahuan dan pengalaman mewujudkan proses kreatif dan analitis mengembangkan kebebasan pribadi melatih kemampuan berbicara B. Diskusi secara umum bertujuan untuk mencari solusi atau penyelesaian suatu masalah secara teratur dan terarah. pembicara. orang yang bertugas membahas masalah adalah moderator selaku pemimpin diskusi. dan kertas. Tugas unsur-unsur diskusi adalah sebagai berikut. (2) Unsur materi. Diskusi yang baik akan membawa manfaat yang baik. seperti topik diskusi atau permasalahan. dan peserta diskusi Jika diskusi tidak dihadiri pembicara. kursi. saling bertukar pikiran secara aktif dan santun untuk mencapai kesepakatan atau penyelesaian yang baik. seperti ruangan/tempat. Agar diskusi bisa berjalan dengan lancar maka setiap unsur diskusi harus menjalankan tugas dan peranannya tersebut dengan baik. Diskusi dan Manfaatnya Untuk mengadakan sebuah diskusi harus dipersiapkan terlebih dahulu unsur-unsur berikut. Diskusi dapat diartikan dengan kegiatan bertukar pikiran secara lisan. misalnya meja. penyaji/narasumber/pemrasaran/pembicara. papan tulis. Tugas dan Peranan Unsur Diskusi Setiap unsur-unsur di dalam diskusi memiliki tugas dan peranannya masing-masing. perlengkapan. (1) Unsur manusia. (3) Unsur fasilitas. maupun moderator menjalankan tugasnya dengan baik. Diskusi biasanya dilakukan karena ada masalah atau persoalan yang perlu dibahas dan dipecahkan. yaitu moderator atau pemimpin diskusi. dan tujuan atau sasaran.A. baik peserta. Yang dimaksud teratur dan terarah ialah semua unsur-unsur yang ada di dalam diskusi berfungsi. notulis/sekretaris.

Menuliskan kesimpulan atau hasil diskusi f. Waktu dan tempat diskusi berlangsung c. Membuat laporan hasil diskusi g. Turut serta menjaga kelancaran dan kenyamanan diskusi 2. Memperkenalkan komponen diskusi terutama pembicara jika ada unsur pembicara/penyaji d. Menjaga agar pertanyaan tetap pada konteks pembicaraan Tugas dan Peranan Notulis a. atau usulan d. Mengikuti tata tertib dan aturan dalam diskusi b. Mencatat segala proses yang langsung dalam diskusi e. Membuka diskusi dan menjelaskan topik diskusi c. Memusatkan perhatian g. Tugas Moderator/Pemimpin Diskusi a. Membuat diskusi menjadi hidup atau dinamis e. Menyajikan pembahasan materi atau menyampaikan gagasangagasan serta pandangan yang berkaitan dengan topik diskusi c. Mencatat jumlah peserta d. Menutup diskusi Tugas Pembicara a.1. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 175 . Mengajukan pertanyaan. Menyimpulkan diskusi dan membacakan simpulan diskusi g. Menyiapkan pokok masalah yang akan dibicarakan b. telah 4. Mempelajari topik/permasalahan diskusi c. Menyiapkan materi diskusi sesuai topik yang akan dibahas b. Mengatur proses penyampaian gagasan atau tanya jawab f. Bersikap santun dan tidak emosional f. pendapat/sanggahan. Mencatat topik permasalahan b. Menjawab pertanyaan secara objektif dan argumentatif d. 3. Mendokumentasikan catatan tentang diskusi yang dilakukan Peranan atau Tugas Peserta Diskusi a. Menunjukkan solidaritas dan partisipasi e.

sanggahan dapat diungkapkan dengan memerhatikan hal-hal berikut. dan lain-lain harus dihindarkan. Perbedaan pendapat di dalam diskusi menyebabkan diskusi berkembang asalkan cara menyampaikan perbedaan tersebut dengan sikap yang toleran dan saling menghargai. Selain itu. maksudnya pendapat disampaikan secara sistematis. (1) Menyatakan permohonan maaf terlebih dahulu sebelum menyampaikan sanggahan atau ketidaksetujuan (2) Memberikan pujian atau penghargaan terhadap pendapat yang akan ditanggapi (3) Menyampaikan sanggahan atau tanggapan dengan alasan yang masuk akal (4) Sanggahan diusahakan menyempurnakan atau memberikan solusi alternatif terhadap gagasan yang akan ditanggapi. jelas. pendapat juga harus disampaikan secara kreatif yaitu. tidak masuk akal. tertolak. Pendapat juga harus bersifat analitis. Namun. 176 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . tepat. apa yang disampaikan merupakan hal yang baru dan bernilai tinggi atau berkualitas. ide. D. teratur. Jika seseorang hendak mengajukan sanggahan atau penolakan atas pendapat serta usulan peserta diskusi yang lain. Pendapat harus bersifat logis. dan mendalam serta tidak berbelit-belit.C. gagasan yang akan disampaikan harus sesuai dengan topik yang sedang dibahas. Menyampaikan Tanggapan dan dalam Diskusi Sanggahan di Adalah wajar dalam setiap diskusi terjadi perbedaan pendapat. (5) Ungkapan-ungkapan yang merendahkan. pendapat orang kampung. atau usulan harus disampaikan dengan bahasa yang santun. semua pengungkapan gagasan. dan objektif. seperti. Menyampaikan Pendapat dan Gagasan dalam Diskusi Saat menyampaikan pendapat atau gagasan di dalam diskusi. yaitu dapat diterima oleh akal disertai alasanalasan serta bukti dan fakta-fakta sehingga pendapat yang dikemukakan dapat meyakinkan peserta diskusi yang lain.

Saya mendukung pendapat Saudara. Pendapat Anda sesuai dengan topik yang dibahas. E. Tanggapan bukan hanya memberi sanggahan. (4) Dukungan harus diungkapkan secara objektif... perlu diperhatikan hal-hal berikut.. Memberikan simpulan dalam diskusi merupakan tugas moderator. tidak berbelitbelit serta dengan bahasa yang santun (2) Persetujuan juga diungkapkan dengan logis berdasarkan fakta dan alasan yang bisa diterima... Saya kira masih ada pilihan lain misalnya . 2. barangkali perlu ditinjau kembali Masih ada yang kurang sesuai dengan topik permasalahan.. peserta diskusi dapat diikutsertakan agar simpulan yang diambil lebih objektif dan valid.. (3) Persetujuan disampaikan dengan wajar dan tidak berlebihan. atau pendapat orang lain di dalam diskusi. simpulan diambil dengan berdasarkan hal-hal berikut. Apa yang Saudara katakan sama dengan pemikiran saya. 3.. Untuk menyampaikan persetujuan atau dukungan terhadap pendapat orang lain. Maaf. 2. Di bawah ini adalah contoh ungkapan yang dapat dipergunakan untuk menyampaikan dukungan atau persetujuan. saya kurang sependapat . simpulan dapat diambil dengan melalui penalaran deduktif maupun induktif. 3. 5. Dalam diskusi. 4. 1. gagasan.Di bawah ini adalah contoh kata atau ungkapan yang dapat digunakan untuk memberikan tanggapan atau sanggahan atas pendapat orang lain. (1) Pernyataan dukungan diungkapkan dengan jelas. Saya setuju dengan pendapat Anda. Namun untuk merumuskan simpulan. Maaf. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 177 . pendapat saya sedikit berbeda . Secara umum. 4. tapi juga mendukung ide. 1.. Mengambil Simpulan dalam Diskusi Tujuan diskusi adalah mencapai hasil berupa kesepakatan terhadap sesuatu atau pemecahan terhadap suatu masalah.

B. (5) Simpulan diupayakan merupakan rumusan yang inovatif. Dalam diskusi simpulan diambil dengan berdasarkan pada fakta. RANGKUMAN A. Menyampaikan Pendapat dan Gagasan dalam Diskusi Saat menyampaikan pendapat atau gagasan di dalam diskusi. setiap unsur diskusi harus menjalankan tugas dan peranannya tersebut dengan baik.(1) Pendapat yang dapat diterima oleh semua peserta diskusi. (2) Data-data dan fakta yang benar dan dapat diterima kebenarannya oleh peserta diskusi. 178 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . unsur materi. Agar diskusi dapat berjalan dengan lancar. Pendapat harus bersifat logis. Menyampaikan Tanggapan dan Sanggahan dalam Diskusi Jika seseorang hendak mengajukan sanggahan atau penolakan atas pendapat atau usulan peserta diskusi yang lain. Secara umum simpulan dapat diambil dengan melalui penalaran deduktif maupun induktif. dan opini yang tepat. Tugas dan Peranan Unsur Diskusi Setiap unsur di dalam diskusi memiliki tugas dan peranannya masingmasing. solusif. gagasan yang akan disampaikan harus sesuai dengan topik yang sedang dibahas. (3) Segala pendapat atau gagasan yang sama dan sejalan. E. dan fasilitas. Diskusi dan Manfaatnya Untuk mengadakan sebuah diskusi harus dipersiapkan terlebih dahulu unsur-unsur manusia. yaitu dapat diterima oleh akal disertai alasanalasan serta bukti dan fakta-fakta sehingga pendapat yang dikemukakan dapat meyakinkan peserta diskusi yang lain. C. Mengambil Simpulan dalam Diskusi Tujuan diskusi adalah mencapai hasil berupa kesepakatan terhadap sesuatu atau pemecahan terhadap suatu masalah. data. dan implementatif. D. dapat diungkapkan dengan menghargai mitra bicara yang menyampaikan argumen tersebut. (4) Voting atau mengambil suara terbanyak dari peserta diskusi yang hadir.

dana d. c. b. memperdebatkan sesuatu e. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! 1. kecuali membuka diskusi mempersiapkan materi diskusi mengatur jalannya diskusi memperkenal unsur-unsur diskusi yang lain menyimpulkan hasil diskusi 2. pembahasan masalah c. kegiatan bertukar pikiran secara lisan d. topik permasalahan e. moderator b. d. dan sanggahan hingga penyusunan simpulan dengan tepat dan santun. perlengkapan Di a. buatlah sebuah diskusi kelompok dengan menentukan topik diskusi. Setelah itu. serahkan simpulan atau hasil pembahasan diskusi kepada guru untuk dinilai! UJI KOMPETENSI I. penyaji c. dan melakukan proses diskusi dengan menerapkan tata cara menyampaikan pendapat. Lalu. Yang dimaksud dengan diskusi adalah a.TUGAS KELOMPOK Bentuklah kelompok yang terdiri atas 4 – 5 orang. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 179 . tukar pikiran dengan rileks Di bawah ini yang termasuk unsur materi dalam diskusi ialah a. bawah ini tugas moderator. 3. obrolan bersama b. e. membagi tugas sesuai unsur diskusi. argumentasi.

. mencatat jumlah peserta diskusi c. melatih kemampuan berbicara d. menilai peserta yang aktif dan pasif Yang merupakan ciri gagasan yang kreatif adalah di bawah ini. 6. 9. memiliki kualitas 180 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 5. mencatat proses atau jalannya diskusi b. menjaga sikap agar santun e. menambah wawasan Yang termasuk unsur perlengkapan untuk menyelenggarakan diskusi di bawah ini. mencatat waktu dan tempat berlangsungnya diskusi d. menumbuhkan sikap demokrasi c. menyiapkan materi diskusi d. kecuali a. bangku dan meja c. mencatat hasil diskusi e. alat tulis dan kertas d. kecuali a. ruangan e. komputer b.4. memperkenalkan diri c. membahas materi diskusi e. sound system dan papan tulis Yang bukan termasuk tugas peserta ialah a. menumbuhkan sikap toleransi e. 7. mengajukan pertanyaan d. 8. mengajukan pertanyaan c. Yang tidak termasuk manfaat diskusi di bawah ini a. menyajikan makalah Yang bukan tugas notulis ialah a. mengikuti tata tertib diskusi Yang bukan tugas penyaji adalah a. menjaga kelancaran diskusi b. mengembangkan gaya bicara b. menjawab pertanyaan peserta b.

Di bawah ini cara menyelesaikan perbedaan pendapat di dalam diskusi yang terbaik ada dalam kalimat a. dan tata suara. juga mengandung nilai hiburan yang tinggi.. Berdasarkan hal-hal yang telah dikemukakan oleh Saudara penyaji. e. Mengambil suara terbanyak dari peserta yang hadir.b. merupakan hal yang baru masuk akal dapat menginspirasikan gagasan yang lain berbobot 10. misalnya tata lampu. 11. jika bisa diskusi ini juga mencari solusi yang tidak menimbulkan risiko apa-apa. c. Perbedaan pendapat di antara peserta wajar terjadi. c. Pilihan kita hanya ini. Saya menyarankan agar pembahasan mengarah pada persoalan. Sebaiknya seni wayang tidak perlu dikembangkan karena tidak sesuai dengan zaman modern. Kalimat sanggahan yang sesuai dengan masalah di atas adalah a. e. sudah percuma dan tidak akan menghasilkan simpulan yang bermutu.. sebaiknya kita membatasi masalah kepada hal. saya ingin bertanya mengenai. d... tak ada lagi yang lainnya. Kalimat yang menggunakan bahasa yang santun dalam diskusi. kecuali a. c. Kita harus mencari alternatif lain karena bukan ini jalan satusatunya yang dapat kita tempuh. e. penyajian seni wayang dipadukan dengan gaya dan cengkok seni modern. Menurut pendapat saya.. Maaf. tata musik. d. Di dalamnya terdapat pelajaran-pelajaran berharga yang berkaitan dengan kehidupan manusia. sekalipun banyak generasi muda yang belum memahami wayang. Bahkan di dunia modern saat ini. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 181 . Pendapat kita harus kita uji cobakan dahulu di lapangan. 12. Seni wayang merupakan seni tradisional yang menjadi salah satu ciri kebudayaan Indonesia. d.. berhasil tidaknya urusan nanti. Masyarakat pada umumnya menyukai seni wayang karena di samping menarik dan padat ceritanya. b. b. Saya harap diskusi ini jangan diteruskan.

pendapat yang digunakan berhubungan dengan topik diskusi 15. d. d. 182 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Menurut saya. b. pendapat yang digunakan tidak memecahkan masalah c. e. Sebaiknya diskusi ini tak usah dilanjutkan. Lestarikan seni tradisional sebagai khasanah kebudayaan Indonesia. Penyampaian gagasan yang paling meyakinkan terdapat pada a. Yang bukan syarat untuk mengungkapkan pendapat dalam diskusi ialah a. 16. diskusi ini saya simpulkan. Barangkali Borobudur itu sudah ada sejak abad ke-200 sebelum Masehi. Untuk melestarikan seni tradisional. Kalimat simpulan yang baik dalam diskusi adalah a. penerapan teknologi modern di kalangan pendidikan menengah dan pesantren harus sudah mulai digalakkan. sebaiknya semua seni tradisional disatukan.. pendapat yang digunakan didukung oleh fakta e. Saya kira telah terjadi berbagai bencana di Jawa Tengah dan sekitarnya selama musim hujan. d. Seni wayang merupakan seni asing sebaiknya tidak perlu dikembangkan. Mengingat suara terbanyak. c. Mungkin beberapa calon kepala desa akan diumumkan minggu depan. 13. Generasi muda tidak perlu mempelajari seni wayang.b. e. 14. pendapat yang disampaikan bersifat terbuka b. b. e. Hendaknya kalian paham bahwa ini adalah simpulan diskusi. kalimat yang digunakan tepat d.. c. Saya yakin peserta diskusi menyetujui simpulan diskusi ini. kalimat yang berupa sanggahan adalah a. c. Kami akan membaca beberapa simpulan sebelum diskusi ini kita akhiri. Sekitar lima puluh kuli tinta dari berbagai media bersedia melawan perdagangan narkoba konon kabarnya. Simpulan ini adalah milik para peserta diskusi. Di bawah ini..

Apa yang Saudara ungkapkan tidak ada salahnya. Mudah-mudahan dengan banyaknya penduduk. c. Maaf. perlu ditinjau kembali c. kecuali a. b. Pendapat Anda sama dengan pemikiran saya. 19. Sudahlah. d. d. kita jadi penonton saja dalam diskusi ini. Menurut saya. Gagasanmu memang luar biasa. 17. negara kita akan makin makmur. b. Kalimat yang tepat untuk menanggapi pendapat tersebut adalah a. kurang sependapat b. Kata-kata yang dapat digunakan untuk menyanggah pendapat yang baik adalah di bawah ini. kurang setuju e. kecuali a. Pernyataan Anda sangat sesuai dengan keinginan saya. e. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 183 . Sanggahan yang kamu kemukakan tadi memang tepat. namun kurang didukung oleh fakta yang akurat. Hal itu bisa terlaksana apabila penduduk dipaksa mengikuti program KB. c. Pengaturan pertumbuhan penduduk melalui program KB tidak perlu digalakkan. apa yang Saudara kemukakan itu tidak selamanya benar. perlu dibarengi dengan pengaturan pertumbuhan penduduk melalui program KB. c.b. e. Saya sependapat dengan apa yang dikemukakan penyaji sebab program KB bertujuan meningkatkan kesejahteraan masyarakat. Pendapat: agar pembangunan ekonomi dan peningkatan kesejahteraan masyarakat dapat terlaksana dengan cepat. e. pendapat Saudara memang baik. Kalimat berikut menyatakan persetujuan. d. Tak ada salahnya kalau kita pertimbangkan dulu usulan Saudara. sama sekali tidak tepat d. belum bisa diterima 18. Saya sangat setuju dengan gagasan Anda.

3. 9. Apa yang dimaksud dengan diskusi? Sebutkanlah manfaat dari diskusi! Sebutkan peranan moderator! Sebutkan peranan penyaji! Sebutkanlah tugas notulis! Sebutkan tugas atau peranan peserta diskusi! Sebutkan yang termasuk unsur manusia dalam diskusi! Buatlah 2 kalimat yang berisi sanggahan yang santun terhadap pendapat orang lain! Buatlah 2 kalimat persetujuan yang santun terhadap pendapat orang lain! 10. Jawablah soal-soal di bawah ini dengan tepat dan benar! 1. Pendapat Anda tidak ilmiah sama sekali. Hal apa saja yang harus diperhatikan dalam memberi tanggapan dalam diskusi? 184 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . 8. Saya sangat tidak setuju dengan pernyataan Saudara tadi. Saya tidak menerima pendapat Saudara.20. kecuali semua peserta menyetujuinya. Saya kurang sependapat dengan gagasan Anda. 2. c. 5. ada hal yang kurang sesuai dengan topik pembicaraan mohon ditinjau kembali. 7. II. 4. Saya pikir pendapat Anda sudah tidak relevan lagi dengan situasi sekarang. b. d. e. Kalimat sanggahan yang tepat dan santun adalah a. 6.

BAB 10 BERNEGOSIASI YANG MENGHASILKAN DALAM KONTEKS BEKERJA Standar Kompetensi Kompetensi Dasar - Berkomunikasi dengan bahasa Indonesia setara tingkat madya Bernegosiasi bekerja yang menghasilkan dalam konteks - Indikator - Mengemukakan gagasan. perlunya negosiasi. kita akan memahami hal-hal yang berkaitan dengan negosiasi yang baik serta mampu menghasilkan dan melakukan negosiasi. serta argumentasi yang rasional Pada pelajaran ini. persyaratan untuk bernegosiasi yang berhasil. atau komentar dalam kalimat yang menarik dan santun dengan memerhatikan butir-butir yang akan dibahas Menyanggah pendapat orang lain dalam kalimat yang santun dengan tetap menghargai pendapat mitra bicara Meyakinkan mitra bicara untuk menyetujui pendapat pembicara dengan sikap dan kalimat yang cermat. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 185 . serta mencermati dialog yang mencerminkan kegiatan negosiasi. pendapat. Diharapkan setelah mempelajari bab ini. kita diajarkan tentang bernegosiasi mulai dari pengertian negosiasi.

Pemakaian energi alternatif baru dan terbarukan sebagai pengganti BBM perlu dilakukan mengingat cadangan BBM yang makin berkurang. Pemerintah juga dapat memanfaatkan lahan-lahan marjinal di sejumlah daerah sebagai lahan untuk ditanami dengan tanaman sumber energi terbarukan seperti singkong dan tanaman jarak yang merupakan bahan bakunya. Namun. Selain insentif. kata Kusmayanto. Menurut dia. dengan memakai 186 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Biodiesel-Gasohol pengganti BBM Pemakaian energi alternatif perlu diberikan program intensif oleh pemerintah untuk mengurangi penggunaan bahan bakar minyak (BBM). baru-baru ini.Wacana Perlu Intensif Pengembangan. Di negara lain seperti di Austria. Wahono Sumaryono. Nox. “Saya harapkan Presiden mau memberikan insentif untuk mengembangkan energi baru dan terbarukan. Pemakaian gasohol maupun biodiesel mendukung program langit biru karena dapat menurunkan kadar emisi gas berbahaya seperti CO. Berbeda pendapat dengan pakar energi lainnya. bagi mereka yang menggunakan bahan bakar biodisel atau gasohol. Itu sebabnya lebih baik diberikan potongan pajak kendaraan bermotor misalnya. kata Menristek. Sox. di Jakarta. harus diakui bahwa harganya menjadi lebih murah dan persoalan pokoknya bahwa biodiesel maupun gasohol adalah energi terbarukan.” kata Menristek/Kepala Badan Pengkajian dan Penerapan Teknologi (BPPT) Kusmayanto Kadiman pada peluncuran perdana Gasohol BE-10 untuk bahan bakar otomotif. Pemerintah Austria memberikan keringanan pajak dan pemberian voucher kepada pemilik mobil yang menggunakan biodesel sebagai bahan bakar kendaraannya. Kusmayanto mengatakan subsidi Pemerintah terhadap BBM dianggap bukan sebagai faktor penyebab dan energi terbarukan kalah bersaing dengan harga BBM. katanya. mengatakan. dalam pengolahan biodiesel maupun gasohol tetap membutuhkan BBM sehingga bila harga BBM naik. Diputi Bidang Teknologi Agroindustri dan Bioteknologi BPPT. Sementara itu. tidak seperti BBM yang makin habis disedot dari bumi. akan mempengaruhi harga biodiesel maupun gasohol juga. senyawa aromatik dalam bensin serta partikel lembut kurang dari 10um.

katanya.3 juta KL per tahun. bioethanol 10%) mencapai seperlima dari total konsumsi bensin.” kata Wahono. Menristek mencanangkan pemakaian gasohol sebagai bahan bakar pada kendaraan dinas yang digunakan sehari-hari di lingkungan kementeriannya. Menurut Wahono. kata Wahono. Brasil (ethanol murni dan Gasohol-20). Kanada (Gasohol-10). Cina (Gasohol-10). Bahan bakar campuran ini populer disebut gasohol. Ethanol anhydrous 99% atau bioethanol fuel great (FGE) dapat dicampurkan ke dalam bensin hingga 20% sebagai aditif (octane enhancer) ataupun subsitusi bahan bakar otomotif tanpa harus mengubah mesin yang sudah ada. Padahal. katanya. ditemui adanya peningkatan efisiensi pembakaran nilai kalor FGE hanya dua per tiga nilai kalor bensin. Produksi FGE tersebut hanya untuk keperluan uji unjuk kerja otomotif berbahan bakar Gasohol BE-10 yang akan dimasyarakatkan kembali. perlu dikembangkan lahan pertanian seluas 70. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 187 .000 hektar. apabila implementasi Gasohol BE-10 (Gasoline 90%.18 juta KL sebagai crude alchohol kadar 96%. India (gasohol-10). Pemanfaatan gasohol. Dalam peluncuran perdana Gasohol BE-10 itu.energi ramah lingkungan. “Kinerja mesin menyamai penggunaan pertamax. Thailan (Gasohol10). Balai Besar Teknologi Pati BPPT di Lampung telah memproduksi FGE secara dehidradi 50 liter per hari. Agar suplai bahan bakunya (singkong) dapat terjamin. Sayangnya. Peningkatan jumlah produksi dan kualitasnya menjadi FGE akan membutuhkan sedikitnya sembilan pabrik ethanol masing-masing berkapasitas 100 KL per hari. Beberapa negara yang telah lama mengaplikasikan gasohol antara lain Amerika Serikat (Gasohol-10). tidak memerlukan perubahan apa pun paa jaringan atau infrastruktur distribusi BBM. pilot plant Ethanol BPPT berkapasitas 8. Bahan baku Gasohol BE-10 adalah singkong yang diproses menjadi ethanol anhydrous 99% atau bioethanol fuel great (FGE). Menurut Wahono. maka dibutuhkan FGE 0. hingga saat ini belum ada satu pun pabrik ethanol di Indonesia yang mampu memproduksi FGE. Indonesia berpeluang mendapatkan insentif Carbon Credit dari Bank Dunia sebesar 10 dolar AS setiap pengurangan emisi CO2 satu meter kubik seperti yang diatur oleh Protocol Kyoto. kapasitas produksi ethanol saat ini hanya berkisar 0. Dari hasil uji konfirmasi yang dilakukan Balai Termodinamika Motor dan Propulsi BPPT atas unjuk kerja mesin mobil yang berbahan bakar Gasohol BE-10 dan BE-20. katanya.000 liter per hari itu masih dapat ditingkatkan kemampuannya untuk menghasilkan FGE. maupun mesin kendaraan yang ada.

dan keinginan untuk berunding. menghapus subsidi beberapa jenis BBM strategis untuk masyarakat banyak seperti bensin. dan minyak tanah. per liter. Untuk mencapai negosiasi yang menghasilkan.550. 1. selain mengakui kebenaran pendapat yang 188 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . sementara pihak lain berpikiran sebaliknya. dengan itu masyarakat akan mencari alternatif lain pengganti BBM. Padahal BBM merupakan bahan bakar yang tidak dapat diperbarui dan cadangannya sangat terbatas di perut bumi. atau sesuatu yang diingini dianggap sudah benar. (Sumber: Media Akademika. edisi Mei 2005) A. Batu bara misalnya. Menyatakan pendapatnya bahwa dengan harga BBM yang rendah tidak menguntungkan bagi upaya mencari bahan bakar alternatif. Franz Von Magnis Suseno. tentu bukanlah alternatif yang dapat diterima semua pihak.BBM hampir selalu menjadi masalah di semua pemerintahan di dunia apabila harus menaikan harganya. Pengertian Negosiasi Dalam Kamus Besar Bahasa Indonesia (KBBI). Menyakut kenaikan harga BBM dewasa ini. yaitu Rp. perlu adanya penyampaian argumentasi yang kuat dan tak terbantahkan dengan kalimat yang menarik dan santun. Demikian juga menyusul kebijakan ini. untuk kegiatan perusahaan. diharapkan pihak lain. solar. Pihak yang satu merasa konsep. dalam suatu artikelnya di koran terkemuka di Jakarta. Dari pengertian tersebut. SJ. masyarakat akan terdorong menggunakan bahan bakar gas untuk kendaraan karena harga jual gas lebih murah. program. terjadilah negosiasi.DR. gagasan. Dengan adanya perbedaan prinsip tapi berada dalam kepentingan dan tujuan yang sama. dapat kita simpulkan bahwa negosiasi adalah proses yang ditimbulkan oleh adanya unsur dua pihak. Romo Prof. Negosiasi dapat diartikan pula kegiatan yang ditimbulkan oleh keinginan untuk memenangkan kemauan atau kepentingan sendiri karena terhambat oleh kepentingan pihak lain atau adanya pemikiran yang bertolak belakang. Magnis Suseno mengakui. negosiasi adalah: Proses tawar-menawar dengan jalan berunding guna mencapai kesepakatan bersama antara satu pihak dan pihak lainnya. Namun. DR. Melalui kalimat yang menarik dan santun. penyelesaian sengketa secara damai melalui perundingan antara pihak yang bersengketa. perbedaan.

Salah satu pelatihan untuk belajar bernegosiasi ialah seringnya mengikuti rapat-rapat dalam organisasi sekolah seperti OSIS. 1. 6. efektif. Kemampuan bernegosiasi juga diperlukan jika suatu saat kita terlibat dalam kegiatan bernegosiasi. Semua kegiatan biasanya dirancang berdasarkan tujuan serta visi dan misi organisasi tersebut. 3. Bernegosiasi dalam Menyusun Program Kerja Sebuah organisasi pasti memiliki program kerja sebagai acuan kegiatan selama kurun waktu tertentu. atau yang berhubungan dengan hajat orang banyak. 7. Memahami persoalan yang akan dinegosiasikan. kita harus banyak berlatih mengungkapkan pendapat melalui diskusi atau dialog. 5. Di sekolah ada Organisasi Siswa Intra Sekolah (OSIS) yang merupakan wadah seluruh kegiatan siswa terutama kegiatan ekstrakulikuler (ekskul). dan santun Bersikap sabar dan terbuka menerima pendapat orang lain Berupaya meyakinkan mitra bicara tentang penting dan bergunanya hal yang kita negosiasikan secara santun Menghindari sikap menjatuhkan pendapat orang lain Memiliki beberapa alternatif konsep lain yang tak jauh beda bila konsep pertama tak bisa diperjuangkan Di samping itu. OSIS juga mempunyai program kerja yang berkaitan dengan kegiatanBahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 189 . Program kerja berisi rencana-rencana kegiatan yang rutin dan insidental disertai jadwal atau waktu pelaksanaannya. 8. Untuk dapat bernegosiasi dengan baik dan berhasil. Kita harus memiliki kemampuan bernegosiasi untuk berbagai hal yang mungkin perlu dinegosiasikan. seperti untuk kepentingan organisasipekerjaan. beberapa hal berikut yang perlu kita perhatikan.dikemukakan juga tertarik pada penjelasan yang disampaikan sehingga bersepakat. kita akan mudah serta terampil bernegosiasi. B. Dengan seringnya berlatih menyampaikan kalimat yang menarik dan santun. Memiliki informasi dan data tentang persoalan yang akan dinegosiasikan sebagai bahan argumentasi Mengungkapkan gagasan atau pendapat dengan alasan yang rasional Menyampaikan penjelasan dengan kalimat yang menarik. 2. 4.

Hal itu perlu sebab sebuah program kegiatan harus dipahami dulu latar belakang. Jika butuh sebuah perincian. Pada sebuah musyawarah atau perundingan. yang dipimpin langsung oleh Ketua Umum OSIS dengan topik pembicaran merumuskan program kerja 1 tahun. logis. Inilah yang disebut negosiasi. Tak jarang sebuah program atau rencana kerja sebelum pembentukan panitia untuk dilaksanakan. dan tidak berputar-putar sehingga tidak membuat orang salah pengertian. perlu dirundingkan dulu. Tawar-menawar dalam merumuskan sesuatu itu wajar terjadi. kesenian. Bernegosiasi dengan Santun Seperti juga dalam diskusi ada yang menyanggah suatu usulan dan ada yang mendukung. keagamaan. proses bernegosasi harus dilakukan dengan bahasa yang santun. Demikian juga dengan negosiasi. Sebuah program kerja tidak serta merta dibuat dan dapat dilaksanakan. pada akhirnya harus menuju suatu keputusan yang damai dan dapat diterima semua pihak. atau olahraga. Selain itu. Oleh sebab itu. dan ekonomis.kegiatan yang diindukinya. C. tujuan. Ada beberapa ekskul yang dilibatkan. orang-orang yang melaksanakan. sebuah program harus dipelajari dengan cermat apakah rencana kerja atau kegiatan tersebut layak dilaksanakan dan tujuannya sesuai dengan visi dan misi organisasi. Setiap bidang kegiatan pada awal tahun membuat program kegiatan yang selanjutnya akan menjadi agenda/program kerja tahunan OSIS. Sanggahan yang diutarakan juga dengan alasan yang tepat dan dapat menyakinkan orang lain. Dalam perundingan mengenai program kerja. tempat pelaksanaan. kemukakan dengan lugas. Berikut ini contoh proses berdiskusi dan negosiasi dalam merumuskan suatu program kerja. 190 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Pembicaraan alot terjadi ketika membahas kegiatan jambore latgab (latihan gabungan) beberapa bidang ekskul yang dimotori oleh pengurus ekskul pramuka. sasaran. serta biaya yang dikeluarkan. ada program yang diterima ada juga yang tertolak atau perlu direvisi bergantung pada argumentasi pihak pembuat program. pramuka. program kerja juga harus realistis. tetapi harus melalui perundingan dan permufakatan di kalangan pengurus OSIS lainnya. menggunakan ungkapan yang tidak bernuansa konflik. Saat berlangsungnya rapat OSIS SMK Nurul Iman. semua itu harus berakhir pada satu titik pertemuan pandangan yang melahirkan suatu simpulan. Singkatnya. seperti paskibra. Tentunya melalui tawar-menawar antara pengusul program dan pihak yang menolak. PMR.

keikutsertaan seksi Mading menjadi kurang efektif dan tidak pada tempatnya. khususnya PMR dan Paskibra.” ”Saya sependapat dengan Anto.” ”Mohon maaf sekali lagi rekan-rekan. Namun. Tak ada salahnya jika kita mengajak semua bidang ekskul untuk terlibat pada jambore/latgab ini. Mereka mengganggap kegiatan latgab. bukannya saya tidak setuju ada tambahan kelompok peserta latgab yang dalam hal ini seksi Mading. Paskibra. Kami malah berkeinginan semua bidang ekskul terlibat. menurut saya. tentu kita tahu bahwa pada kegiatan ini. Sebagaimana seksi KIR. Berikut cuplikan percakapannya. nanti akan kita rumuskan bersama. latihan gabungan ini jika dilihat dari nama kegiatannya. kita hendaknya tidak memandang pelatihan Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI Anto : (wakil Paskibra) Tari (wakil PMR) : Dwi : (wakil Pramuka) 191 . yaitu mengupayakan adanya kebersamaan di tubuh OSIS dalam bidang apa pun. induk kita adalah sama semua ekskul membawa visi dan misi sekolah kita dan melibatkan para siswa di SMK kita. pihak Pramuka mengizinkan seksi Mading diikutsertakan pada latihan gabungan tersebut. Sebenarnya jika kita cermati tujuan diadakannya latgab ini. kita mengnyinergikan peranan beberapa ekskul yang pada intinya memiliki kesamaan materi yang dipelajari di bidang ekskulnya. jika selama ini Pramuka yang memotori kegiatan latgab sehingga kami yang merencanakan proses kegiatan ini. Ketua OSIS : ”Teman-teman pengurus OSIS. Saya malah menyarankan untuk latgab tahun ini. bidang ekskul. khusus untuk bidang ekskul tertentu saja. Jadi. dalam kegiatan latgab bulan depan. peserta ekskul hanya melibatkan PMR. apakah ada yang ingin menanggapi?” ”Mohon maaf. Masalah butuh pelatihnya.seperti Majalah Dinding (Mading) dan KIR (Karya Ilmiah Remaja). Sebab. yaitu keterampilan psikomotorik. dan pramuka. Jadi tidak semua bidang ekskul pantas menjadi peserta latgab. namun orientasi latihan gabungan ini kan mengarah pada lebih banyak kegiatan yang bersifat pelatihan fisik. Sebelum kita putuskan. tidak setuju.

Namun.ini sebagai bentuk latihan keterampilan untuk fisik saja. Akhirnya. Sekali lagi kami minta maaf. tak ada salahnya bukan?” Tari : (wakil Pramuka) Ketua OSIS : . Ini hanya ingin supaya kegiatan tak harus bernuansa hura-hura. tapi lebih terfokus dan efektif karena OSIS tetap akan mengakomodasi semua kegiatan bidang lainnya pada bentuk kegiatan yang proporsional. Kami akan mengupayakan semaksimal mungkin untuk meringankan beban keuangan OSIS... Kepada Ketua umum OSIS..” ”Baiklah jika pihak Pramuka yang menjadi ”master of job” kegiatan ini menjamin pihak OSIS dan sekolah tidak menjadi susah dalam proses penyelenggarannya. 192 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . OSIS menetapkan kegiatan latgab melibatkan semua bidang ekskul bukan saja Mading dan KIR. menurut saya kita coba saja. bukannya kami bermaksud menyepelekan teman-teman di bidang lain.” ”Apa yang disampaikan Anto tidak salah jika pandangannya lebih mengarah pada proses penyelenggaraan. butuh pelatihan yang bersifat kognitif. Kami mohon tawaran kami ini didukung. Mungkin rekan-rekan di Mading dan KIR dapat memberikan konsep dan keterampilan khusus untuk hal ini.” Anto : (wakil Paskibra) ”Semua yang dikemukakan teman Dwi betul.. kami mohonkan pengertian semua pihak bahwa melibatkan banyak pihak bukan berarti berhura-hura. Tapi. bagaimana perencanaan mengenai akomodasi dan biaya pastilah akan mengalami pembengkakan. namun juga setiap peserta apa pun bidang ekskulnya. kami mencoba ingin adanya kebersamaan yang total di tubuh OSIS.

proses bernegosasi harus dilakukan dengan bahasa santun menggunakan ungkapan yang tidak bernuansa konflik. Tentunya melalui tawar-menawar antara pengusul program dan pihak yang menolak. Sanggahan yang diutarakan juga dengan alasan yang tepat dan dapat menyakinkan orang lain. perbedaan. dan tidak berputar-putar sehingga tidak membuat orang salah pengertian. Bernegosiasi dengan Santun Sebuah musyawarah atau perundingan pada akhirnya harus menuju suatu keputusan yang damai dan dapat diterima semua pihak. Bernegosiasi dalam Menyusun Program Kerja Dalam perundingan mengenai program kerja. Dari pengertian tersebut. Oleh sebab itu. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 193 . Inilah yang disebut negosiasi. C. dan keinginan untuk berunding. Jika butuh sebuah perincian.RANGKUMAN A. dapat kita simpulkan bahwa negosiasi adalah proses yang ditimbulkan oleh adanya unsur dua pihak. kemukakan dengan lugas. ada program yang diterima ada juga yang tertolak atau perlu direvisi bergantung pada argumentasi pihak pembuat program. Tawar-menawar dalam merumuskan sesuatu itu wajar terjadi. B. Pengertian Negosiasi Negosiasi adalah proses tawar-menawar dengan jalan berunding guna mencapai kesepakatan bersama antara satu pihak dengan pihak lainnya.

1. 2. Setiap kelompok yang sudah berpasangan. Guru dapat menilai keaktifan siswa dalam kegiatan ini. masing-masing akan menjadi pihak ke. Seluruh siswa dalam kelompok diharapkan berlatih untuk mengemukakan pendapat dan menghargai pendapat pihak lain dengan santun. tapi pihak kedua tak setuju karena akan menggangu persiapan menghadapi ujian. 4.1 dan pihak ke-2 yang akan bernegosiasi. Sekolah akan membuat peraturan bahwa siswa dilarang membawa HP ke sekolah. Setiap kelompok dipasangkan dengan kelompok lainnya sehingga ada 4 kelompok berpasangan. Pihak ke-1 setuju. Lakukanlah kegiatan negosiasi dengan persoalan berikut ini. seksi Acara. tapi pihak ke-2 tidak setuju dengan alasan masing-masing. Untuk mengisi acara. 194 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . 3. Pihak pertama setuju acara pelepasan kelas XII diadakan di luar sekolah. Terjadi pro dan kontra. Pihak ke-1 setuju. Sekolah akan mengadakan pentas seni dalam rangka HUT sekolah. pihak kedua berpendapat di dalam sekolah saja dengan bentuk acara hiburan atau panggung. pihak pertama setuju karena punya pengalaman. Mengenai keterlibatan kelas XII dalam ekskul dan perlombaan antarsekolah. Hal ini lalu diserahkan ke siswa untuk dimusyawarahkan. tapi pihak ke-2 tak setuju dengan argumentasi masing-masing. merencanakan salah satunya mengundang penyanyi dangdut selain group band. Setiap kelompok yang berpasangan memilih permasalahan di atas dan dikembangkan menjadi sebuah persoalan yang menuntut negosiasi.TUGAS KELOMPOK Bagilah kelas menjadi 8 kelompok.

yang tidak selayaknya Anda lakukan adalah a. 3. menerima dengan sikap positif a. menyampaikan pendapat dengan kalimat yang menarik c. b. orang yang bernegosiasi harus melakukan persiapan. menyadari bahwa pihak Anda memang masih banyak kekurangan d. mengusahakan jalan pintas yang licik Berikut ini pernyataan yang tidak benar dalam bernegosiasi adalah a. d. Jika dalam suatu negosiasi. dan perseteruan. Orang yang bernegosiasi harus mematuhi aturan. e.UJI KOMPETENSI I. Pakailah segala cara untuk memenangkan negosiasi. logis d. mendalam Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2. menyampaikan pendapat dengan argumentasi yang benar Penyampaian negosiasi memenuhi kriteria berikut. lugas b. percekcokan. menyampaikan pendapat yang dapat menyakinkan mitra bicara. pihak Anda tidak memenangkan negosiasi. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! 1. sistematis e. menyampaikan pendapat dengan kalimat yang santun d. menyampaikan pendapat dengan ucapan-ucapan licik e. Usaha berdiskusi. subjektif c. tidak berdebat dan hindari pula konfrontasi. menghargai keputusan yang telah disepakati c. Orang yang bernegosiasi harus saling menghormati. Sebelum bernegosiasi. b. kecuali a. 4. memperjuangkannya lagi di lain kesempatan b. c. Pernyataan yang tidak tepat dalam penyampaian pendapat dalam negosiasi adalah a. 195 .

kecuali a. mudah dipahami e. sesuai dengan harapan c.5. membutuhkan banyak pihak yang terlibat 6. negoi + iasi Program kerja harus bersifat realistis. tidak sulit dilakukan e. negasi + asi b. tidak memerlukan biaya besar c. tidak membutuhkan anggaran d. pemurah c. mudah dicerna akal c. membutuhkan biaya banyak b. 10. 8. dapat dipertanggungjawabkan d. supel b. maksudnya a. luwes Kata negosiasi berasal dari bentukan a. tidak masuk akal 196 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . 9. dapat menghasilkan uang Program kerja harus bersifat logis. terampil bicara e. nego + siasi e. tidak bertentangan dengan kenyataan Program kerja harus bersifat ekonomis. dapat dicerna akal b. maksudnya a. negoi + asi d. Ungkapan bernuansa konflik yang harus dihindari adalah di bawah ini. negasi + iasi c. Seorang negosiator harus mempunyai sifat berikut. dapat diwujudkan secara nyata e. sesuai dengan keadaan b. uraiannya tidak berbelit-belit d. terpecaya d. kecuali a. 7. maksudnya a.

Menolak pertunjukan dangdut. memilih kata yang baik c. Alasan saudara Joni. saya menolak pendapat Saudara Nita tentang lagu dangdut yang terkesan kampungan. b. 14. menghargai mitra bicara b. e. lagu dangdut sangat merakyat dan syairnya pun diambil dari kehidupan sehari-hari. Maaf saudara Nita. acara hiburan sekaligus penutupan. 13. Tetapi. c. sambutan kepala sekolah. kecuali a. Ragu-ragu dalam mengadakan pertunjukan dangdut. mencabut hak bicara bagi yang menolak 12. banyak negatif 11. mustahil dilakukan e. Saya sependapat bahwa musik dangdut itu vulgar. Urutan acara sambutan a.b. Saya menolak pendapat Saudara Joni tentang musik dangdut. Kesatuan sebuah ungkapan harus didasarkan pada pertimbangan di bawah ini. tidak benar sama sekali c. Kesimpulan rapat dari panitia pelepasan siswa kelas 3 SMK Jaya Bakti … a. c. d. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 197 . boleh–boleh saja d. menyusun perencanaan lain d. Maaf Saudara Dini. dangdut merupakan khas Indonesia. Menyetujui diadakan pertunjukan dangdut. Tidak boleh diadakannya pertunjukan dangdut sebab terlalu vulgar. Contoh tanggapan yang santun dalam kalimat diskusi a. menyanggah pendapat lain e. d. bahwa musik dangdut itu murahan. Saya tidak terima dengan tanggapan Saudara. tanggapan lagu dangdut saya terima. e. b. Pembukaan oleh panitia.

pramuka. diganti d. dan penutup. Pembukaan oleh panitia. sambutan kepala sekolah. tak mau kalah d. Dalam diskusi “Narkoba”. semangat e. pembukaan oleh panitia. dan penutup. d. dan penutup. seseorang peseta mempertahankan pendapatnya.b. arif b. dan keagamaaan b. acara hiburan. kecuali a. dan latihan upacara bendera e. Dalam menyampaikan alasan bernegosiasi. sambutan oleh panitia. tahukah narkoba sangat merugikan. Ungkapan yang santun adalah a. tata tertib sekolah. Sambutan kepala sekolah. Program kegiatan biasanya dibuat untuk hal–hal yang berkaitan dengan a. pentas seni. paskibraka. hiburan. ditinjau ulang 17. diperlukan sikap-sikap ini. keamanan sekolah. kebersihan sekolah. c. e. acara hiburan. direvisi c. pentas seni. acara hiburan. Saudara-saudara semua. upacara bendera. kebersihan sekolah. Negosiasi mengupayakan agar sebuah program kerja atau usulan tidak dibuat seperti di bawah ini. dan tata tertib sekolah d. 15. sabar c. kecuali a. dan pembayaran uang sekolah c. ditolak e. penuh pengertian 18. Pembukaan oleh kepala sekolah. kelompok belajar dan paduan suara 16. berdoa. Oleh 198 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Berdoa yang dibawakan oleh guru agama. diterima b.

3.b. bercakap-cakap c. agenda kerja c. 4. kegiatan penyuluhan narkoba perlu kita lakukan sebab memiliki efek yang positif untuk penyalahgunaan Narkoba. Proses tawar-menawar dengan jalan berunding guna mencapai kesepakatan bersama antara satu pihak (kelompok atau organisasi) dan pihak (kelompok atau organisasi) yang lain disebut … a. 2. dong. pedoman kerja e. Jawablah soal-soal di bawah ini dengan tepat dan benar! 1. negosiasi e. Jelaskan apa yang dimaksud negosiasi! Syarat apa yang harus dimiliki oleh seorang negosiator? Apa yang dimaksud dengan program kerja? Bagaimana cara menyanggah yang santun? Mengapa kita harus bernegosiasi dengan santun? Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 199 . c. Sebuah rumusan yang merupakan acuan untuk pelaksanaan sebuah pekerjaan/kegiatan disebut a. sebab itu. jadwal kerja b. narkoba mesti kita berantas! Saudara-saudara. e. diskusi d. 19. tanya jawab b. Saudara-saudara harus paham. Saudara-saudara. 5. kalau kegiatan ini ditolak. hasil kerja 20. d. kegiatan narkoba oke banget! Saudara-saudara harus maklum. program kerja d. harus dicegah. debat II. berarti Saudara semua bandar narkoba.

Amatilah perbincangan rapat OSIS SMK Nurul Iman pada materi pelajaran ini. Lalu jawablah soal-soal di bawah ini! 6. 7. 8. 9. Apakah inti permasalahan dalam rapat tersebut? Apakah bahasa yang digunakan cukup santun dan tidak menyinggung perasaan orang lain? Apakah gagasan/ide disampaikan secara logis? Apakah alasan diikutsertakannya ekskul Mading dan KIR dalam latihan gabungan?

10. Bagaimana hasil keputusan rapat tersebut?

200

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

BAB 11 MENYAMPAIKAN LAPORAN ATAU PRESENTASI LISAN DALAM KONTEKS BEKERJA

Standar Kompetensi Kompetensi Dasar

-

Berkomunikasi dengan bahasa Indonesia setara tingkat madya Menyampaikan laporan atau presentasi lisan dalam konteks bekerja

-

Indikator

-

-

Menyampaikan fakta (dalam tuturan deskriptif, naratif, dan ekspositoris) yang berkenaan dengan keadaan atau peristiwa yang dilaporkan Menyampaikan keadaan atau peristiwa secara kronologis (dalam tuturan deskriptif/naratif/ekspositoris) sesuai dengan tuntutan keadaan atau peristiwa yang dilaporkan secara lisan Menyampaikan rangkuman (kategorisasi) atau simpulan (analisis/sintesis) dengan benar

Pada bab ini, kita akan belajar tentang laporan dan cara menyajikannya secara lisan. Sebelumnya, akan dibahas mengenai sistematika laporan, pola dan contoh laporan deskripsi, narasi, dan eksposisi. Dengan mempelajari materi ini, kita diharapkan dapat membuat laporan dan dapat menyajikannya secara lisan sesuai dengan sifat laporan. Selain itu, kita juga diharapkan mampu membuat rangkuman dan simpulan laporan dengan benar.

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

201

Wacana Makanan Unik dari Yogyakarta
Yogyakarta sebagai daerah istimewa memang selalu menjadi salah satu tujuan wisata yang ramai dikunjungi oleh para wisatawan baik lokal maupun luar negeri. Di samping memiliki ciri khas kebudayaan keraton yang masih kental, banyak hal yang bisa diamati di Yogyakarta yang belum tentu ada di wilayah lain, misalnya keanekaragaman jenis makanan daerahnya. Jika kita ke Yogyakarta, yang biasanya teringat di benak kita adalah gudeg yogya, bakpia patok, atau makanan lesehan yang terdapat di sepanjang Jalan Malioboro. Sebenarnya selain dari dua makanan khas yang terkenal dari Yogya dan penyajian ala lesehan itu, ada juga makanan lain yang terasa unik didengar dan masih asing di telinga kebanyakan orang yang bukan penduduk Yogyakarta. Makanan itu disebut dengan “sego kucing” atau nasi kucing. Mendengar nasi kucing, yang terbayang adalah nasi yang biasa diberikan untuk kucing. Lalu mengapa dijual? Siapa yang mau makan nasi buat kucing? Rupanya ini hanya istilah. Bagi yang pernah tinggal di Yogyakarta, sudah tak asing lagi dengan yang namanya nasi kucing. Nasi bungkus dengan lauk-pauk sambal teri, oseng-oseng tempe, dan bandeng goreng ini biasanya disantap dengan tambahan lauk sate atau makanan gorengan seperti tahu susur (tahu isi), tempe goreng tepung, bakwan tauge, dan tahu atau tempe bacem. Di Yogya, nasi kucing merupakan santapan ‘wajib’ mahasiswa sebab harganya yang murah. Umumnya, mahasiswa yang sering terlambat menerima kiriman uang dari orang tuanya harus hidup berhemat. Salah satu pos penghematan adalah biaya konsumsi atau makan. Maka, nasi kucing pun sering menjadi pilihan. Karena porsinya kecil, nasi kucing ini cukup mengenyangkan dan sangat cocok disantap pada malam hari. Biasanya malam hari jarang orang yang makan banyak. Sebungkus nasi kucing ditambah sate dan minumannya hanya dihargai Rp 3.000. Lauk sate yang tersedia bermacam-macam, yaitu sate babat, sate kepala, sate sayap, sate telur puyuh, sate ati, sate ampela, sate usus, dan sate daging sapi. Semua sate tersebut diberi bumbu bacem sehingga terasa manis. Minuman yang tersedia untuk mengiringi santapan nasi kucing juga bermacam-macam seperti es jerman (jeruk manis), es tehquila (es teh manis), es tarik (es teh susu), dan kopi jos. Jenis minuman terakhir ini cukup unik, 202
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

baik rasa maupun cara membuatnya. Segelas kopi panas disiapkan lalu dimasukkan sebongkah bara arang. Kabarnya, minuman ini berkhasiat menghilangkan racun di dalam tubuh. Selain nasi kucing, ada lagi makanan unik di kawasan Pasar Tradisional Jejeran, Plered, Yogyakarta, jalan raya arah Yogyakarta ke Imogiri. Di tempat itu, terdapat warung makan tradisional yang sangat terkenal. Warung tersebut hanya berukuran 3 x 4 meter, namun pengunjungnya sangat banyak, apalagi jika malam hari. Mobil-mobil plat B dan L berderet memenuhi marka jalan di depan Pasar Jejeran. Di pasar ini, ada warung makan yang menjual sate klatak, yaitu sate kambing yang dibakar dengan arang pohon asam, tanpa dibumbui kecap atau bumbu kacang layaknya sate yang kita kenal selama ini. Sate klatak dibakar tanpa bumbu, namun memiliki aroma rasa yang natural dan gurih. Untuk menciptakan rasa gurih, sebelum dibakar, daging terlebih dahulu dicelup ke dalam kuah kaldu daging kambing. Selain itu, sate klatak harus dibuat dari daging kambing muda. Makanan khas dan unik juga terdapat di Klebengan, Selokan Mataram, sebelah utara Kampus Fakultas Kedokteran Hewan UGM. Tepatnya di sebuah resto yang dulunya kantin kampus dan sekarang bernama Resto SGPC Bu Wiryo. SGPC singkatan dari Sego Pecel khas Bu Wiryo yang begitu sangat terkenal di kalangan mahasiswa UGM. Bahkan saking terkenalnya, banyak alumni UGM dari berbagai daerah yang kini sudah banyak yang menjadi pejabat, saat bertandang ke Yogyakarta, menyempatkan mampir bersama keluarganya ke Resto SGPC Bu Wiryo. Resto ini tetap mempunyai rasa yang khas seperti saat menjadi kantin kampus dulu, tak pernah berubah dengan harga yang tetap murah dan menu yang unik. Ada menu SDSB (Sop Daging Sayur Bayem), Sop Tanpa Kawat (Sop Tanpa So’un), Sop Bubrah (sop yang diberi bumbu kacang pecel), Sop Tanpa Truk (sop tanpa kubis/ Kol), Pecel Keramas (nasi pecel diberi kuah sop), Pecel Pancasila (Pecel dengan telur puyuh lima buah), Pecel Diuwel-uwel (pecel dibungkus), dan yang agak baru ada menu SBY (sop bayem). Demikian juga minumannya, ada Teh Mrengut (teh kental), Teh Kemulan (teh hangat), dan Teh Sengkuni (teh dicampur jeruk). Anda tertarik untuk mencobanya?
(Sumber: Berita Kota, Januari 2008 dan Majalah Kewirausahaan & Keuangan, Desember 2007)

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

203

A. Pengertian Laporan
Laporan adalah suatu cara komunikasi yang berisi informasi sebagai hasil dari sebuah tanggung jawab yang dibebankan kepada pembuatnya. Dengan kata lain, sebuah dokumentasi yang berisi fakta-fakta dari hasil penyelidikan suatu masalah sebagai bahan acuan pemikiran, penilaian serta tindakan. Laporan lebih banyak disampaikan dalam bentuk tertulis dan juga bisa disampaikan secara lisan. Laporan berguna untuk: (1) (2) (3) (4) (5) (6) (7) alat pertanggungjawaban secara tertulis pendokumentasian data bahan pertimbangan acuan pengambilan keputusan alat merumuskan suatu penilaian bahan evaluasi melatih berpikir sistematis

Baik berbentuk tulisan maupun lisan, kriteria penyampaian laporan yang baik dilihat dari tiga hal berikut. (1) Isi laporan mencakup kelengkapan fakta, data yang akurat, faktual, dan objektif. (2) Penyajian mencakup penggunaan bahasa yang baik, jelas dan tepat, sistematik serta menarik (3) Penyajian lisan harus disampaikan dengan vokal yang jelas, pengucapan, lafal, intonasi yang tepat dan gaya ekspresif yang sesuai. Sebelum laporan disajikan secara lisan, laporan terlebih dahulu disusun dalam bentuk tertulis secara sistematis sehingga mudah dipahami. Dari segi bentuk tertulis, laporan terbagi menjadi seperti berikut. (1) Laporan berbentuk formulir, yaitu laporan yang tinggal mengisi pada blangko yang disediakan. (2) Laporan berbentuk memorandum, yaitu laporan yang diuraikan secara singkat. Laporan ini dibuat dalam rangka proses hubungan kerja antara atasan dan bawahan atau antar-unsur-unsur dalam suatu instansi. 3. Laporan berbentuk surat, yaitu laporan yang diuraikan lebih panjang dari memorandum sebagaimana uraian dalam bentuk surat biasa. Jenis laporan ini dapat dipergunakan untuk bermacam-macam topik. 204
Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI

dan laporan percobaan. daftar grafik (jika ada) g. simpulan dan saran. berisi uraian pembahasan tentang masalah atau objek yang dilaporkan serta hasil yang dicapai i. dan sebagainya h. Laporan formal biasanya dibuat untuk keperluan formal seperti dalam ruang lingkup pekerjaan atau pendidikan. ialah laporan perjalanan. dan umumnya bersifat berkala. yaitu jika laporan tidak memenuhi persyaratan sistematika di atas. (5) Laporan berbentuk buku. Contoh laporan formal ialah laporan tentang keadaan dan perkembangan proyek yang sedang dilaksanakan. Yang termasuk laporan informal. kata pengantar d. yaitu laporan yang struktur penulisannya lengkap. yaitu laporan yang disusun dalam bentuk buku. laporan terbagi seperti berikut (1) Laporan formal. pendahuluan. daftar isi e.. biasanya disusun seperti makalah. daftar tabel (jika ada) f. Dari segi struktur penulisan. (2) Laporan informal. Materi laporan dibagi menjadi beberapa topik dan subtopik. laporan pengamatan. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 205 . laporan penelitian ilmiah. ruang lingkup masalah/objek. Pembuatannya lebih cenderung memenuhi kebutuhan informasi atau untuk mendapatkan data lapangan. Sistematika atau struktur penulisannya lebih sederhana atau memiliki model sistematika sendiri dan tidak bersifat standar. berisi hal-hal pokok atau intisari dari pembahasan laporan serta penyampaian keinginan pelapor terhadap hal-hal yang berkaitan dengan laporan yang belum atau seharusnya ada.(4) Laporan berbentuk naskah. yaitu laporan yang panjang. tujuan. Laporan formal sangat terikat dengan struktur penulisan. bagian isi. terdiri atas: a. berisi latar belakang. halaman pengesahan c. dan laporan kunjungan. pembatasan masalah/objek. halaman judul b.

Desa ini dapat dicapai dari Denpasar dalam waktu 2. laporan ini dituntut harus faktual (berdasarkan yang ada). Pola penyajian laporan bersifat narasi lebih menekankan uraian secara kronologis. laporan peliputan peristiwa. Isi laporan bersifat penceritaan atau pemaparan peristiwa tentang objek yang dilaporkan. laporan pertanggungjawaban uraian pekerjaan yang menggunakan tahapan. yaitu berdasarkan rangkaian waktu. Pola Penyajian Laporan secara Lisan Baik laporan formal maupun informal disusun dengan menggunakan bahasa yang baku. Yang termasuk laporan bersifat ekspositoris adalah laporan penelitian. 78 kilometer sebelah timur Denpasar adalah desa tempat asal salak bali. why: mengapa dan how: bagaimana). dan sebagainya. Berikut adalah contoh-contoh laporan berbentuk narasi. dan ekspositoris Contoh laporan narasi berupa laporan perjalanan Sibetan. Oleh sebab itu. Oleh sebab itu. pengungkapan informasinya bermuatan 5 W + I H (what: apa. Terletak di ketinggian 350550 m dari permukaan laut. laporan percobaan. tempat. Lain lagi dengan pola penyajian laporan bersifat deskripsi. laporan kunjungan. laporan observasi. atau pemaparan mengenai tahapantahapan perkembangan objek yang dilaporkan.5 jam melalui Padang Bai-Amlapura dengan ongkos Rp 2. Sisa 206 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Kabupaten Karang Asem. deskripsi. aktual berkaitan realita dengan kejadian yang baru terjadi. Kendaraan umum dari Denpasar memang hanya sampai Amlapura. dan ekspositoris. bentuk uraian laporan dapat disajikan dengan pola penyajian narasi. proses kejadian. Yang termasuk laporan ini misalnya. deskripsi. where: dimana.B. Laporan ini bersifat pengungkapan fakta pada sebuah peristiwa atau keadaan. when: kapan. Sebagaimana sebuah berita. Pola penyajian laporan bersifat ekspositoris berupa uraian yang berisi langkah-langkah kerja. dan sebagainya. Laporan yang telah disusun bisa juga disampaikan secara lisan. dan laporan berita (reportase). akurat berdasarkan bukti-bukti yang dapat dipertanggungjawabkan dan objektif (apa adanya). laporan perjalanan. dan bentuk fisik serta ciri-ciri objek yang dilaporkan. Laporan ini lebih terfokus pada penggambaran mengenai lokasi. who: siapa.000. Yang termasuk laporan deskripsi ialah laporan pengamatan.

menjadi licin dan lengket. Iklimnya termasuk basah dengan curah hujan rata-rata 2. tepat pukul 07. Sibetan bisa dicapai dalam waktu lebih singkat kalau kita mengambil jalur Denpasar-Klungkung-Besakih. pada kesempatan itu meminta agar pemerintah menetapkan tanggal 12 Mei sebagai hari antikekerasan. Di Kota Rendang. Waktu Trubus ke sana. kebetulan hujan tidak turun sehingga walaupun jalan tanah di desa itu naik-turun. dan pimpinan kampus melakukan pengibaran bendera setengah tiang sebagai bentuk berkabung masyarakat Trisakti atas meninggalnya empat mahasiswa pada 12 Mei 1998 itu. acara dimulai dengan pengibaran bendera setengah tiang. setelah menempuh perjalanan selama tiga jam melalui Padang Bai-Amlapura. Thoby Mutis. Udara terasa sejuk meskipun siang itu matahari bersinar terik. dosen. ”Saya ingin setiap tanggal 12 Mei dijadikan Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 207 . Dihadiri seluruh masyarakat Trisakti. Rektor Universitas Trisakti. Selain itu. kendaraan umum Rendang-Selat hampir tidak ada sehingga memang lebih mudah datang ke Sibetan melalui Padang Bai-Amlapura. terlihat rumah para petani. setahun ada tujuh bulan basah (Oktober-April) dan lima bulan kering (Mei-September). Dalam situasi normal. Tanah seperti ini kalau disiram air. Sayang kan. Jenis tanahnya latosol cokelat kemerah-merahan. tetapi tidak licin. Sebenarnya. dia juga berharap nama besar yang disandang empat mahasiswa Trisakti sebagai tokoh reformasi dapat dipertahankan oleh mahasiswa Trisakti lain.145 mm/tahun dan jumlah hari hujan 84 hari. Contoh laporan narasi berupa laporan liputan peristiwa Ratusan civitas akademika Universitas Trisakti kemarin memperingati sembilan tahun Tragedi Trisakti. Topografinya berbukit-bukit. Kondisi lingkungan Sibetan memang cocok untuk salak. kita turun dan menyambung perjalanan ke selat. Trubus tiba di Sibetan pukul 14.30 WIB. Upacara tersebut bertempat di pelataran parkir depan Gedung Sjarif Thajeb yang berada di depan Monumen Tragedi 12 Mei. karyawan.00 WITA. Para mahasiswa.000. Hari Senin.perjalanan sejauh 14 kilometer ke Sibetan diteruskan dengan angkutan umum Isuzu hijau dengan ongkos Rp 5. Di kiri kanan jalan yang menanjak dan berkelok-kelok terlihat hamparan kebun salak dan di tengah-tengah kebun.

yakni di bawah pohon besar yang cukup rimbun. tepat pukul 09. Seluruh masyarakat Trisakti yang hadir dalam upacara berpakaian hitam-putih. Adapun inti peringatan sudah dilakukan sejak Rabu (09/5) lalu. Di Sungai Cikampak yang deras arusnya.sebagai Hari Antikekerasan. Air panas ini berada di jalur Sungai Cikampak. Setelah selesai upacara. Yang agak terlindung pun ada. kita harus berjalan kaki menyeberangi sungai dengan panjatan batu-batu besar. dilakukan acara tabur bunga di depan Monumen Tragedi 12 Mei dan napak tilas tragedi 12 Mei 1998 dengan dilanjutkan acara sarasehan nasional. Di tempat itu. Sungai itu tidak dalam. tetapi hanyut dilanda banjir. Presiden BEM Trisakti.00 WIB. 208 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Ahmad Gauzul Alam mengatakan upacara yang dilakukan kemarin sebagai bentuk seremonial belaka. Ada pula jembatan bambu dibangun yang biasa digunakan untuk menyeberang orang per orang. Ada bagian-bagian tertentu yang sudah bebas dari batu yang dapat dipergunakan untuk mandi bagai di kolam renang. (Dari: Seputar Indonesia. ” ujarnya. Dulu. Mandi dengan bebas tanpa rasa sungkan.” ujar Thoby. tetapi tak membahayakan dan panas airnya. Untuk mencapai tempat itu. kita bisa mandi secara bebas. Tempat rekreasi di Cipanas memang ramah terhadap alam. kulit bisa mengelupas. Lihatlah anak-anak bermain dengan air sangat ceria. kita sejak Rabu kemarin telah melakukan peringatan. Gadis-gadis dengan kain melilit di tubuhnya bercanda dengan sesama atau rombongan keluarga turun bersama-sama ke air panas. pernah dibangun jembatan. Asal jangan di tempat yang terlalu dekat dengan sumber air panas karena bila kita lakukan. tetapi arusnya deras karena berbatu. Minggu 13 Mei 2007) Contoh laporan deskripsi pengamatan terhadap lokasi wisata Mandi dan Berobat di Alam Perawan Cisolok Cipanas berciri khas air panas yang memancar setinggi kira-kira 3 meter. ”Ini hanya seremonial saja. Sementara para mahasiswa dilengkapi juga dengan jaket almamater biru tua. ada bangunan permanen yang dapat digunakan menginap tanpa biaya jika misalnya kebetulan banjir. di beberapa tempat juga ada air panas memancar tetapi lebih rendah. Selain pancarannya yang tinggi itu.

(Aklis/Ami). Dukun yang ke sini dengan membawa rombongan pasien. Juga bisa digunakan untuk ruang ganti pakaian. orang bisa memasak air di atas air. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 209 . pedesaan. Bila kembali ke Jakarta. air panas Cipanas. Demikian keterangan salah penunggu warung di sana. Bustal sendiri sering tinggal di rumah yang dibangun khusus untuk film di kawasan itu. Melihat kadar panasnya air. Kita tinggal menaruh panci di atas batu yang di bawahnya memancar air panas atau kalau mau kita juga bisa merebus telur di atas air panas itu dalam waktu singkat.” kata Bustal Nawawi. Bahkan. Ada yang datang pertama digendong. dan sejenisnya. Kawasan wisata ini menarik karena alamnya murni dan benar-benar masih pedesaan. Di sudut lokasi dekat tempat parkir. Masih ada monyet-monyet bergelantungan di pohon di atas bukit. Cisolok memang layak mengundang kita. gatal-gatal. Penyakit mereka biasanya rematik. Banyak orang Jakarta atau Bandung datang kemari hanya untuk berobat. dan udara nyaman alam tropis yang masih perawan. memang memungkinkan kawasan itu selain untuk rekreasi juga untuk berobat. ”Sayang belum pernah diselidiki apakah air itu bisa lebih berfungsi sebagai sarana pengobatan. Hari Minggu di Cipanas adalah hari ceria sambil berobat. produser film Nagabonar yang selam tiga bulan syuting di sana. dua bulan kemudian sudah bisa datang sendiri. bila musim kebetulan datang. ketika siang sudah berlalu atau sore sudah tiba. Di sana ada kesegaran. Menurut penduduk setempat. mandi air hangat di alam yang bebas terbuka. dibangun sebuah rumah sederhana terbuat dari papan. Memang itulah yang terkesan. Di dalamnya ada bak-bak air panas. di tengah perjalanan kita bisa beli oleh-oleh: pisang atau durian. keceriaan. yang datang kemari juga dukun atau tabib yang mengobati pasiennya.Di sini. Cisolok itu mengandung belerang atau setidaknya dianggap berkhasiat bisa menyembuhkan penyakit. Di sana juga untuk mandi orang yang berobat. Banyak orang sakit ke sini untuk mandi dan mereka sembuh. Kadang ada juga babi yang nyasar lalu diburu oleh penduduk.

Setelah sawah bersih dari jerami. Salah satu program kampanye hemat energi itu ialah mencari sumber energi alternatif yang sebanyak-banyaknya. Sebaiknya gumpalan-gumpalan briket itu jangan terlalu besar supaya mudah menyala. Apakah briket dapat menjadi energi alternatif sebagai pengganti bahan bakar khususnya untuk memasak? Kemudian. Akan lebih baik apabila tungku tersebut dilengkapi dengan alat pengukur panas sehingga kita dapat memantau suhu setiap saat. kita siapkan tungku yang terbuat dari tanah liat. Oleh sebab itu. briket batu bara yang sudah kita siapkan dimasukkan ke dalam tungku tersebut. Briket terbuat dari batu bara. saluran air yang berfungsi untuk menyiram tanaman. Selanjutnya. 210 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Penyewaan sawah dilakukan selama satu kali tanam tembakau. Contoh laporan ekspositoris berupa percobaan (eksperimen) Bahan bakar minyak (BBM) termasuk jenis energi yang tidak bisa diperbaharui. Maka. Tungku itu dapat kita buat dalam bentuk seperti sarang tawon. kotak. Tanah yang sudah ditraktor harus digemburkan lagi dengan cangkul. Siapkan bahan-bahan yang akan kita masak.Contoh laporan ekspositoris tahapan (proses) Tembakau sebagai bahan baku rokok termasuk tanaman perkebunan. Pengolahan dari sawah menjadi ladang mengalami beberapa tahap. kemudian tungku tersebut dinyalakan dan kita tinggal menunggu sampai masak. Tahap selanjutnya tanah harus digemburkan dengan traktor atau cangkul sementara membuat bibit tembakau mulai dilakukan. Perkebunan menyewa sawah petani setelah masa panen padi. Pihak PT. kemudian diteliti dan diadakan percobaan pemakaian bahan bakar briket. Percobaannya adalah sebagai berikut Pertama-tama. Pemerintah dalam berbagai kesempatan selalu mengampanyekan program hemat energi. Untuk itu perlu digalakkan berbagai percobaan untuk menemukan energi alternatif itu. diujicobalah bahan bakar briket tersebut. Tanaman tembakau ditanam pada tanah ladang/sawah kering. dibuatlah got. atau multi tungku yang dapat dipakai untuk memasak beberapa panci sekaligus.

Menyampaikan pengantar sekilas tentang latar belakang pembuatan laporan Menyampaikan proses memperoleh bahan laporan Memberikan gambaran secara umum tentang sistematika laporan Menyampaikan isi laporan dengan bahasa yang baik. diperoleh kesimpulan bahwa satu kilogram briket dapat dipakai untuk memasak 4. Untuk menyampaikan laporan secara lisan. 3. hal-hal yang perlu diperhatikan. 1. Dari pembahasan atau uraian yang ada pada isi laporan. perpaduan Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 211 . dan efektif Memberikan penekanan pada uraian mengenai fakta jika berbentuk laporan naratif dan deskriptif Memberikan penekanan pada alur proses atau tahapan jika laporan berbentuk ekspositoris C. 5. simpulan merupakan uraian singkat yang diwarnai oleh pandangan dan penilaian dari si pembuat laporan.Berdasarkan hasil beberapa kali percobaan memasak dengan briket batu bara ini. formal. Laporan yang sudah disusun dapat disampaikan secara lisan atau dipresentasikan. Sebelum menyajikan laporan secara lisan. Ini berarti kita bisa menghemat lebih dari 75% apabila dibandingkan dengan menggunakan bahan bakar minyak. Memberi tahu jenis laporan yang akan disampaikan. Simpulan dapat dibuat berdasarkan suatu analisis dari materi laporan. ada penjelasan tentang hasil yang dicapai. 2. 6.5 liter air. 4. Selain menyajikan rangkuman sebuah laporan dapat pula membuat simpulannya. Penyajian dalam bentuk rangkuman berupa uraian hal-hal pokok saja atau bentuk garis besarnya saja namun tetap tersusun secara sistematis. Menyampaikan Rangkuman dan Simpulan Laporan Di dalam setiap laporan. Berbeda dengan rangkuman. yaitu seperti berikut. Seberapa besar hasil itu harus disampaikan? Penjelasan tentang hasil masih merupakan bagian isi laporan. dibuatlah suatu rangkuman dan simpulan mengenai hal yang dilaporkan. laporan dapat disusun terlebih dahulu secara tertulis. 7.

Pengertian Laporan Laporan adalah suatu cara komunikasi yang berisi informasi sebagai hasil dari sebuah tanggung jawab yang dibebankan kepada pembuatnya. Pihak-pihak tersebut misalnya para dewan legislatif dan eksekutif supaya memberikan arahan dan rencana pembangunan yang lebih berpihak pada sektor pertanian. Tentunya sebelum menyampaian laporan. Contoh simpulan sebuah laporan Berdasarkan hasil penelitian ini. (1) guna laporan (2) kriteria penyampaian laporan (3) jenis/bentuk-bentuk laporan 212 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Akhirnya. si pembuat laporan harus memahami beberapa hal berikut. dan dapat juga berbentuk kategori (pengelompokan) unsur-unsur yang dilaporkan yang memiliki ciri yang sama. itu semua tetap mengacu pada tujuan dan apa yang harus dicapai oleh pembuat laporan serta tuntutan dari yang menerima laporan. diharapkan penelitian ini mampu memberikan penyadaran pada masyarakat dan dapat menjadi masukan untuk pihak-pihak yang berwenang memberikan kebijakan. dapat dipastikan hasil produkdi pertanian akan makin berkurang sehingga negara pun akan mengimpor beras. RANGKUMAN A. dapat disimpulkan bahwa ada beberapa faktor yang menyebabkan para petani melakukan mobilisasi sosial menjadi perajin. terutama masyarakat miskin pedesaan. Untuk membuat sebuah laporan yang baik. terlebih dahulu laporan disusun dalam bentuk rangkuman atau simpulan. Semua itu bergantung pada permintaan dan kebutuhan.(sintesis) dari beberapa aspek yang dilaporkan. Namun. Jika tidak ada suatu program penyadaran baik dari pemerintah maupun masyarakat setempat. Laporan dapat pula disampaikan hanya berbentuk rangkuman atau simpulannya.

lalu lakukan perjalanan ke tempat tertentu yang dianggap berkesan. deskripsi. TUGAS KELOMPOK Bentuklah kelompok terdiri atas 4 orang. Presentasikanlah di depan kelas! Kelompok lain diminta mengomentari atau memberi tanggapan. notula d. UJI KOMPETENSI I. 213 . diolah. dan disajikan secara tertulis disebut a. dapat berbentuk objek wisata. Menyampaikan Rangkuman dan Simpulan Laporan Penjelasan tentang hasil masih merupakan bagian isi laporan. Dari pembahasan atau uraian yang ada pada isi laporan. susunlah laporannya dalam bentuk narasi. dan ekspositoris. dibuatlah suatu rangkuman dan simpulan mengenai hal yang dilaporkan. rangkuman Berikut ini hal–hal yang berkaitan dengan laporan.B. museum. Oleh sebab itu. industri kecil. menggunakan peralatan tertentu Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2. Buat pula rangkuman atau simpulannya. dibuat dalam jangka waktu tertentu b. Kemudian. bentuk uraian laporan dapat disajikan dengan pola penyajian narasi. atau eksposisi. C. simpulan b. artikel c. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! Keterangan atau informasi yang dikumpulkan. dan lainlain. 1. laporan e. tempat pembuatan kerajinan tangan. Laporan yang telah disusun bisa juga disampaikan secara lisan. Pola Penyajian Laporan Secara Lisan Baik laporan formal maupun informal disusun dengan menggunakan bahasa yang baku. deskripsi. kecuali a.

kecuali a. mencatat sumbe –sumber informasi membanding–bandingkan sumber informasi dibuat dalam jangka waktu yang lama Suatu laporan yang baik harus memenuhi mutu berikut ini. d. 3. jelas e. cermat b. menciptakan dokumen yang dapat dijadikan bahan studi c. deskripsi b. eksposisi e. 6. 5. argumentasi e. persuasi c. narasi d. persuasi 4.c. deskripsi d. 214 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . sederhana Berikut ini yang bukan merupakan kegunaan membuat laporan adalah a. eksposisi c. melatih kita untuk selalu bertujuan d. argumentasi b. tepat waktu c. e. menciptakan bahan diskusi kemasyarakatan Tulisan yang bertujuan menceritakan peristiwa atau pengalaman manusia berdasarkan perkembangannya dari waktu ke waktu agar pembaca terkesan disebut karangan a. memudahkan kita dalam berpikir e. populer d. melatih kita untuk berbuat cermat b. narasi Tulisan yang bertujuan menggambarkan sejelas–jelasnya suatu objek sehingga pembaca seolaholah mengalami sendiri suatu yang di gambarkan itu disebut karangan a.

b. penilaian 9. lisan b. tulisan c. ringkasan d. tulisan c. laporan tugas d. Salah satu bentuk laporan lisan ialah a. melainkan langsung menyajikan inti masalah serta berbagai pemecahannya. kecuali a. d. ringkasan d. Menyajikan bagian-bagian yang dianggap penting dan penyajian tidak perlu mempertahankan urutan karangan yang asli. kecuali a. a dan b benar e. laporan kunjungan b. 10. akurat c. e. persuasif d. laporan berita c. Dari segi materi laporan bersifat berikut ini. c benar Laporan dapat dijadikan bahan acuan membuat hal di bawah ini. pemikiran e. faktual e. c. Laporan dapat dibuat atau disampaikan secara a. Uraian di atas menjelaskan ciri-ciri a.7. laporan observasi Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 215 . lengkap b. a. laporan perjalanan e. b. notula laporan karangan simpulan artikel 8. kebijakan b. penilaian 11.

elespresi 16. umum khusus dan khusus-umum e. e. Di Aceh telah terjadi bencana alam Tsunami. Tahun 2009. proses 13. tulisan menyajikan fakta nonverbal lisan verbal e. umum-khusus b. Di bawah ini yang tergolong laporan berupa fakta ialah a. b. tulisan dapat berbentuk surat dan lisan reportase d. Dalam mengahadapi ujian nasional. kecuali a. intonasi c. akan dilaksanakan pemilihan umum. audit d. Laporan deskriptif terdapat pada laporan a. d. khusus-umum c. kecuali a. naratif dan khusus-umum 15. Ciri-ciri kalimat deduktif ialah a. 216 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Kita diharapkan berperan aktif memberantas penyebaran virus flu burung. tulisan lengkap dan lisan pokoknya saja b. siswa diajak mengikuti acara istighosah.12. tulisan memuat perincian dan lisan dapat berupa rangkuman 14. naratif d. kegiatan e. Perbedaan laporan bentuk tulisan dan lisan adalah berikut ini. Kapan Bapak ke luar negeri? c. tulisan terstruktur dan lisan sederhana c. dokumentasi e. vokal d. Hal-hal yang dinilai dalam penyampaikan secara lisan ialah di bawah ini. pengamatan c. perjalanan b. lafal b.

makna bukan sebenarnya c. korban d. pengunaan bahasa yang aktif. Teknik pengumpulan data dimulai dengan cara a. makna konotasi e. e. Di bawah ini hal yang disampaikan pada laporan tentang banjir. Judul–daftar isi–kata pengantar–bab pendahuluan– bab pembahasan–kesimpulan Judul–daftar isi–bab pendahuluan–bab pembahasan–bab penutup–kesimpulan 18. Urutan bagian-bagian karya tulis berupa laporan yang menggunakan sistematika yang benar adalah a. dan ragam resmi 20.17. dan bahasa baku e. proses evakuasi korban 19. Judul–kata pengantar–daftar isi–bab pendahuluan–bab penutup–kesimpulan c. lokasi b. makna sebenarnya b. sistematika. menarik. Makna denotasi adalah makna a. sistematika. menyebarkan angket. gambaran suasana e. cermat. menarik. majalah. sistematika. kata-katanya bermakna denotasi. makna mengandung dua arti Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 217 . makna rancu d. Judul–bab pendahuluan–kata pengantar–daftar isi bab penutup–kesimpulan b. Judul–kata pengantar–daftar isi–bab pendahuluan–bab pembahasan–bab–penutup d. wawancara. dan ragam bahasa resmi d. dan surat kabar b. kecuali a. pelaku c. c.

Kapan laporan dibuat? 218 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Jawablah soal-soal di bawah ini dengan tepat dan benar! 1. 9. 6. 7.II. 5. Apakah yang dimaksud dengan laporan? Bagaimanakah syarat menyampaikan laporan secara lisan? Jelaskan pengertian laporan deskriptif! Sebutkan hal-hal yang harus diperhatikan ketika menyusun laporan! Jelaskan apa yang dimaksud dengan kesimpulan! Buatlah contoh kalimat induktif! Apa perbedaan induktif dan deduktif? Buatlah contoh kalimat deduktif! Sebutkan cara menyusun laporan yang baik! 10. 8. 3. 2. 4.

unsur-unsur. dan argumentatif naratif. ciri-ciri. eksposisi. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 219 . DESKRIPTIF. eksposisi. deskripsi. diharapkan kita dapat membuat tulisan bercorak narasi.BAB 12 MEMBUAT WACANA BERCORAK NARATIF. serta contoh tulisan. - Indikator - Menulis suatu kejadian dalam bentuk narasi serta memuat unsur-unsur yang melingkupinya secara kronologis Membuat deskripsi dari gambar/bagan/tabel/grafik/ diagram/matriks yang dilihat atau didengar sepanjang 150-200 kata dalam waktu 30 menit Membuat eksposisi dari suatu peristiwa Menyusun argumentasi dengan tujuan untuk meyakinkan pembaca tentang suatu peristiwa kerja agar menerima suatu sikap dan opini secara logis Bab ini membahas materi tentang wacana bercorak narasi. dan argumentasi termasuk pengertian. EKSPOSITORIS DAN ARGUMENTATIF Standar Kompetensi Kompetensi Dasar - Berkomunikasi dengan bahasa indonesia setara tingkat madya Menulis wacana bercorak ekspositoris. Setelah pembelajaran. tahapan penulisan. dan argumentasi dengan tepat. deskriptif. deskripsi.

di Indonesia. sejak Ibanez-Camacho dari Meksiko melakukan penelitian.3% mineral. Di Vietnam. Buah naga yang sudah matang warnanya merah menyala. disandingkan dengan kaktus. mulai dibudidayakan. thang loy (buah naga) atau dragon fruit memiliki khasiat untuk kesehatan. Thailand. opuntia ficus-indica yang masih pipih seperti daun. Namun masih sebatas hiasan. nopalitos juga menurunkan kadar lemak dan kolesterol darah. Dan kini mulai dikembangkan di tanah air. tanaman ini kemudian dikembangkan di Israel. dan 1. Setelah dibuang duri dan tunas daunnya yang. dunia kedokteran tahu. Pada tahun 1979. juga disebabkan tanaman ini masih tergolong jenis baru. 220 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Tanaman nopalitos ini dapat menurunkan kadar gula darah pada penderita diabetes yang tidak bergantung pada insulin. Buah naga atau biasa disebut dragon fruit. pencegah kolesterol tinggi. Inilah yang menjaga kesehatan orang Indian Amerika Selatan dan Meksiko. buah naga dipromosikan sebagai penyeimbang kadar gula darah. serta memiliki peluang besar untuk disebarluaskan. dan Australia. ia merupakan sumber vitamin beta karoten (18-30 mg tiap 100 g bobot sayuran) dan vitamin C (10-18 mg tiap 100 g bobot sayur). Di Indonesia. khususnya diperkampungan di Pulau Jawa. Selain itu. Walaupun nilai gizinya sama dengan jenis-jenis sayuran lain. terkenal mujarab menurunkan kadar gula darah dan kolesterol. sayur nopalitos bisa dimasak termasuk sebagai salad dan sop daging. Nopalitos adalah pucuk tunas cabang kaktus prickly pear. dan pencegah kanker usus. bahwa nopalitos berkhasiat menurunkan kadar gula.Wacana Menghisap Khasiat Buah Naga Warga keturunan Tionghoa beranggapan bahwa buah naga membawa berkah. Dalam perkembangannya. 3-7% karbohidrat. buah naga berasal dari Meksiko. terutama kalsium). Selain masih sedikit yang menanamnya. Tidak mengherankan jika buah ini diletakkan di antara dua ekor patung naga hijau yang diletakkan di atas meja altar. Konon disebut buah naga karena seluruh batangnya yang menjulur panjang seperti ular naga. seperti daun selada (90% air. Dalam berbagai pameran buah-buahan pada tahun 1999.

Jenis buah naga ada empat macam. Bagian bawah tiang dibuatkan kaki-kaki tiang. mengobati hypertensi. dan buah naga kulit kuning daging putih (Selenicerius megalanthus). 5. dan ikat bibit tersebut agar tidak mudah roboh. 3. 2. biarkan semalam. Untuk penyeimbang kadar gula darah. Setelah itu. Mencegah kanker usus. 4. Basahi permukaan media dengan sedikit Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 221 . pertama buah naga daging putih (Hylocereus undatus). Campur merata. pasir. dan obat keluhan keputihan. masukkan ke dalam pot hingga 80% volumenya. yang nantinya dimasukkan pada bagian ujung tiang. pulas dengan aspal agar tak gampang keropos. buah naga daging merah (Hylocereus polyrhizus). dibentuk trapesium dengan ukuran 30 cm. memperhalus kulit wajah. beri besi tegak lurus sepanjang 30 cm. Sebaiknya. beli bibit dari penangkar tanaman buah naga. Buatlah tiang setinggi 200 cm. Bagian atas tiang dibuatkan piringan diameter 40 cm. menurunkan kadar lemak. Pilih yang kuat dari besi beton berdiameter 8-10 cm. sementara bagian tengahnya diberi besi dipasang bersilang. Seperti biasa. Pada pertemuan silangan. Seluruh tiang panjatan diberi sabut kelapa yang diikatkan. Cara Menanam Buah Naga di Pot Bagaimana cara menciptakan tabulampot buah naga? Langkah pertama. sediakan pot. Setelah itu. 6. Pilih bibit stek batang sepanjang 60 cm dengan diameter 7 cm. Mengobati sembelit. serta sebagai bahan kosmetik. Meningkatkan daya tahan. bubuk bata merah. menguatkan fungsi ginjal dan tulang. Panjang kaki tiang 35 cm. tekan media di sekitar bibit agar padat. menguatkan daya kerja otak. Setelah itu. pelindung kesehatan mulut. Pilih pot dari tanah liat berdiameter sekitar 40-50 cm. Mujarab menurunkan kolesterol. buat 3 lubang tanam dalam pot dengan kedalaman 10 cm dan diameter 6 cm. dan kompos (1 : 2 : 2 : 3 : 1). meningkatkan ketajaman mata. pupuk kandang. Siram sampai basah. Berilah air. sediakan pula media tanam berupa campuran tanah. buah naga daging supermerah (Hylocereus costaricensis). pencegah kanker. Setelah ditanam. Tambah dolomit 100 gram/pot dan pupuk hortigo 20 gram/pot. Pencegah pendarahan. sediakan tiang panjatan. Khasiat Buah Naga: 1.

a setiap unsurnya harus memiliki kesatuan dan kepaduan. Tujuan ini berkaitan dengan bentuk atau model isi wacana. Sebelum menulis wacana. baik lisan maupun tulisan. Langkah terakhir. yang artinya antara lain ”Kemampuan untuk maju menurut urutan-urutan yang teratur dan semestinya. Hal itu dibuat sebagai pedoman agar karangan dapat terarah dengan memperlihatkan pembagian unsur-unsur karangan yang berkaitan dengan tema. Setiap wacana memiliki tema sebab tema merupakan hal yang diceritakan atau diuraikan sepanjang isi wacana. 1. Tema wacana akan diungkapkan dalam corak atau jenis tulisan seperti apa itu bergantung pada tujuan dan keinginan si penulis. Edisi 05.” Jadi.” Pengertian lain. terarah dan tidak menyimpang ke mana-mana. 222 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Kerangka karangan bermanfaat sebagai berikut. pangkal batang peka terhadap genangan air. Pedoman agar penulisan dapat teratur dan terarah. Dalam wacan. Tak lama. terutama pada pagi hari. yaitu ”Komunikasi buah pikiran. Penggambaran pola susunan dan kaitan antara ide-ide pokok/topik. 2. Mungkin itu yang membuatnya jadi makin dicari orang. penulis dapat mengadakan berbagai perubahan susunan menuju ke pola yang sempurna.air. (Sumber : Tunas. seseorang harus terlebih dahulu menentukan tema. setelah itu baru tujuan. 17-30 November 2007) A. Anda pun akan menikmati indahnya tabulampot buah naga. Topik-topik itu disusun secara sistematis. Sebab. dan bisa mematikan. Membuat kerangka karangan sangat dianjurkan sebelum penulisan. yang resmi dan teratur. Tema menjadi acuan atau ruang lingkup agar isi wacana teratur. terutama bagi pengarang pemula. Setelah menetapkan tujuan. Pengertian Wacana Wacana berasal dari bahasa Inggris discourse. Membantu pengarang melihat adanya pokok bahasan yang menyimpang dari topik dan adanya ide pokok yang sama. Usahakan jangan sampai air menggenangi pangkal batang. Dengan itu. penulis akan membuat kerangka karangan yang terdiri atas topik-topik yang merupakan penjabaran dari tema. letakkan buah naga di pot di lokasi yang mendapat sinar matahari. 3. wacana dapat diartikan adalah sebuah tulisan yang teratur menurut urut-urutan yang semestinya atau logis.

2.4. 3. Jumlah Pemudik Lebaran Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI Contoh kerangka topik 223 . Berikut contoh kedua bentuk penyusunan kerangka karangan tersebut. meskipun yang lebih banyak digunakan adalah kerangka topik. Kerangka topik. 4. Agar penyusunan kerangka karangan dapat efektif menjadi acuan pembuatan karangan. Kerangka kalimat. Masuknya ajaran komputer di sekolah-sekolah menambah pengetahuan tentang teknologi informasi. Menjadi gambaran secara umum struktur ide karangan sehingga membantu pengumpulan bahan-bahan pustaka yang diperlukan. 1. (1) (2) (3) (4) (5) (6) Menentukan tema/topik karangan Menjabarkan tema ke dalam topik-topik/subtema Mengembangkan topik-topik menjadi subtopik Menginvestaris sub-sub topik Menyeleksi topik dan sub-subtopik yang cocok Menentukan pola pengembangan karangan Kerangka karangan dapat ditulis dalam dua bentuk. Memanfaatkan minat remaja dan anak sekolah dengan membuka warnet. Antisipasi lonjakan arus mudik lebaran : 1. Contoh kerangka kalimat: Membuka usaha warnet di tengah perkembangan teknologi informasi. berikut. langkah yang mesti ditempuh oleh pengarang untuk menyusun kerangka karangan adalah seperti berikut. Perkembangan sarana komputer menjadi sarana jaringan informasi melalui internet. 1. Penyusunan kerangka karangan dapat berbentuk kalimat dan frasa atau klausa sekaligus. Penggunaan internet menjadi kebutuhan remaja dan anak sekolah. ialah kerangka karangan yang disusun dalam bentuk kalimat-kalimat lengkap yang menjabarkan ide-ide pokok karangan. ialah kerangka karangan yang dituangkan dalam bentuk frasa dan klausa sehingga tampak lebih praktis. 2.

B. keesokan harinya. alur/plot. Narasi seperti ini disebut dengan narasi ekspositoris. Penggunaan kata hubung yang menyatakan waktu atau urutan. 224 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . konflik. dan suasana. otobiografi/riwayat hidup seseorang yang ditulisnya sendiri. seperti lalu. atau setahun kemudian kerap dipergunakan. jalur selatan c. Unsur-unsur penting dalam sebuah narasi adalah: (1) (2) (3) (4) (5) kejadian. argumentatif. b. dari instansi terkait 3. 2. perkiraan lonjakan jumlah pemudik sarana angkutan yang dipersiapkan sarana angkutan yang diandalkan Pengaturan jalur Jakarta-Surabaya a. kemacetan lalu lintas dan usaha pencegahannya Petunjuk pemanfaatan jalur a. tokoh.a. Narasi diuraikan dalam bentuk penceritaan yang ditandai oleh adanya uraian secara kronologis (urutan waktu). deskripsi. selanjutnya. Narasi dapat berisi fakta. 1. Narasi ini disebut dengan narasi imajinatif. latar yang terdiri atas latar waktu. Narasi bisa juga berisi cerita khayal/fiksi atau rekaan seperti yang biasanya terdapat pada cerita novel atau cerpen. tempat. misalnya biografi (riwayat seseorang). wacana dibedakan menjadi wacana narasi. dan persuasi. Jenis-Jenis Wacana Berdasarkan bentuk atau jenisnya. c. Narasi Narasi adalah cerita yang didasarkan pada urut-urutan suatu kejadian atau peristiwa. atau kisah pengalaman. dari DLLAJR b. eksposisi. jalur utara b.

rumah saya belum dilewati oleh bus kota jurusan Bukit Besar. cerita sejarah. 6. 2. 5. terpaksa saya turun di simpang empat lampu merah Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 225 . Saat itu. 4. dekat dengan PT Pupuk Sriwijaya (Pusri). Jadi. kisah perjalanan. novel. 3. Rumah saya berada di daerah Bukit Besar sehingga membutuhkan waktu lebih kurang 45 menit untuk pergi dari rumah ataupun pulang dari dinas. dan sebagainya. (5) mengembangkan kerangka menjadi karangan.Tahapan menulis narasi. persiapan keberangkatan perjalanan menuju stasiun Kota tiba di tempat tujuan mengamati peninggalan zaman penjajahan Belanda berkumpul kembali di depan ”Meriam Jagur” persiapan pulang (1) (2) (3) (4) Contoh narasi ekspositoris: Minta Tolong Malah Dikira Hantu Pocong Kejadian yang menggelikan sekaligus menegangkan ini terjadi pada pertengahan bulan Juli 1993. roman. Penyajian berdasarkan urutan waktu adalah urutan yang didasarkan pada tahapan-tahapan peristiwa atau kejadian. karena rute bus kota pada waktu itu hanya sampai di dekat wilayah Kembang Manis. menentukan tema cerita menentukan tujuan mendaftarkan topik atau gagasan pokok menyusun gagasan pokok menjadi kerangka karangan secara kronologis atau urutan waktu. yaitu sebagai berikut. Pola urutan waktu ini sering digunakan pada cerpen. Kerangka karangan yang bersifat naratif dapat dikembangkan dengan pola urutan waktu. ketika saya baru masuk bekerja di sebuah klinik yang terletak di daerah Lemabang. Contoh: Kunjungan ke Museum Fatahillah 1.

serta suara wanita menangis. Bahkan satu orang dari mereka nekat memanjat pagar rumah orang lain untuk menyelamatkan diri. tunggu. Dalam hati saya berkata. ada pocong . (Dikutip dari Republika....” Setelah saya sampai di rumah dan menceritakan semuanya kepada anggota keluarga. pocong. Setelah melihat baju dinas berwarna putih yang saya kenakan. Sebab. kekhawatiran saya agaknya terobati karena dari kejauhan saya melihat tiga orang lelaki yang tampaknya juga baru pulang dari kerja dan jalannya searah denganku. setelah mendengar itu saya sendiri malah tambah ketakutan. kirain ada pocong beneran. Akibatnya.. ada pocong . Mas!” Tapi bukannya mendekat. tiga lelaki itu tambah kencang sehingga tidak terkejar lagi oleh saya. saya juga sangat takut dengan yang namanya setan atau semacamnya. mendekat saja orang takut kepada saya. tiap kebagian jadwal dinas siang lagi. ”Tolooong . Orang-orang yang lewat sering diganggu kuntilanak. Sejak kejadian itu.. Kapten Arivai. ”Sialan. Bahkan seorang keponakan saya memanggil saya dengan sebutan ’Tante Pocong’. spontan mereka tertawa terbahak-bahak. Ahad. saat pulang malam saya tidak pernah memakai baju putih lagi.. jalanan sangat sepi dan gelap karena wilayah yang saya lewati adalah TPU (Tempat Pemakaman Umum) dan wilayahnya juga masih banyak hutan serta lampu jalan belum dipasang.!” Karena saya orang yang agak telmi (telat mikir). Tetapi. Jangankan mendapat kawan. saya baru sadar ternyata yang mereka kira pocong adalah saya.. Malam itu.Jl. ”Mas . cukup jauh dari rumah untuk berjalan pulang. Tanpa pikir panjang langsung saja saya berlari mendekati dan memanggil mereka.. makin saya mendekat. Mas .. 25 Maret 2007) 226 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . saya sangat takut berjalan pulang ke rumah sendirian.. Tetapi. Apalagi kawasan yang saya lewati merupakan daerah rawan dan angker. Ternyata yang disangka pocong itu aku. mereka malah berlari dan berteriak ketakutan...

ternyata aku memang diperlakukan ’istimewa’ oleh majikanku. Sungguh julukan inilah yang menjadi ’beban’ bagiku karena banyak orang menyalahgunakan ’arti’ keabadianku selama ini! Keabadianku mereka samakan dengan ’cinta abadi’. Tersusun rapi di atas lemari belajarnya.. novel. aku sering disebut tanaman sejenis perdu. Hidupku bergerombolan di ujung dahan dengan harum yang khas.. aku sangat resah dengan label hitam yang bertulisakan ”Cinta Abadi” yang melekat manis di atas plastik kotak ini. apalah arti protesku? Toh.. Oleh kalangan Botani. majalah remaja dan . Bungaku istimewa. Biasanya aku tumbuh di dataran tinggi atau puncak-puncak gunung. berlapiskan plastik transparan. Tapi. Bungaku kecil sebesar bunga rumput. dan termasuk anggota famili Compositae atau disebut juga Asteraceae (sambung-sambungan). Tinggi batangku dapat mencapai lima meter dengan daun-daun runcing dan lurus. Ah . Ya . siapa yang perduli dengan rintihanku. cinta sepasang manusia yang tidak memiliki ikatan resmi. Yap! Untuk mengenang siapa yang memberikannya! Aku memang lebih beruntung dari bunga mawar yang menjadi pendatang baru di kamar ini. di antara bunga-bunga milik Rieska. mekarku abadi sehingga dijuluki ”bunga abadi”.. dan anggrek yang merana karena sebagian kelopak bunganya telah mengering. bunga-bunga koleksi Rieska! Tempatnya sengaja disimpan Rieska. tak pernah layu. Aku sangat senang dengan perlakuan baik Rieska. ***** Aku berada di kamar Rieska.Contoh narasi imajinatif : NAMAKU EDELWEISS Namaku Edelwiss alias Anaphalis javanica. Orang lebih mengenalku dengan warna putih daripada warna lainnya. lengkap dengan spora yang masih menempel di tubuhnya. Rieska! Aku ditaruh di dalam kotak berwarna biru muda. Wajahnya pucat karena air di dalam vasnya tak pernah diganti Rieska. ***** Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 227 . Sama halnya dengan nasib suplir yang telah mengering menjadi pembatas buku.. Di sampingku ada diktat kuliah..

ya. Mereka seharusnya berpikir andai tidak ada mawar. Allah sengaja menciptakan duri-duri kecil di batangku untuk menjaga kehormatanku dari serangan makhluk yang jahil agar tidak mudah dipetik begitu saja.. ***** Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 228 .. Apa itu namanya dunia nggak terbalik ?” sahut suplir yang dulunya tinggal di teras depan rumah Bayu pacar Reiska yang ketiga.... sekarang memang zaman edan. wangi yang merebak. ”Tapi. anggrek. itu kan pikiran kalian saja kalau aku bahagia ada di sini. Mereka seharusnya menjaga kita dengan baik. Weis. kalian bisa saja. dan seharusnya manusia yang melihat ’keabadianku’ sebagai contoh bagaimana mengabadikan hatinya sebagai rasa syukur ke hadirat Illahi.. ”Ah.” ujarku pelan. mencontohkan kita! Indah tapi tak mudah diraih. bagaimana? Dunia pasti suram tanpa penyejuk mata. suplir yang segar atau anggrek yang . eh . Jawa barat. Dan kamu juga hidup di tepi jurang sehingga diperlukan perjuangan bagi yang ingin memetikmu. Beda kalau ada kita... mereka akan merasa senang dan tenteram bila memandang si mawar yang sedang mekar. benar kan memang kamu anak emas! Apa karena kamu pemberian Ari pacar Rieska anak gunung itu?! Kali ini suara supir dari balik buku angkat bicara. kamu tidak perlu ganti-ganti air seperti aku!” ujar anggrek. benar aku memang anak emas Reiska. Lihat bungaku... Ya. atau bunga lainnya. Ia mangambilku ketika dia mendaki gunung gunung Ceremai. sebenarnya aku nggak terlalu bahagia kok tinggal di sini!” ujarku. ”Ah sudahlah .” suaraku pelan. enam bulan lalu.. yang pria berjas rapi menutup seluruh aurat..”Kamu beruntung. berwarna merah menawan. Weis tempatmu terempuk!” komentar mawar suatu hari saat Rieska berngkat kuliah ”Iya . ”Kok bisa? Mengapa?” tanya mawar keheranan. Weis. mataku mulai berkaca-kaca menahan air mata yang hampir tertumpah. ”Aku ingin sekali Reiska menyadari keberadaan kita.. Seharusnya manusia menyadari hal itu... wanitanya berpakaian seksi minim bahan.” ”Ah .. Aku diberikan kepada Reiska tepat pada ulang tahun ke-22. seharusnya manusia belajar dari fenomena alam seperti kita. ”Kamu benar. Bukankah Allah menciptakan mereka untuk menjadi Khalifah di muka bumi ini? Manusia seharusnya menyayangi dan merawat kita. suplir. Reiska seharusnya berpikir ada apa di balik kekuasaan Allah yang telah menciptakan kita.

” terdengar suara Reiska di ruang tamu. aku nggak mau.. ”Nggak. aku nggak mau.. Tapi terlambat! Edelweis telah dibuang ke dalam tong sampah dan bercampur dengan sampai lainnya. harus! Titik!” ”Eh .. suplir. ya. ”Aku .. Reiska berjalan dengan tergesa menuju meja belajarnya.. meraih kotak mungil yang disimpannya dengan penuh kasih sayang selama ini.!!” teriak mawar. ”I .. ini anak kamu. Ari!” ”Hah? Kamu hamil?” tanya Arif kaget.. ini di luar dugaannya. ”Tidak! Aku tidak mau menikah sekarang! Kamu harus menggugurkan kandunganmu!” ”Arif.. aku . mungkin saja ini anakmu dengan pacar kamu yang lain!”cibir Arif.. kawan-kawan. Rina dan Shanti pergi ke pesta pernikahan relasi papanya.ngan.... dulu bunga Edelweis kalau cintamu bukan cinta abadi.. ”Nggak tahu.. Arif anak kita!” ”Pokoknya tidak! Kamu harus menggugurkan. tidak seperti biasanya yah? Mungkin .. mama dan papa serta kedua kakaknya. Telat . ada yang ingin kukatakan. Bunga lainnya... aku .. suplier dan anggrek serempak. kita harus segera menikah. ****** Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 229 ........ dan anggrek menjerit histeris ! ”Ja. mil. atau berantem sama papa dan mamanya. ”Arif .. ”Ada apa?” tanya Arif..... tapi cinta murahan! Ngakunya cinta. mereka berdua duduk di kursi sofa empuk..”Arif . Reiska kenapa yah?” tanyaku pada mereka... ini anak kita! Kamu harus bertanggung jawab!” teriak Reiska bercampur tangis.”tebak anggrek.. tapi mengapa kamu tinggalkan aku dalam keadaan ini?” tangis Reiska sambil membuka kotak mungil itu lalu membuang seluruh bunga Edelweis ke dalam tempat sampah yang berada tepat di samping meja belajar.. ”Percuma kamu berikan itu. Malam itu hanya mereka berdua yang ada di rumah. teganya kamu bicara begitu.. mawar. Arif aku takut papa dan mama akan marah!” ujar Reiska gusar... ha . Reiska ribut dengan Arif. Tiba-tiba...

perincian... satu lagi telah Kau-tunjukkan kebesaranMu menciptakan bunga Edelweis yang tahan layu dan tak lelah diterpa angin. Aku.” lirih suara Rahman menyejukkan hatiku. yaitu sebagai berikut. (Sumber: Majalah Sabili. Edelweis. tersenyum bahagia dalam genggamannya. Ia mengamatiku dari tadi sambil terus berzikir memuji asma Allah.. perasaan dan pengalaman penulisnya. merasakan. ”Ya. Deskripsi adalah karangan yang menggambarkan suatu objek berdasarkan hasil pengamatan. tanpa memudar dan tanpa kekeringan. deskripsi dibedakan atas 2 macam. dan mengalami sendiri obyek tersebut.Namaku Edelwies alias Anaphalis javanica. dan pengalaman penulis sehingga seolah-olah pembaca yang melihat. Kali ini aku berada dalam genggaman seorang pemuda bernama Rahman. perasaan. 10 April 2003) 2. Ya. tapi aku merasakan betapa ia seorang pemuda yang berhasil mengenali alamnya dan terus berzikir melihat keesaan Penciptanya. penulis deskripsi merinci objek dengan kesan. Allah. dan citraan. seperti inikah semangat Saudara-saudaraku di Palestina dalam menghadapi serangan Tentara Yahudi demi merebut kembali hak mereka atas masjid Al-Aqsa? Ya . Tujuannya adalah pembaca memperoleh kesan atau citraan sesuai dengan pengamatan.Rabb yang Maha Kuasa. kuatkanlah hati-hati kami untuk merebut itu semua. fakta. Deskripsi Imajinatif/Impresionis ialah deskripsi yang menggambarkan objek benda sesuai kesan/imajinasi si penulis. Aku hanya tumbuhan tanpa nyawa.. Dilihat dari sifat objeknya. Deskripsi Kata deskripsi berasal dari bahasa latin discribere yang berarti gambaran. 230 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Untuk mencapai kesan yang sempurna..Rabb. atau pembeberan.. a. Biasanya aku tumbuh di dataran tinggi atau puncak-puncak gunung.

Di luar hujan masih saja turun dengan derasnya. daripada melamun tidak menentu. Di atas ruangan. (Dikutip dari wacana berjudul Banjir. kantuk hebat datang. mirip dengan ruangan diskusi. Belum lagi selesai kalimat yang sedang kubaca. Ramadhan Syukur dalam buku: Menulis secara Populer. kunyalakan kembali lampu belajar dan mulai membaca sambil duduk bersandar di kursi. karya Ismail Marahimin. Bau asap tembakau memenuhi ruangan itu. di dekatnya beberapa jendela kaca. Padahal besok aku harus bangun lebih pagi. yang menyebabkan ruangan ini cukup terang. Di sebelah kananku ada sebuah pintu. Kami semua duduk di kursi yang diatur membentuk sebuah lingkaran. ****** Aku tidak lagi berada di kamarku. Angin yang menerobos masuk melalui kisi-kisi terasa dingin menusuk kulit. masing-masing terdiri atas empat jendela. Ada dua baris jendela kaca. tapi tak seorang pun yang kelihatan peduli. tidak ada apa-apa di sana. 2001) Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 231 . ada empat pasang lampu neon 40 watt. Semua tampak duduk tenang. buku yang kupegang terlepas dari tangan.Contoh deskripsi Impresionistis dalam sebuah cerita: Jam dinding kamar menunjukkan pukul sepuluh lewat sembilan belas menit. Warna hijau muda dinding itu sudah perlu dilebur kembali. Malah terasa suasana persis seperti di ruang kuliah. Akhirnya. kuputuskan akan melanjutkan membaca. memang. Agak menolong. ****** Tidak ada yang ganjil terlihat. di sana-sini kelihatan coret-coretan tangan-tangan jahil. tergantung di langitlangit. Tiba-tiba kantuk hebat datang menyerang. Aku kembali ke meja belajar. Dinding sebelah kiri kosong. semua kelihatan sedang menulis. dan tidak seorang pun yang kelihatan peduli pada orang lain di ruangan itu. tetapi di suatu ruangan bersama-sama dengan sekelompok orang yang sama sekali belum pernah kulihat sebelumnya. Piama yang melekat di tubuhku tidak banyak membantu menahan dingin sehingga agar lebih hangat kepakai lagi jaket tebal. oleh. Akan tetapi.

beberapa helai kertas berserakan dan buku-buku dalam keadaan terbuka. agak ke atas. yaitu: (1) (2) (3) (4) (5) 232 menentukan objek pengamatan menentukan tujuan mengadakan pengamatan dan mengumpulkan bahan menyusun kerangka karangan mengembangkan kerangka menjadi karangan. tanda pengenalnya tertera di pintu. 2001) Kita dapat membuat karangan deskripsi secara tidak langsung. Tunggu aku!” ****** Di sebelah kiri pintu tergantung sebuah penanggalan dan sebuah cermin yang bertuliskan ”Anda manis. Write Your Massage! Pada note book itu kubaca pesan untukku. Apa saja yang tergambarkan dalam bentuk visual tersebut dapat menjadi bahan atau fakta yang akurat untuk dipaparkan dalam karangan deskripsi karena unsur dasar karangan ini adalah pengamatan terhadap suatu objek yang dapat dilihat atau dirasakan.” Di bawahnya merapat sebuah meja belajar yang diberi alas kertas berbungabunga merah jambu. masih di pintu itu. ini dia kamar yang kucari. Sebuah note book kecil dijepitkan pada kotak itu. Di atas meja ada sebuah tape recorder kecil. pikirku. dan lain-lain. ****** (Sumber: “Kamar Sebuah Asrama. dalam buku Menulis Secara Populer. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Tahapan menulis karangan deskripsi.b. grafik. ”Masuk saja. yaitu dengan mengamati informasi dalam bentuk nonverbal berupa gambar. Pasti semalam dia habis mengerjakan paper. Rat. karya Ismail Marahimin. Tepat di depan mataku. Deskripsi faktual/ekspositoris ialah deskripsi yang menggambar kan objek berdasarkan urutan logika atau fakta-fakta yang dilihat. kunci dalam kotak ini. diagram.” oleh Ni Made Tuti Marhaeni. jam weker. dengan sebuah perintah dalam bahasa Inggris. Contoh deskripsi faktual dalam sebuah cerita: Lantai tiga kamar nomor tiga-nol-lima. Nona. dan dilapisi lagi dengan plastik bening. sebuah mesin ketik. alat-alat tulis. Benar. ada sebuah kotak kecil warna merah jambu.

Biasanya bentuk karangannya deskriptif. atau depan ke belakang.Pengembangan kerangka karangan bercorak deskriptif dapat berupa penyajian parsial atau tempat. sedangkan sisanya sebanyak 1.630 Pemutihan 1.630 bangunan yang tidak memiliki izin mendirikan bangunan. Kampung Melayu 2. dapat kita lihat bahwa pada tahun 2006. Data Kasus Pelanggaran Izin Bangunan di DKI Jakarta No. Di antaranya 749 bangunan dibongkar. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 233 .888 (Sumber: Republika. Contoh: Laporan lokasi banjir di DKI Jakarta 1.051 712 Dibongkar 749 1. Pada tahun 2007. yang berstatus residu 2. terdapat 4.312 2. Salemba c. Tanah Abang 3. 25 April 2008) Dari tabel data kasus pelanggaran izin bangunan di atas. Banjir di wilayah Jakarta Barat Karangan deskripsi dapat juga dibuat dengan mengamati bentuk informasi nonverbal seperti grafik.112 kasus pelanggaran izin bangunan. Contoh karangan deskripsi dari tabel. Dari jumlah tersebut.112 4.742 bangunan terpaksa dibongkar. Pramuka b. umpamanya dari kiri ke kanan. 3. Tahun 2006 2007 Kasus 5.051 bangunan diarahkan untuk mengurus izin bangunan (pemutihan). terdapat 5. Jumat. atau bagan. dan 1. tabel.888. Banjir di wilayah Jakarta Timur a. 1. Penyajian urutan ini digunakan bagi karangan yang mempunyai pertalian sangat erat dengan ruang atau tempat. yang diarahkan mengurus perizinan sebanyak 712 unit. Pola uraiannya berangkat dari satu titik lalu bergerak ke tempat lain. Banjir di wilayah Jakarta Pusat a. Klender c.312 bangunan berstatus residu. 2. atas ke bawah.742 Residu 3. Duren sawit b.

Contoh eksposisi dengan pengembangan ilustrasi Kepemimpinan seorang Bapak dalam rumah tangga bak nakhoda mengemudikan kapal. b. tabel. simposium. Bila ditempatkan di pot kecil. bentuknya yang mungil memudahkan orang untuk berkomunikasi di mana saja berada. Ada dua jenis tanaman mini. sama halnya dengan kapal yang dikemudikan nakhoda. Tanaman jenis ini misalnya. pertumbuhannya jadi lambat. Karangan eksposisi adalah karangan yang memaparkan atau menjelaskan secara terperinci (memaparkan) sesuatu dengan tujuan memberikan informasi dan memperluas pengetahuan kepada pembacanya. dan klasifikasi. Bila kepemimpinan kepala keluarga baik. cara kerja. Contoh eksposisi dengan pengembangan klasifikasi. Bapak menjadi kepala keluarga yang bertanggung jawab terhadap istri dan keluarganya. merek. Pertama. Dengan variasi bentuk. c. jenis telepon ini banyak diminati berbagai kalangan masyarakat. Contoh eksposisi dengan pengembangan definisi. atau menguraikan. atau penataran. ia akan tumbuh besar dan normal seperti biasa. Untuk mendukung akurasi pemaparannya. tanaman mini yang bukan asli mini. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 234 . Eksposisi Kita eksposisi berasal dari bahasa Latin exponere yang berarti: memamerkan. makalahmakalah untuk seminar. definisi. Telepon genggam adalah produk canggih era komunikasi nirkabel. Berikut contoh-contoh pengembangan karangan eksposisi: a. dan sebagainya dengan pola pengembangan ilustrasi. Sama seperti nakhoda yang mampu memimpin dan melaksanakan tugas dan tanggung jawabnya. menjelaskan. sering pengarang eksposisi menyertakan bentuk-bentuk nonverbal seperti grafik. atau bagan dalam karangannya. telepon tanpa kabel. akan baiklah keluarga tersebut. Bila ditanam di tanah. Pemaparan dalam eksposisi dapat berbentuk uraian proses. Karangan eksposisi biasanya digunakan pada karya-karya ilmiah seperti artikel ilmiah. diagram. Selain mudah digenggam serta dibawa ke mana-mana. tahapan. Telepon genggam yang lebih dikenal dengan sebutan ponsel (telepon seluler) atau HP (hand phone) merupakan alat komunikasi yang berbentuk kecil serta ringan.3. dan model yang selalu baru.

Meskipun bentuk karangannya cenderung narasi. Tahapan menulis karangan eksposisi. yaitu sebagai berikut. Penggalian yang memakan waktu hampir 20 jam itu berakhir saat dua korban berhasil ditemukan. atau cara kerja. Contoh karangan eksposisi dari suatu peristiwa. chriptanthus panseviera. Tanaman ini kalau ditanam di tanah tidak dapat besar seperti ukuran biasa (normal). (4) menyusun kerangka karangan. pohon asem. (1) menentukan objek pengamatan. Jika ditanam di pot kecil. mengantisipasi wabah DBD dengan 3 M. atau evakuasi korban banjir. (2) menentukan tujuan dan pola penyajian eksposisi. Sementara Itok ditemukan dalam kondisi mengenaskan. Jenis kedua tanaman mini asli yang aslinya memang kecil. Semua bagian dianggap bernilai sama. Pengembangan kerangka karangan berbentuk eksposisi dapat berpola penyajian berikut: 1). namun kita dapat membuatnya menjadi bentuk paparan dengan memusatkan uraian pada tahapan. Mundari ditemukan dalam keadaan tubuh melingkar. (3) mengumpulkan data atau bahan. misalnya cara menanggulangi penyebaran virus flu furung. Karangan eksposisi juga dapat ditulis berdasarkan fakta suatu peristiwa.00 WIB penggalian terus dilakukan dengan menggunakan backhoe. ia akan makin kecil. Dari sejak subuh kemarin hingga pukul 03. kejadian bencana alam. misalnya. kecelakaan. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 235 . dan cantik. dan jambu kerikil.tanaman palem udang. Tanaman ini antara lain agave. dan anthurium chrystallium. atau sejenis liputan berita. dan (5) mengembangkan kerangka menjadi karangan. Dua pekerja yang tertimbun tanah longsor akhirnya ditemukan oleh petugas kepolisian setelah sejak kemarin mereka menggali gundukan pasir setinggi sepuluh meter. mungil. pohon rhapis. hal atau peristiwa tanpa memproritaskan bagian mana yang terpenting. beringin. Urutan topik yang ada Pola urutan ini berkaitan dengan penyebutan bagian-bagian suatu benda.

(1) menentukan tema atau topik permasalahan. Sebab-sebab kemacetan di DKI Jakarta a) Jumlah penggunaan kendaraan b) Ruas jalan yang makin sempit c) Pembangunan jalur busway Akibat-akibat kemacetan a) Terlambat sampai di kantor b) Waktu habis di jalan b. sebagai berikut. akibat-sebab. Karangan argumentasi dapat juga berisi tanggapan atau sanggahan terhadap suatu pendapat dengan memaparkan alasan-alasan yang rasional dan logis. Contoh: a. Sebab-akibat Pola urutan ini bermula dari topik/gagasan yang menjadi sebab berlanjut topik/gagasan yang menjadi akibat.2). atau pernyataan yang mendukung. Argumentasi Karangan argumentasi ialah karangan yang berisi pendapat. (3) mengumpulkan data atau bahan berupa: bukti-bukti. dan (5) mengembangkan kerangka menjadi karangan. 1). Pengembangan kerangka karangan argumentasi dapat berpola sebabakibat. bukti-bukti. Urutan klimaks dan antiklimaks Pola penyajian dimulai dari hal yang mudah/yang sederhana menuju ke hal yang makin penting atau puncak peristiwa dan sebaliknya untuk anti-klimaks. Tujuan karangan argumentasi adalah berusaha meyakinkan pembaca akan kebenaran pendapat pengarang. atau penilaian terhadap suatu hal yang disertai dengan alasan. 4. 236 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Tahapan menulis karangan argumentasi. atau pola pemecahan masalah. dan pernyataan-pernyataan yang logis. sikap. fakta. (2) merumuskan tujuan penulisan. (4) menyusun kerangka karangan.

Daftar kecelakaan pun bertambah panjang. Fungsi hutan 3. Kesimpulan dan saran Contoh karangan argumentasi: Salah Urus Kereta Api Lagi-lagi kecelakaan kereta api terjadi. Urutan Pemecahan Masalah Pola urutan ini bermula dari aspek-aspek yang menggambarkan masalah kemudian mengarah pada pemecahan masalah. Keadaan hutan kita 2. Contoh : Bahaya narkoba dan upaya mengatasinya 1. Akibat-akibat kerusakan hutan 3). Upaya mengatasi kecanduan narkoba 4. Dalam kurun waktu empat bulan terakhir sudah terjadi 10 kali kecelakaan kereta api. ancaman hukumannya 3. Tanda-tanda amblesnya tanah di bawah bantalan rel kereta tentu bisa diamati jauh Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 237 . Akibat-sebab Pola urutan ini dimulai dari pernyataan yang merupakan akibat dan dilanjutkan dengan hal-hal yang menjadi sebabnya. Jawa Barat. Musibah kereta api Argo Lawu tak memakan korban. Kereta api Citra Jaya terguling di Cibatu. Angka ini naik hampir tiga kali lipat dibanding periode yang sama tahun lalu. pengaruh terhadap kesehatan b. Sabtu lalu. Jawa Tengah. Contoh : Menjaga kelestarian hutan 1. Pemerintah mesti segera membenahinya sebelum korban jatuh lebih banyak akibat kecelakaan. Pada hari yang sama. sepur eksekutif Argo Lawu juga anjlok di Banyumas. Pengertian narkoba 2. Tapi kecelakaan kereta Citra Jaya menyebabkan puluhan orang terluka.2). Tidaklah salah pernyataan Menteri Perhubungan Hatta Rajasa kemarin bahwa anjloknya dua sepur itu seharusnya bisa dideteksi. Bahaya kecanduan narkoba a. Ini makin menunjukkan perkeretaapian kita dalam kondisi gawat. pengaruh terhadap moral c.

(Dikutip dari Koran Tempo. Membiarkan kereta api berlari di atas bantalan rel yang lapuk atau tak terurus sungguh berbahaya. semestinya manajemen PT Kereta Api lebih serius mengawasi jalur kereta api. kenapa untuk urusan yang ini tidak? Pemerintah tak perlu ragu mengucurkan dana untuk pembenahan perkeretaapian. Dari total panjang lintasan rel kereta api 4. Dengan kata lain. Di luar perawatan rutin. kalau pemerintah bisa menalangi Lapindo Brantas Inc. angka itu memang tampak besar. Faktanya. kondisi perkeretaapian yang amburadul harus segera dibenahi. jumlah penumpangnya tentu akan jauh meningkat. anggaran dari pemerintah hanya Rp 750 miliar.5 triliun buat membangun infrastruktur di Porong Sidoarjo.4 triliun per tahun. 24 April 2007) 238 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Inilah yang menyebabkan perusahaan milik negara tersebut tak sanggup memberikan layanan yang baik.1 triliun. Sementara itu. Pendapatan PT Kereta Api pun akan bertambah. Dengan pengelolaan di bawah standar pun. Badan Perencanaan Pembangunan Nasional tahun lalu menghitung dibutuhkan Rp 6 triliun untuk menyehatkan kereta api dan jaringan rel. Yang terjadi sebenarnya pemerintah juga salah urus perusahaan ini sehingga terus merugi. Pak Menteri Cuma melihat sisi ketidakberesan PT Kereta Api. separuh lebih berusia di atas 50 tahun. Total duit yang dikeluarkan untuk perawatan reguler per tahun mencapai Rp 2. setiap tahun kereta api mampu mengangkut 150 juta penumpang dan 5 juta ton barang. Dalam keadaan anggaran negara yang sedang tekor. Jika dikelola dengan benar. Kerugian besar muncul karena PT Kereta Api diwajibkan memelihara jaringan rel di Indonesia. Jika pemerintah peduli keselamatan warganya. Tapi. Rp 1. Persoalannya. kereta api sebetulnya berpotensi menunjang perekonomian. Padahal sebagian besar bantalan rel itu perlu diganti.676 kilometer. Sekitar Rp 7. sebagian besar kecelakaan kereta api yang terjadi pada 2001-2006 akibat kurang beresnya rel. Jumlahnya tidak tanggung-tanggung. Kalau ditangani lebih baik.hari. Jangan heran jika banyak bantalan rel yang sudah lapuk. Kondisi ini sangat mudah membuat kereta api anjlok. PT Kereta Api jelas tak mampu lagi menanggungnya.

penulis merinci objek dengan kesan. Dilihat dari sifat objeknya.RANGKUMAN A. Pengertian wacana Wacana adalah sebuah tulisan yang teratur menurut urut-urutan yang semestinya atau logis. terutama bagi pengarang pemula. eksposisi. Untuk mencapai kesan yang sempurna bagi pembaca. Unsur-unsur penting dalam sebuah narasi adalah kejadian. Agar penyusunan kerangka karangan menjadi acuan pembuatan karangan. yaitu deskripsi Imajinatif/Impresionis dan deskripsi faktual/ekspositoris. Kerangka karangan dapat di tulis dalam dua bentuk. dan suasana. Jenis-Jenis Wacana Berdasarkan bentuk atau jenisnya. tujuan yang sesuai dengan bentuk wacana. calon penulis sebaiknya mengetahui langkah-langkah menyusun kerangka karangan. yaitu kerangka kalimat dan kerangka topik. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 239 . deskripsi. wacana dibedakan menjadi wacana narasi. argumentatif. deskripsi dibedakan atas 2 macam. alur/plot. fakta. seseorang harus menentukan tema. tempat. perasaan. tokoh. Narasi dapat berbentuk narasi ekspositoris dan narasi imajinatif. Sebelum menulis wacana. konflik. serta latar yang terdiri atas latar waktu. dan citraan. Narasi Narasi adalah cerita yang didasarkan pada urut-urutan suatu kejadian atau peristiwa. 2. 1. dan pengalaman penulisnya. dan menyusun kerangka karangan. B. Membuat kerangka karangan sangat dianjurkan sebelum penulisan. Dalam wacana setiap unsur-unsurnya harus memiliki kesatuan dan kepaduan. dan persuasi. Deskripsi Deskripsi adalah karangan yang menggambarkan/suatu objek berdasarkan hasil pengamatan.

atau pernyataan yang mendukung. Tahapan menulis karangan argumentasi. atau penataran. fakta. menentukan tujuan dan pola penyajian eksposisi. atau pola pemecahan masalah. bukti-bukti. dan mengembangkan kerangka menjadi karangan. mengumpulkan data atau bahan. Pengembangan kerangka karangan berbentuk eksposisi dapat berpola penyajian urutan topik yang ada dan urutan klimaks dan antiklimaks. menyusun kerangka karangan. dan pernyataan-pernyataan yang logis. Karangan eksposisi biasanya digunakan pada karyakarya ilmiah seperti artikel ilmiah. merumuskan tujuan penulisan. Eksposisi Karangan eksposisi adalah karangan yang memaparkan atau menjelaskan secara terperinci (memaparkan) sesuatu dengan tujuan memberikan informasi dan memperluas pengetahuan kepada pembacanya. yaitu menentukan tema atau topik permasalahan. atau penilaian terhadap suatu hal yang disertai dengan alasan. 4. Argumentasi Karangan argumentasi ialah karangan yang berisi pendapat. akibat-sebab. sikap. yaitu menentukan objek pengamatan. Pengembangan kerangka karangan argumentasi dapat berpola sebab-akibat. menyusun kerangka karangan. Tahapan menulis karangan eksposisi.3. dan mengembangkan kerangka menjadi karangan. 240 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . mengumpulkan data atau bahan berupa: bukti-bukti. makalah-makalah untuk seminar. Tujuan karangan argumentasi adalah berusaha meyakinkan pembaca akan kebenaran pendapat pengarang. simposium.

argumentasi tentang prinsip atau sikap kerja. Bacalah wacana di awal bab. deskripsi dengan mengamati gambar atau ilustrasi. narasi yang berisi uraian secara kronologis. Dibandingkan menanam tanaman lain. c. tanaman hidroponik dapat diletakkan dalam rumah atau bangunan. terumbaiumbai bergerak ditiup angin. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! 1. Panjang karangan 150 – 200 kata dalam waktu 30 menit. UJI KOMPETENSI I. d. 3. Ketika itu. Jelaskan perbedaannya dari segi tema. Carilah di koran atau majalah contoh tulisan berbentuk narasi. kerjakanlah tugas berikut. padang ilalang terbentang luas. b. 1. Putih tipis. tanaman hidroponik keuntungan hidroponik tanaman dalam bangunan d. tujuan. atau argumentasi. 2. manfaat hidroponik cara menanam tanaman Di belakang bukit di sebelah selatan. b. eksposisi. deskripsi. eksposisi. e. Tulislah wacana bercorak: a. seperti busa air di arus yang deras. c. narasi Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 241 . Uraian di atas merupakan paragraf jenis …… a.TUGAS MANDIRI Agar lebih memahami dan terampil menulis wacana bercorak narasi. Tulislah paragraf berbentuk deskripsi dan eksposisi. 2. bunga-bunganya sudah bermunculan. eksposisi mengenai suatu peristiwa. dan argumentasi. Tumbuhan ini mudah tumbuh asal kebersihannya terjaga …… Paragraf ini berisi hal tentang a. deskripsi. dan sifat uraiannya.

c. sebuah tulisan yang teratur dan logis b. e. e. tema d. d. menentukan tujuan dan pola penyajian eksposisi c. kecuali a. kalimat utama e. 242 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . mengadakan pengamatan terhadap objek 5.b. 6. 3. sebuah uraian singkat c. deskripsi argumentasi persuasi ekposisi Buang sampah di sungai Banjir Hutan ditebang Saluran air tidak tepat Bagan di atas merupakan laporan secara a. d. c. b. judul Hal-hal di bawah ini termasuk tahapan membuat karangan eksposisi. cerita berbentuk narasi ukpositos Unsur terpenting dalam sebuah wacana adalah a. Di bawah ini yang merupakan pengertian wacana adalah a. menentukan objek pengamatan b. induktif deduktif induktif-deduktif deduktif-induktif campuran 4. alinea atau paragraf b. alur c. naskah pidato e. teks yang berisi data dan fakta d.

menggambarkan secara umum ide karangan e. 7. e. 2. menggambarkan pola penalaran karangan d. eksposisi e. 1. narasi b. deskripsi c. 4. menggambarkan pola susunan ide-ide pokok c. eksposisi e. argumentasi d. 10. narasi b.d. argumentasi 8. 9. persuasi Karangan deskripsi yang menggambarkan objek sesuai kesan atau imajinasi si penulis disebut a. persuasi Karangan yang isinya menjelaskan dengan tujuan memberi tambahan informasi atau pengetahuan bagi pembacanya disebut a. deskripsi impresionistis e. narasi faktual d. 3. narasi b. deskripsi c. kecuali a. agar tulisan sistematis b. deskripsi c. menyusun kerangka karangan mengembangkan kerangka menjadi karangan Keterangan yang berisi penggambaran atas suatu objek disebut a. Hal berikut adalah manfaat kerangka dalam pembuatan karangan. mengoreksi ide pokok yang timpa tindih 11. argumentasi d. Pendahuluan Langkah-langkah berbisnis lewat internet Keuntungan berbisnis lewat internet Manfaat internet Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 243 .

(3). (2). (5). e. (3). (2). persuasi eksposisi narasi argumentasi deskripsi 244 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . (3). Dalam kehidupan pribadi. (1) (1). c. disiplin berarti peraturan yang dibuat untuk diri sendiri yang tidak bertentangan dengan peraturan umum. (5) (5). d. kerangka karangan naratif 13. (4). (5). b. Hadir dalam suatu acara pada waktu yang ditetapkan atau melakukan tugas dan kewajiban dengan tepat dan tertib dapat tercapai kalau ada disiplin pribadi. Teknologi informasi yang namanya internet Susunan topik-topik di atas agar menjadi kerangka karangan yang baik ialah a. kerangka karangan kalimat a. (4). tetapi belum dimanfaatkan (2) turbin yang berputar akan mengalirkan energi listrik besar 60 Mega watt (3) uap panas itu disalurkan ke turbin (4) itu yang terjadi di Amerika serikat dan lain lagi di Indonesia. Pengembangan paragraf di atas menggunakan pola. (3) (5). b. (1). (2). d. Bangun dan melakukan suatu tepat pada waktunya.5. (4). (2) 12. kerangka karangan ide pokok c. Perhatikan kerangka karangan berikut: (1) teknologi sudah diketahui. Kerangka karangan di atas termasuk berbentuk a. c. e. kerangka karangan imajinatif d. (2) (1). kerangka karangan topik b. (1). (4). a. (4).

peran sektor pertanian di dalam produksi nasional menunjukkan trend yang terus menurun. Meskipun demikian. (3). (5) (5). Sejalan dengan industrialisasi. c. (1). (2). dan juga sebagai sumber penghasilan berjuta-juta petani. (2). yakni sebagai sumber produksi pangan. c. (4). bahan baku industri. Kalimat yang bersifat deskriptif ialah a. d. e. (4). d. 17. curah hujan di Jawa waktu itu sangat tinggi. (5) (2). yaitu pada tahun 1988. perannya di dalam perekonomian sangat penting. (4). (3). Merokok merupakan kebiasaan yang kurang selaras dengan kampanye hidup sehat. meski tidak mengakibatkan banjir sungai yang dahsyat. Akibatnya. sebab-akibat b. b.14. (4). Persoalan yang melilit para pengusaha kecil ialah kurangnya modal. (1) (3). Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 245 . (3). perbandingan 16. (1). (3). (2). (1). Perolehan devisa dari sektor pariwisata menurun tajam sejak tragedi bom Bali. b. (5). (4). Indonesia pernah ketempatan kutup air hangat di atas atmosfernya. Polusi udara yang makin meningkat harus diatasi dengan sungguh-sungguh. (1) perdagangan setelah berlakunya pasar bebas (2) pengertian pasar bebas (3) strategi menghadapi pasar bebas (4) dampak pasar bebas terhadap satu negara (5) eksis di era pasar bebas Urutan kerangka yang tepat ialah a. Koherensi (hubungan antar kalimat) dalam paragraf di atas di wujudkan dengan menggunakan penghubung yang menyatakan a. ringkasan d. e. Asap tebal membubung tinggi di atas gunung api yang aktif. berurutan c. (5) (2). pertentangan e. (1) 15.

Curah hujan yang tinggi terutama di Jawa mengakibatkan sungai– sungai banjir. Hasan seorang remaja yang cerdas. Apabila siswa patuh.Dari situ jelaslah bahwa penyebab banjir di negeri kita tidak mutlak karena tingginya curah hujan. e. b. e. terampil. ”Awas! Ular!” Teman-temannya berlarian menghindar sambil berkata. Kerangka argumentasi dengan penalaran yang menyatakan hubungan akibat – sebab terdapat pada a. kaki. Kutup air hangat di atas atmosfer dapat meningkatkan curah hujan. c. Baju. kelas akan menjadi tertib dan proses belajar berjalan lancar. Sembilan bocah berkerumun di atas petak tanah yang berlumpur. b. c. c. d. tangan bahkan wajah mereka terlihat kotor. Kesimpulan yang diperoleh setelah membaca paragraf di atas ialah a. Sementara di langit matahari memancarkan cahayanya yang garang. tetapi juga karena ulah manusia seperti perusakan hutan dan keengganan mengadakan reboisasi. dan disiplin. e. argumentasi persuasi 246 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . sehingga ia diterima sebagai karyawan bank. Makin banyak jumlah pengganguran. Banyak sungai yang banjir akibat dari hujan deras dan kutup air hangat. Perusakan hutan dan keengganan mengadakan reboisasi mengakibatkan banjir. Keluarga aman menjadi akseptor KB Lestari tentu saja kehidupan rumah tangga sejahtera. Di mana terjadi kebakaran hutan karena panjang dan mungkin juga ulah manusia. ” Mana? Mana?” Pola pengembangan paragraf tersebut adalah a. tetapi peran ulah manusia juga. d. 19. Banjir bukan karena curah hujan yang tinggi. b. narasi deskripsi eksposisi d. 18. Tiba-tiba seorang anak yang bertelanjang dada berteriak. persaingan mencari pekerjaan makin ketat.

3. 2. Jawablah pertanyaan di bawah ini dengan tepat dan benar! Jelaskan pengertian wacana argumentasi! Sebutkan dan jelaskan cara membuat karangan yang baik! Jelaskan pengertian kerangka karangan! Sebutkan syarat-syarat paragraf yang baik! Apa yang dimaksud dengan narasi? Jelaskan fungsi dari kerangka karangan! Jelaskan apa yang dimaksud dengan teknik menyimpulkan secara induktif dan deduktif! 8. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 247 . Buatlah contoh paragraf yang menggunakan koherensi dengan kata ganti orang! 9. Layar Terkembang d. Di bawah ini yang sesuai judul karangan persuatif adalah a. 4. Lemak Yang Berlebihan Mengakibatkan Jantung Koroner. Buatlah contoh satu paragraf dengan pola hubungan sebab-akibat! 10. II. Buatlah kerangka karangan berurutan pada urutan umum-khusus! 1. 5. 6. 7. Langkah-langkah Membina Hubungan Bisnis e. Dian Tak Kunjung Padam c.20. Dari Ave Maria ke Jalan Lain Ke Roma b.

248 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .

jelas. Setelah pembelajaran ini. lugas. Pada bab ini pun. kita diharapkan mampu menyusun ringkasan dengan bahasa yang baik dan benar serta dapat menyimpulkan teks dengan jelas dan benar. dan bernalar sesuai dengan informasi yang diperoleh Bab ini membahas materi tentang cara membuat ringkasan dari teks tertulis dalam bentuk uraian dalam bahasa yang baik dan benar serta ringkasan berbentuk skema atau bagan dengan bahasa yang lugas. kita belajar membuat simpulan. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 249 .BAB 13 MERINGKAS DAN MENYIMPULKAN TEKS TERTULIS DALAM KONTEKS BEKERJA Standar Kompetensi Kompetensi Dasar - Berkomunikasi dengan bahasa indonesia setara tingkat madya Meringkas dan menyimpulkan teks tertulis dalam konteks bekerja - Indikator - Mencatat butir-butir informasi yang akan diringkas dalam bentuk skema atau bagan dalam bahasa yang lugas dan jelas Menghitung jumlah kalimat yang menjadi isi ringkasan sesuai dengan rumus meringkas yang baku Menyusun ringkasan teks secara jelas dalam bahasa yang baik dan benar Menyimpulkan suatu teks dengan menggunakan kalimat yang tidak ambigu.

prestasi Triyatno berada di peringkat enam. Enam tahun terakhir. Prestasi yang ia raih itu menyamai rekor SEA Games yang ditorehkan oleh lifter Indonesia. Anak Emas Petani Susah Betapa girangnya Triyatno. ia berada di peringkat empat. Tahun 2001. ia mengikuti kejuaraan dunia yunior dan meraih perunggu. Com Singnoi (snatch). yang diukir pada SEA Games 2001 di Johor Bahru. Pada kejuaraan angkat besi dunia yunior di Ceko tahun 2006. Lifter Triyatno. Saya bangga dan senang jadi 250 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Triyatno pindah latihan di ParungPanjang. Lampung. ia berada di peringkat delapan.” ujar Triyatno. ketika itu kelas II SMP di Metro. Namun. pada SEA Games tahun 2003 di Hanoi (clean and jerk dan total angkatan) dan lifter Thailand. Bogor. mengumpulkan angkatan Snatch 130 kg dan clean and jerk 160 kg. ia meraih perunggu di kejuaraan nasional angkat besi. ia dilatih Yono Haryono. di kompetisi internasional setelah itu. yang 20 Desember mendatang genap 20 tahun. Tahun 2007. Saat mengikuti kejuaraan dunia angkat besi. Triyatno meraih medali perak. “Hadiah uang dari pemerintah akan saya berikan kepada Ibu. Menekuni dunia angkat besi sejak usia 14 tahun. prestasi Triyatno terus meningkat. yang telah membesarkan dan mendidiknya dalam kesusahan. Dengan demikian. Di Asian Games Doha. ikut SEA Games dan meraih emas. banyak suka duka dialami Triyatno dalam meraih prestasi. “Sekarang. ia meraih medali emas.Wacanan Jawara Olahraga dari Desa yang Mengharumkan Nama Bangsa Triyatno. Minggu (9/12) siang itu. Pada kejuaraan dunia senior di Chiang Mai. Sebagai anak petani. Tiga tahun kemudian. Thailand. Triyatno berada di peringkat empat. total angkatan emasnya 290 kg. Karena padepokannya kemudian dilarang dan dibongkar. yang murah senyum dan rendah hati itu. angkatannya terus bertambah. Malaysia. Kebahagiaannya bertambah karena hadiah uang Rp 200 juta akan diserahkan kepada ibunya. Di pra-PON. terserah mau digunakan untuk apa. Gustar Junianto. dia menyumbangkan mendali emas bagi bangsa dan negara. pada final kelas 62 kg angkat besi SEA Games XXIV di provinsi Nakhon Ratchasima. Di Metro.

. Namun. Perkenalan Siti dengan dunia mendayung dimulai tahun 2003 ketika ia duduk di kelas 3 SMP Gunung Halu. yang juga atlet nasional cabang olahraga dayung nomor kayak. Bandung. untuk menonton latihan dayung. 2 September 1988. Namun. yang anak ketiga dari pasangan petani Suparno (50) dan Sukartinah (49). jadi pegawai negeri sipil. Cililin.” tutur gadis yang duduk di semester satu Jurusan Olahraga Universitas Pendidikan Indonesia.. sudah mengantongi sejumlah emas pada pertandingan tradisional boat tingkat Asia Tenggara.” Si Jago Dayung dari Gunung Namanya mungkin terbilang baru di kancah olahraga dayung. “Bagi saya. untuk didik menjadi atlet cabang olahraga dayung. Terlahir di Gunung Halu. tetapi lebih dari sekadar motivasi dan saya punya cita-cita. saya ingin langsung kerja. Ia lantas memberanikan diri mendaftar di asrama atlet yunior Pusat Pendidikan dan Latihan Pelajar. “Yang penting saya berkesempatan membawa nama negara dan berprestasi.” ujar Triyatno. ia tidak berhasil menduduki peringkat empat teratas yang akan dipertandingkan untuk nomor kayak. sebagai pendayung di sisi kanan. “Karena sudah tamat SMU. “Besar sebelah deh tangannya. target bukan beban. pada seleksi pelatnas 2005. Siti selalu dipandang aneh oleh orang yang pertama kali berkenalan dengannya. walau baru mengantongi ijazah SMU. sering mengajaknya ke Situ Ciburuy di Padalarang.” ujarnya terpingkal-pingkal. Awalnya ia tertarik di nomor kayak. “Lebih ringan dan mendayungnya menggunakan dua tangan. Bogor.duta bangsa dan persembahkan prestasi buat negara tercinta. Bandung. jangan salah. Siti kemudian dialihkan ke nomor traditional boat.” kilah Triyatno. Bandung. Thailand. Cita-cita lainnya adalah bekerja. Bandung. menjadi Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 251 .. Bandung. “Kok orang gunung bisa ngedayung? Ketemu airnya di mana?” ujarnya terkekehkekeh menirukan pertanyaan orang-orang. SEA Games XXIV mendatang di Nakhon Ratchasima.. “Dari nonton. Meski berotot hanya sebelah tangan.. pendayung dari nomor traditional boat ini.” ujarnya. eeh malah iseng pengen coba. lulusan SMU Paruh Panjang. Sepupunya. sampai ketagihan. bagaikan bisa turun di ajang Olimpiade Beijing. Siti mengaku tetap percaya diri.” tuturnya bangga. Siti Maryam (19).

Pada SEA Games XXIII di Filipina. Cara Membuat Ringkasan Ada beberapa cara yang dapat dijadikan pegangan dalam membuat ringkasan yang baik dan teratur. pada Kejuaraan Traditional Boat di Penang. yaitu sebagai beriku. yang kemudian dipangkas dengan mengambil halhal atau bagian yang pokok dengan membuang perincian serta ilustrasi. Walaupun kedua istilah itu sering disamakan.” ujar Siti penuh harap. Ikhtisar sebaliknya. Jadi. sebuah ringkasan tetap mempertahankan pikiran pengarang serta pendekatannya yang asli. B. (Sumber: Kompas. dan Thailand. Malaysia. timnya berhasil meraih emas di jarak 500 meter.SEA Games ke-2 yang diikuti Siti. tapi sesungguhnya keduanya berbeda. ringkasan merupakan keterampilan mereproduksi hasil karya yang sudah ada dalam bentuk yang singkat. sementara bagian yang dianggap kurang penting dapat dibuang. Saya optimistis tim traditional boat putri berhasil meraih emas. Ringkasan berbeda dengan ikhtisar. setidaknya di jarak 500 meter. 252 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Ringkasan merupakan penyajian singkat dari suatu karangan asli namun tetap mempertahankan urutan isi dan sudut pandang pengarang asli.000 meter dan 500 meter. 2 Desember 2007) A. Pengertian Ringkasan Ringkasan (precis) adalah suatu cara yang efektif untuk menyajikan karangan yang panjang dalam sajian yang singkat. “Tahun ini latihannya jauh lebih berat dari yang dua tahun lalu. Awal tahun 2007. penulis dapat langsung mengemukakan pokok uraian. Meskipun begitu. tidak perlu mempertahankan sistematika penulisan sesuai dengan aslinya dan tidak perlu menyajikan isi dari seluruh karangan itu secara proporsional. Dalam ikhtisar. Sebuah ringkasan bermula dari karangan sumber yang panjang. ”Precis” berarti ”memotong” atau ”memangkas”. Siti bersama rekan-rekannya meraih dua perunggu di jarak 1.

Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 253 . Ringkasan dari sumber asli yang berupa naskah pidato atau pidato langsung. misalnya 150 atau 200 kata bergantung pada permintaannya. Mencatat Gagasan Utama Semua hal yang menjadi gagasan utama atau gagasan penting digarisbawahi atau dicatat. 4. Bahkan. Sebuah ringkasan umumnya ditentukan dari panjang ringkasan finalnya.1. f. Membuat Reproduksi Menyusun kembali suatu karangan singkat berdasarkan gagasangagasan penting yang dicatat tadi. yaitu sebagai berikut. Dalam ringkasan. Lebih baik menggunakan kalimat tunggal daripada kalimat majemuk. c. penggunaan kata ganti orang pertama tunggal atau jamak harus ditulis dengan sudut pandang orang ketiga. Semua paragraf ilustrasi yang dianggap penting harus dipersingkat atau digeneralisasi. maksud pengarang. Ringkaslah kalimat menjadi frasa. 3. b. 2. Ketentuan Tambahan Ada ketentuan tambahan selain ketiga cara di atas. serta sudut pandangnya. Membaca Naskah Asli Penulis ringkasan harus membaca naskah asli secara keseluruhan beberapa kali untuk mengetahui kesan umum. frasa menjadi kata. tidak ada pemikiran atau interpretasi baru dari penulis ringkasan. d. semua keterangan atau kata sifat dibuang. e. g. a. gagasan panjang menjadi gagasan sentral saja. jika tidak diperlukan sebuah paragraf dapat dipangkas atau dibuang. Bila mungkin.

Mesti begitu pemerintah tetap mempersiapkan juga. Sarana angkutan dari jauh-jauh hari sudah dipersiapkan. apalah artinya. diharapkan arus pulang mudik lebaran sudah mulai berlangsung jauh sebelum puncak lebaran. tetapi harus mencerminkan gagasan atau seperti yang diungkapkan oleh teks sumbernya. Masalah yang satu ini jelas sangat ditentukan oleh disiplin bersama. lonjakan arus penumpang lebaran diantisipasi naik 10-15% agar jangan sampai kekurangan sarana angkutan. Kalau semua ramai-ramai pulang menjelang lebaran. Beberapa Contoh Bentuk Ringkasan Ringkasan dapat disusun dalam dua bentuk. Baik disiplin aparat. harus dicatat terlebih dulu butir-butir informasi yang akan dijadikan unsur-unsur bagan atau skema. Perusahan angkutan bus sudah mampu menyediakan dalam jumlah bsar. Meskipun ringkasan berbentuk bagan atau skema. Angkutan bus betul-betul menjadi tulang punggung di saat-saat seperti ini karena lebih dari separuh calon pemudik diperkirakan akan terangkut oleh bus. Meskipun akhirnya terangkat juga. Sementara hanya 1/3 dari seluruh pemudik dari Jakarta dan sekitarnya diperkirakan menggunakan jasa KA Angkutan bus jarak jauh tidak ada masalah. 254 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . maupun pemakai jalan meski fasilitasnya cukup. yaitu bentuk verbal uraian (paragraf) dan bentuk nonverbal berupa bagan atau skema. kalau lalu lintas macet. Untuk itu. Perhatikan beberapa contoh teks dan ringkasannya di bawah ini! Contoh 1: Jumlah pemudik lebaran diperkirakan sama dengan tahun-tahun sebelumnya. Padahal. penyelenggara. bisa-bisa pemudik akan menumpuk di terminal. Sebelum membuat bagan atau skema. Meski demikian. hal itu memberi kesan seolah-olah kekurangan sarana. Tinggal masalah lancar dan tidaknya saja di perjalanan .C. sebetulnya cukup memadai.

Selanjutnya lancar dan Jumlah pemudik lebaran diperkirakan sama dengan tahun-tahun sebelumnya meskipun tidaknyanaik 10 – 15 %. di bawah ini. pasien akan dirujuk surat rujukan untuk diperiksa di Rumah surat Daerah. Meskipun akhirnya terangkat juga. maupun pemakai jalan mesti Separuh calon pemudik diperkirakan akan menggunakan bus. fasilitasnya cukup. agar tidak terjadi penumpukan di terminal dan terkesan kekurangan sarana.115 Rujukan ke Rumah Sakit Daerah R. Sarana angkutan dari jauh-jauh hari sudah dipersiapkan. Angkutan bus betul-betul menjadi tulang punggung di saat-saat seperti ini karena lebih dari separuh calon pemudik diperkirakan akan terangkut oleh bus. Jika puskesmas tidak bisa menangani. Prosesnya pun mudah. Asalkan Puskesmas sangat menguntungkan bagi masyarakat. Tinggal mudik berlangsung jauh sebelum lebaran agar tidak terjadi penumpukan masalah lancar dan tidaknya saja di perjalanan . Kalau semua ramai-ramai pulang menjelang lebaran. Asalkan sudah mendaftarkan diri. Demikan pula dengan pemerintah. pasien tinggal menunggu panggilan untuk pedesaan dan bagi masyarakat dapat ditangani di puskesmas dapat langsung pulang diperiksa. Ia akan diberi pengantar atau setelah diperiksa dan diberi obat. terutama bagi masyarakat di sudah mendaftarkan diri. Pasien yang dapat ditangani di puskesmas bisa langsung pulang pasien akan dirujuk ke Rumah Sakit Daerah. Demikan pula dengan pemerintah. pasien tinggal menunggu setelah diperiksa dan diberi obat. Pasien yang yang kurang mampu. penyelenggara. Diharapkan proses mudik berlangsung jauh sebelum lebaran diantisipasi akan ditentukan oleh kedisiplinan bersama.Dan 1/3 dari seluruh pemudik Jakarta an sekitarnya diperkirakan menggunakan kereta api. sebetulnya cukup memadai. Padahal. kalau lalu lintas macet. terutama bagi masyarakat di pedesaan dan bagi masyarakat yang kurang mampu. Masalah yang satu ini jelas sangat ditentukan di terminal dan terkesan kekurangan sarana. Separuh calon pemudik diperkirakan akan menggunakan bus. Ringkasan teks di atas dapat berbentuk bagan. Sementara hanya 1/3 dari seluruh pemudik dari Jakarta Ringkasan teks di atas adalah sebagai berikut: dan sekitarnya diperkirakan menggunakan jasa KA Jumlah pemudik lebaran diperkirakan sama dengan tahun-tahun sebelumnya meskipuntidak ada masalah. Baik disiplin aparat. seperti Pelayanan di Puskesmas Pelayanan di Puskesmas Pasien datang Loket pendaftar Ruang tunggu Ruang Periksa . Jika puskesmas tidak dapat menangani. Dan 1/3 dari seluruh pemudik Jakarta dan sekitarnya diperkirakan Ringkasan teks di atas adalah Perusahaan bus menggunakan kereta api. Biaya Contoh 2: pengobatan di puskesmas sangat murah. Selanjutnya lancar dan tidaknya ditentukan oleh kedisiplinan bersama. bisa-bisa pemudik akan menumpuk di terminal. Ia akan diberi pengantar atau Sakitrujukan untuk diperiksa di Rumah Sakit Daerah. sebagai berikut: sudah mempersiapkan seluruh armadanya. Daerah Antri Obat pulang Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 255 . Ringkasan teks di atas dapat berbentuk bagan. oleh disiplin bersama. Diharapkan mampu menyediakan dalam jumlah bsar. panggilan untuk diperiksa.S. Biaya pengobatan di puskesmas sangat murah.berlangsung jauh sebelum puncak lebaran. Puskesmas sangat menguntungkan bagi masyarakat. Mesti begitu pemerintah tetap mempersiapkan juga. apalah artinya. halitu memberi kesan seolah-olah kekurangan sarana. seperti di bawah ini. Prosesnya pun mudah. Perusahaan bus sudah Contoh 2: mempersiapkan seluruh armadanya. Perusahan angkutan bus sudahproses Angkutan bus jarak jauh diantisipasi akan naik 10–15%. ke Rumah Sakit Daerah.

dapat memunculkan konflik-konflik sosial. Bahkan. Semoga hasil seminar ini dapat menambah wawasan atau pengetahuan kita mengenai masalah ketenagakerjaan. masalah tingginya pengangguran yang berdampak pada tingginya angka kriminalitas. Marilah kita memanjatkan puji syukur ke hadirat Tuhan Yang Mahakuasa atas limpahan rahmat dan karunia-Nya kepada kita. ada juga yang mengalami kekerasan.Contoh 3: Teks Pidato. Masalah ketenagakerjaan terebut dapat menimbulkan dampak sosial yang negatif. dan masalah pekerja anak merupakan contoh masalah ketenagakerjaan. Anak-anak itu disuruh bekerja dengan aturan yang tidak tentu. Dan teman-teman yang saya cintai. Misalnya. Penentuan tema ini dilatarbelakangi oleh makin maraknya sorotan masyarakat terhadap masalah ketenagakerjaan. Bapak/Ibu guru yang saya hormati. Kita harus melakukan suatu tindakan walaupun tindakan itu sangat sederhana. meningkatnya pengangguran. Salam sejahtera. Kita harus turut berupaya menghentikan eksploitasi anak mulai dari lingkungan terdekat kita. Sempitnya lapangan kerja. Kondisi ekonomi yang tidak baik mengharuskan mereka bekerja walaupun usia mereka belum masuk usia kerja. terutama masalah pekerja anak. Masalah yang tidak kalah penting adalah masalah pekerja anak. Saya berharap kita dapat termotivasi melakukan sesuatu untuk 256 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Bahkan. Tentu saja masalah tersebut menjadi keprihatinan kita bersama. Hal yang sangat memprihatinkan adalah adanya orangorang yang tidak bertanggung jawab yang memanfaatkan mereka sebagai objek eksploitasi. Pekerja anak sangat rentan terhadap eksploitasi. Banyaknya anak yang putus sekolah menyebabkan meningkatnya jumlah anak yang terpaksa bekerja membantu orang tua memenuhi kebutuhan hidup. Saya sampaikan selamat datang dan terima kasih atas kehadiran teman-teman dalam acara seminar pada pagi hari ini. Banyak pekerja anak yang tidak mendapatkan haknya selama bekerja. Seminar pada kesempatan ini mengambil tema masalah ketenaga kerjaan.

simpulan dapat dinyatakan benar. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 257 . fakta. Anak dieksploitasi tanpa aturan yang tetap oleh orang yang tak bertanggung jawab. Saya mohon maaf jika ada kesalahan. Simpulan juga berarti kesudahan pendapat (pendapat terakhir yang berdasarkan uraian sebelumnya) atau keputusan yang diperoleh berdasarkan metode berpikir induktif dan deduktif. atau salah. Oleh sebab itu. Pemberi sambutan mengajak kita untuk melakukan tindakan untuk meminimalisasi eksploitasi pekerja anak mulai dari lingkungan yang terdekat. Ringkasannya adalah sebagai berikut: Pemberi sambutan menjelaskan bahwa tema seminar menyoroti masalah ketenagakerjaan dari sempitnya lapangan kerja. Demikianlah sambutan yang saya sampaikan. kesimpulan. Pengertian Simpulan Menurut Kamus Besar Bahasa Indonesia. sedangkan dalam simpulan terdapat penilaian atau pendapat pembuat simpulan. pengangguran hingga eksploitasi pekerja anak. Jika pada ringkasan penulis tetap mempertahankan isi. D. saya ucapkan terima kasih. kita harus menggunakan data. ada yang tidak. atau asumsi yang benar. kurang benar. fakta. Untuk dapat menarik simpulan yang benar. simpulan adalah sesuatu yang disimpulkan. sudut pandang. atau asumsinya tidak akurat. hasil simpulannya juga tidak akan akurat. hasil menyimpulkan. Semua itu dapat menimbulkan dampak sosial yang negatif termasuk tingginya angka kriminalitas. Atas perhatian teman-teman pada acara seminar ini. Simpulan berbeda dengan ringkasan. Ada yang mendapat haknya. Banyak penyebab yang menimbulkan adanya pekerja anak. serta sistematika karya aslinya.meminimalisasi eksploitasi pekerja anak. Jika data.

b. Pola Penalaran dalam Mengambil Simpulan Dalam mengambil simpulan. Kebanyakan dari mereka terpengaruh oleh budaya Barat yang bebas. aliran air di selokan dan kali tersumbat. tiga bentuk berikut. 258 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . kemudian ditelusuri penyebabnya. Contoh: PU PK K : : : Semua peserta ujian diwajibkan mengenakan atribut dan seragam dari sekolah asalnya. Masih banyak penduduk yang membuang sampah di selokan dan di kali. banjir melanda di mana-mana. Penalaran deduktif terdiri atas. a. Silogisme Silogisme adalah proses pengambilan simpulan dengan mengungkapkan terlebih dahulu pernyataan yang bersifat umum (premis umum) disusul dengan pernyataan khusus (premis khusus). Saat datang musim hujan. Dapat dilihat dari kurang sadarnya menjaga kebersihan lingkungan. Separuh di antaranya telah terlibat pergaulan bebas. Sebab-Akibat-Akibat Pola ini diawali dengan pengungkapan fakta yang merupakan sebab. Penalaran Deduktif Pola ini diawali dengan mengemukakan pernyataan yang umum lalu diikuti dengan pernyataan-pernyataan khusus. Contoh : Masyarakat kita masih rendah tingkat kedisiplinannya. Akibat-Sebab-Sebab Pola ini dimulai dengan pernyataan yang merupakan akibat. 1. Susi wajib mengenakan atribut dan seragam sekolah asal.E. digunakan pola penalaran deduktif dan induktif. pernah berpacaran. Contoh: Dua dari tiga remaja di kota-kota besar di Indonesia menurut penelitian. tidak lancar. c. Akhirnya. lalu disusul dengan simpulan yang berupa akibat. Susi adalah salah seorang peserta ujian.

setiap datang musim hujan . Jadi dapat dikatakan siswa SMA Teladan. Akibat-Akibat-Sebab Pola ini dimulai dengan mengungkapkan fakta-fakta yang merupakan akibat lalu dikemukakan peristiwa yang menjadi penyebabnya. pembinaan agama di rumah maupun di sekolah sangat kurang. Pakaian mereka putih-putih dan kemeja dimasukkan ke dalam celana dan ke dalam rok. atau hasil survei. Pengawasan terhadap hutan lindung sangat lemah. Penalaran Induktif Pola penalaran ini bermula dari pengungkapan hal-hal yang khusus. Penduduk sekitar pun ikut-ikutan sampai membuka ladang dengan menebangi hutan. Terjadi kebakaran hutan di mana-mana. a. Berikut adalah pola-pola penalaran induktif. pengamatan. bencana longsor terjadi. pakaiannya seragam dan tertib sewaktu mengikuti upacara.Mereka dengan serta-merta mengadopsinya dari tayangan-tayangan film di media elektronik. c. Data dan fakta diperoleh melalui penilaian. Contoh: Hutan banyak ditebangi secara ilegal oleh oknum pengelola hutan. Ditambah lagi. Pakaian mereka dilengkapi dengan dasi dan topi abu-abu. Generalisasi Generalisasi ialah pengambilan simpulan umum berdasarkan fakta dan data yang bersifat khusus. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 259 . Sebab-Sebab-Akibat Pola ini dimulai dengan mengemukakan fakta-fakta yang menjadi sebab. memakai ikat pinggang warna hitam. b. kemudian ditarik suatu simpulan yang bersifat umum. Contoh: Berdasarkan pengamatan yang dilakukan kepada SMA Teladan saat mereka melaksanakan upacara. lalu ditarik simpulan yang merupakan akibat. Akibatnya. 2. semua siswa memakai sepatu hitam dan kaos kaki putih.

Dapatkah seseorang melaluinya? Begitu pula bila menuntut ilmu seseorang akan mengalami rintangan seperti kesulitan ekonomi. menuntut ilmu sama saja halnya dengan mendaki gunung untuk mencapai puncaknya. kesulitan memahami pelajaran. tapi sesungguhnya keduanya berbeda. walaupun kedua istilah itu sering disamakan.Contoh: Ketika hujan. RANGKUMAN A. Ringkasan merupakan penyajian singkat dari suatu karangan asli namun tetap mempertahankan urutan isi dan sudut pandang pengarang asli. ada saja rintangan seperti jalan yang licin yang membuat seseorang jatuh. penulis dapat langsung mengemukakan pokok uraian. Biasanya dua hal atau lebih yang dibandingkan dianggap memiliki kesamaan sifat dasarnya. Analogi Analogi ialah pengambilan simpulan dengan mengambil kesamaan dari suatu hal yang diperbandingkan. Sedangkan ikhtisar sebaliknya. ”Precis” berarti ”memotong” atau ”memangkas”. Para penduduk mengungsi di tempat yang tinggi. 260 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Ini disebabkan saluran air tersumbat oleh sampah yang dibuang warga sembarangan. Apakah dia sanggup melaluinya ? Jadi. Ringkasan berbeda dengan ikhtisar. Contoh: Seorang yang menuntut ilmu sama halnya dengan mendaki gunung. Ada pula semak belukar yang sukar dilalui. d. banjir melanda di mana-mana. Sewaktu mendaki. dan sebagainya. Mereka harus menunggu air surut kembali. tidak perlu mempertahankan sistematika penulisan sesuai dengan aslinya dan tidak perlu menyajikan isi dari seluruh karangan itu secara proporsional. Dalam ikhtisar. sementara bagian yang dianggap kurang penting dapat dibuang. Pengertian Ringkasan Ringkasan (precis) adalah suatu cara yang efektif untuk menyajikan karangan yang panjang dalam sajian yang singkat.

Yang termasuk pola penalaran induktif ialah generalisasi. Pola Penalaran dalam Mengambil Simpulan Dalam mengambil simpulan digunakan pola penalaran deduktif dan induktif. yaitu membaca naskah asli. Sebelum membuat bagan atau skema. C. Pola penalaran Bermula dari pengungkapan hal-hal yang khusus. Beberapa Contoh Bentuk Ringkasan Ringkasan dapat disusun dalam dua bentuk. simpulan adalah sesuatu yang disimpulkan . kesimpulan. Simpulan juga berarti kesudahan pendapat (pendapat terakhir yang berdasarkan uraian sebelumnya) atau keputusan yang diperoleh berdasarkan metode berpikir induktif dan deduktif. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 261 . yaitu bentuk verbal atau uraian (paragraf) dan bentuk nonverbal berupa bagan atau skema. kemudian ditarik suatu simpulan yang bersifat umum. Meskipun ringkasan dalam bentuk bagan atau skema tetapi harus mencerminkan gagasan seperti yang diungkapkan oleh teks sumbernya. sebab-sebab-akibat. dan analogi. harus dicatat terlebih dulu butirbutir informasi yang akan dijadikan unsur-unsur bagan atau skema. akibat-akibat-sebab. Cara Membuat Ringkasan Ada beberapa cara yang dapat dijadikan pegangan dalam membuat ringkasan yang baik dan teratur. Pengertian Simpulan Menurut Kamus Besar Bahasa Indonesia.] E. Penalaran deduktif terdiri atas silogisme. dan akibat-sebab-sebab. sebab-akibat-akibat. dan ketentuan tambahan.B. hasil menyimpulkan . mencatat gagasan utama. D. membuat reproduksi.

kemudian buatlah ringkasannya dalam bentuk skema atau bagan! Buatlah simpulan paragraf tersebut secara induktif! Buatlah contoh simpulan dengan pola penalaran deduktif : a. siswa SMK negeri yang mengulang hanya 0. Walaupun angka ini relatif kecil. Walaupun demikian dari angka tersebut. Besar dan trend angka mengulang kelas antara SMA negeri dan swasta relatif sama.36% untuk SMA swasta dan 0. Bacalah paragraf di atas. kemudian buatlah ringkasannya! Angka mengulang kelas di tingkat SMA relatif kecil. 2. angka tersebut 0.22% untuk SMK negeri.49% atau 575 orang. 4.88% untuk SMA swasta dan 0. 3. sebab-akibat-akibat c. dari tahun ke tahun mengalami perbaikan.36% untuk SMK swasta dan 0. generalisasi b. di tahun 2005 kesenjangan tersebut dapat ditekan menjadi 0. 262 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . akibat-sebab-sebab Buatlah contoh simpulan dengan pola penalaran induktif: a. masih memperlihatkan kesenjengan mutu antara SMK negeri dan swasta yang harus dikikis. Sementara di tahun yang sama. pada tahun 2004 ada 756 atau 1. Ini menunjukkan mutu pelayanan yang relatif seimbang antara SMA negeri dengan swasta.41% siswa SMK swasta mengulang. silogisme b. Bacalah wacana berikut.. akibat-akibat-sebab 5.85% untuk SMA negeri. Berbeda halnya dengan apa yang terjadi di SMK. Pada tahun 2004. sebab-sebab-akibat c. berkurang menjadi 0. Berkat kegigihan semua pihak khususnya jajaran pengelola SMK swasta.TUGAS MANDIRI 1.23% untuk SMA negeri pada 2005.

memahami sudut pandang d. kecuali a. menangkap gagasan pokoknya 5. d. Penulis ringkasan setelah mencatat gagasan pokok. kecuali a. Di bawah ini pernyataan yang berkaitan dengan ikhtisari. 3. b. menulis kembali naskah drama Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 263 . membaca naskah asli b. Ikhtisar tidak perlu mempertahankan urutan isi karangan asli. mencatat gagasan pokok d. Ikhtisar pada prinsipnya sama dengan ringkasan. Ringkasan berasal dari kata precis yang artinya memotong. b. c. e. Ringkasan berbeda dengan ikhtisar.UJI KOMPETENSI I. menggunakan interpretrasi pengarang c. membuat reproduksi e. ialah a. 2. Di bawah ini pernyataan yang berkaitan dengan ringkasan. Ikhtisar merupakan penyajuan berisi pandangan pembuat ikhtisar. e. Hal yang perlu dilakukan oleh pembuat ringkasan ialah membaca naskah asli secara keseluruhan. Yang bukan merupakan cara membuat ringkasan yang baik adalah a. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! 1. c. Ikhtisar berarti memangkas. menghafal beberapa kalimatnya e. menangkap maksud pengarang c. Ringkasan merupakan suatu penyajian singkat dan suatu karangan aslinya. Ringkasan tidak perlu mengikuti urutan isi sumber aslinya. d. akan melakukan reproduksi. maksudnya adalah berikut ini. maksudnya a. Ringkasan berisi hal-hal pokok dari karangan panjang. mendapatkan kesan umum b. menggunakan kalimat tunggal daripada kalimat majemuk 4. Ikhtisar tetap mempertahankan urutan isi wacana aslinya.

c. ia sedang tertidur pulas. menyusun kembali karangan singkat berdasarkan gagasan yang diperoleh membuat kerangka karangan menyusun karangan dari kerangka yang dibuat mencatat ide-ide pokok naskah asli Ketika rumah tetangganya terbakar. d. d. b. Kalimat berikut yang merupakan kalimat tunggal ialah a. b. kalimat dirigkas menjadi frasa b. 8. d. Karena tidak pernah disiram. c. Amin tidak mengikuti praktik bahasa hari ini. e. a. e. Siswa SMK wajib mengikuti ujian praktik. 6. c. bunga itu mati. Di bawah ini adalah hal-hal yang perlu dilakukan dalam membuat ringkasan. Di bawah ini yang bukan kalimat majemuk adalah a. bila perlu kata keterangan atau kata sifat dibuang e. 9. e. d. Bapak pergi haji setelah tanahnya di kampung terjual. Kalimat singkat dari kalimat majemuk di atas adalah rumahnya terbakar saat ia tidur ia tidur pulas dan tetangganya terbakar ia tidur pulas di tengah kebakaran ia tertidur ketika kebakaran terjadi tetangganya terbakar tetapi ia tertidur pulas 7. c. Perusahaan itu maju karena seluruh karyawannya rajin bekerja. Presiden melakukan reshuffle kabinet agar kinerja menteri bisa lebih efektif. kecuali a. frasa disingkat menjadi kata c. Air Sungai Ciliwung itu meluap setelah Kota Bogor diguyur hujan. mengubah kata menjadi imbuhan 264 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Anita remaja yang sukses karena pandai dan disiplin. Pilkada itu rusuh karena seorang profokator membakar emosi massa. e. Adi dihukum Pak Guru ketika teman-temannya mengikuti pelajaran olahraga.b. gagasan panjang menjadi gagasan sentral saja d. b.

Pelajaran matematika dimulai pukul tujuh. aksi c. Manajemen perusahaan itu memang rapi. saling d. Kalangan partai politik mengusulkan agar menteri-menteri yang bermasalah diganti dalam perombakan kabinet yang dilakukan awal Mei mendatang. Para siswa-siswa mendaftar ke sekolah baru. itu b. d. c. Untuk meringkas kalimat di atas yang perlu diringkas adalah a. buku catatan. Kalimat di atas dapat diringkas dengan menghilangkan kata-kata di bawah ini. Kepolisian Resor Aceh Timur membenkuk enam anggota kelompok bersenjata di rumah milik Andi Wahyudi di Desa Kabu. Kecamatan Peireulak Barat. kecuali a. politik c. pada Sabtu malam lalu. Bapak dan Ibu harap berdiri. kata buku catatan menjadi buku tulis 11. Penggerebekan itu diwarnai aksi saling tembak menembak antara polisi dan anggota-anggota kelompok bersenjata tersebut. kata buku catatan sampai alat perekam menjadi berbagai perlengkapan yang diperlukan d.10. Kata yang harus dihilangkan pada kalimat kedua adalah a. c dan d Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 265 . awal d. kata alat perekam dihilangkan e. yang dilakukan e. Petani di desa Kulonprogo memprotes kenaikan harga gabah. 13. menteri jadi para menteri 12. kalangan b. alat tulis dan alat perekam. Kalimat di bawah ini yang menggunakan kata-kata berlebihan ialah a. anggota e. e. Sebelum melakukan wawancara perlu disiapkan pokok-pokok pertanyaan. b. kata sebelum b. kata pokok-pokok menjadi pokok c.

membekuk d. Untuk meringkas kalimat pertama pada soal nomor 13 yang perlu dilakukan adalah a. Ide pokok paragraf soal nomor 13 di atas ialah a. polisi melawan kelompok bersenjata e. Sabtu malam lalu e. malam lalu. Andi Wahyudi c. kata depan c. nama orang dihilangkan e. Sabtu malam lalu e. Ringkasan paragraf di atas adalah a. keterangan tempat disingkat d. keterangan waktu dihilangkan 16. Polisi bertarung dengan enam kelompok bersenjata di Aceh Timur. b. Yang merupakan keterangan waktu pada paragraf di atas adalah a. 266 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . polisi membekuk kelompok bersenjata c. kata bilangan b. d. penggerebekan polisi di Aceh b. Andi Wahyudi c. Yang merupakan keterangan tempat pada paragraf di atas adalah a. kelompok bersenjata 18. kelompok bersenjata 17.14. Polisi tembak-menembak dengan kelompok bersenjata di Aceh Timur. Kecamatan Pereulak Barat b. polisi terlihat aksi tembak-menembak d. Kecamatan Pereulak Barat b. peristiwa bersenjata di Aceh 15. membekuk d. Enam anggota bersenjata dibekuk polisi Aceh timur. Polisi membekuk kelompok bersenjata di Aceh Timur malam Sabtu lalu. c.

Saudara-saudara. b. mengajak menjadi meminta 20. Jelaskan pengertian ringkasan? Apa perbedaan ringkasan dengan ikhtisar? Buatlah ringkasan dari wacana di atas! Sebutkan aturan tambahan dalam membuat ringkasan! Hal apa saja yang harus dipangkas dalam membuat ringkasan! Apa yang dimaksud dengan reproduksi? Buatlah ringkasan dari sebuah pidato sambutan! Berikan contoh menjadikan kalimat majemuk menjadi kalimat tunggal! Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 267 .e. 3. II. Yang perlu diubah pada penggalan pidato di atas dalam rangka meringkas ialah a. 8. mengganti kata “saya” dengan kata ganti orang ketiga e. c. Pada pertemuan ini saya mengajak Anda semua untuk membantu korban bencana alam di daerah kita. Sabtu lalu membekuk kelompok bersenjata setelah aksi saling tembak. 7. 5. Ringkasan pidato di atas adalah a. d. 2. 4. 19. Pemberi pidato membantu korban bencana alam. Pemberi pidato mengajak hadirin untuk membantu beban korban bencana di daerahnya. menghilangkan kata Saudara b. Kepolisian Aceh Timur. Ria mengajak orang-orang untuk membantu korban bencana. mengganti membantu jadi memberi bantuan c. Jawablah soal-soal di bawah ini dengan tepat dan benar! 1. Hadirin diajak olehnya untuk membantunya dari bencana alam. Dia akan membantu korban bencana alam bersama hadirin. menghilangkan kata korban d. e. 6.

” Perbaikilah kalimat ini sehingga menjadi efektif! 10. “Semua siswa-siswi diwajibkan membawa alat kebersihan besok. Carilah sebuah paragraf ekspositoris.9. lalu buatlah ringkasannya! 268 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .

5. Setelah ini kita dengarkan beberapa sambutan b.. Halo Rina. kecuali a. Assalamu’alaikum b. apa kabar? b. 4. apa kabar semua? Membuka acara pada situasi semiformal di bawah ini. hubungan antarpelaku bicara d. Buat kamu-kamu.. Selamat jumpa di mana saja kamu berada Di bawah ini yang merupakan pembuka percakapan melalui telepon. Pilihlah jawaban yang paling tepat dari pernyataan di bawah ini! 1. kecuali a.. waktu pembicaraan e. Para hadirin yang dimulaikan. yaitu a. e.. e. Halo teman-teman semua b. Halo. Selamat malam di mana saja Anda berada e. Halo semua. Sampai nanti dalam acara yang sama d.. Acara selanjutnya yaitu . Bapak dan Ibu kami minta duduk kembali d. Selamat datang para undangan c. 269 . selamat pagi . Hai semuanya apa kabar? d. situasi pembicaraan b. gimana kabarnya? Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 2. c. usia penuturnya c.. Sebuah komunikasi dapat efektif bergantung pada beberapa hal di bawah ini. Selamat pagi pemirsa c.. 3. Gimana nih kabarnya elu-elu pada? c. kecuali a. tempat dilakukan komunikasi Di bawah ini contoh ungkapan memulai percakapan formal. selamat siang.. Salam sejahtera untuk semua Ucapan membalas acara dalam situasi formal ialah a.TES SEMESTER GENAP I.

d. Saya tidak menerima pendapat yang Saudara ajukan itu. Para peserta diskusi hendaknya menyetujui simpulan ini.d. c. mencacat jumlah peserta d. . Sebelum diskusi ini berakhir. 8. 270 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 7. Saya tidak menyetujui pendapat apalagi Saudara sendiri tidak bersedia dijadikan pengurus. Mengingat suara terbanyak. 9. kecuali semua peserta dapat menerima usulan Saudara. mencatat waktu dan tempat berlangsungnya diskusi e. akan kami bacakan beberapa simpulan. Hendaknya Saudara paham bahwa setiap ceklis diskusi ada simpulan. b. mengikuti tata tertib diskusi b. menilai peserta aktif dan pasif Yang merupakan tugas peserta ialah berikut ini. mencacat hasil diskusi c. Selamat pagi para pemirsa semua! Di mana saja Anda berada salam jumpa ! Yang bukan tugas notulis ialah a. Pendapat Saudara belum jelas. e. Kalimat sanggahan yang tepat sesuai dengan santun diskusi terdapat pada kalimat a. Saya kurang sependapat dengan jalan pikiran Saudara dan apa yang dikemukakan tadi mohon ditinjau kembali. turut menjaga kelancaran diskusi d. Saya tidak sependapat dengan jalan pikiran Saudara dan itu semua tedak perlu diwujudkan. Sebaiknya para peserta diskusi menyadari bahwa simpulan ini adalah milik bersama. mengajukan pertanyaan c. menjaga sikap agar tidak emosional Kalimat simpulan diskusi yang baik adalah a. mohon diulang kembali dan dijelaskan sekali lagi. e. 6. c. memperkenalkan diri e. d. mencacat jalannya diskusi b. e. b. kecuali a. diskusi ini saya simpulkan.

pedoman kerja e. dapat menghasilkan uang 14. kecuali a. Program kerja harus memiliki sifat di bawah ini. dapat dipertanggungjawabkan d. agenda kerja c. logis 13. direvisi c. Di bawah ini ciri gagasan yang kreatif. iplementatif d. Negosiasi mengupayakan agar sebuah program kerja atau usulan tidak dibuat seperti di bawah ini. hasil kerja 12. program kerja d. kecuali a. ekonomis e. maksudnya a. ditinjau ulang Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 271 . jadwal kerja b. sebuah hal yang baru b.10. ditolak e. berbobot e. Sebuah rumusan yang merupakan acuan untuk pelaksanaan sebuah pekerjaan/kegiatan disebut a. kecuali a. Sebuah program kerja harus bersifat realitis. memiliki kualitas arti d. sesuai dengan harapan c. sesuai dengan keadaan b. sesuai realita c. diganti d. diterima b. menginspirasikan gagasan lain 11. dapat diwujudkan secara nyata e. realitas b. sensatif c.

notuler c. d. kegiatan penyuluhan narkoba perlu kita lakukan sebab memiliki efek yang positif untuk mencegah penggunaan narkoba. Saya menyetujui kerja itu. Saudara-saudara harus maklum. proposal b. Dalam diskusi tentang ”Narkoba”. b. Saya mendukung rencana kerja tersebut. Saudara-saudara. Di bawah ini adalah ungkapan mempertahankan sebuah pendapat atau rencana kegiatan a. Saya sependapat dengan Anda. semua tahu kan narkoba sangat merugikan oleh sebab itu harus dicegah. c. kecuali a. kebijakan c. kalau kegiatan ini ditolak berarti saudara semua bandar narkoba. seseorang peserta mempertahankan pendapatnya. Rencana kegiatan ini mudah dilaksanakan layak untuk diprogramkan. Saya kira rencana-rencana itu harus ditolak. kegiatan narkoba oke banget! c. b dan c benar e. 16. Ungkapan yang santun ialah a. e. tulisan d. e. Laporan dapat dibuat atau disampaikan secara a. pemikiran b. Seseorang yang telah selesai melaksanakan sebuah tugas diminta untuk membuat a. b.15. Saudara-saudara. narkoba kan mesti kita berantas! d. 17. jadwal 18. a dan b benar b. laporan d. tindakan d. ringkasan e. penghargaan 272 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Saudara-saudara. lisan c. Saudara-saudara harus paham dong. a. Laporan dapat dijadikan bahan acuan membuat hal di bawah ini. ringkasan 19. penilaian e.

kecuali a. sesuai dengan realita d. persuasif 21.. tetapi gemuruh dan gemertak api yang datang dari hulu lebih seru. Begitu saja keadaan terjadi. jelas d. narasi b. Salah satu bentuk laporan lisan ialah a. sementara teriakan menanti terdengar riuh sekali. laporan kunjungan b. Arus deras dari kampar-kampar menyerbu dari hulu membantu sampan-sampan itu ke hilir. Sementara gemuruh kapal dari hilir makin mendekat.. sistematik 22. apa adanya b. Yang lainnya menyusul. Paragraf tersebut termasuk wacana berjenis. mendalam e. Beberapa orang melompat ke tepi dan tercebur ke kali. menandakan tibanya petaka. Beberapa perahu yang lepas tampak melaju menuju hilir. laporan berita c. berkaitan dengan hal yang baru terjadi e. tepat b. diterima oleh semua pihak 24. objektif e. menarik c. Dari segi materi laporan bersifat berikut. Yang dimaksud laporan harus faktual adalah a. Lengking suara orang dan tabuhan gong. laporan observasi 23. akurat d. deskripsi d. faktual b. laporan tugas d. didukung oleh data yang valid c. Suasana benar-benar kacau balau. Asap yang mengepul hitam legam jelas menunjukkan bahwa sedang terjadi kebakaran. argumentasi Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 273 . laporan perjalanan e. lengkap c. persuasi c. eksposisi e.20. Penyampaian laporan harus seperti di bawah ini a. a.

Hadir dalam suatu acara pada waktu yang ditetapkan. atau melakukan tugas dan kewajiban dengan tepat dan tertib hanya dapat tercapai kalau ada disiplin pribadi. Karangan deskripsi yang menggambarkan objek benda sesuai kesan atau imajinasi si penulis disebut a. narasi b. Dalam kehidupan pribadi. persuasi b. biografi b. kerangka karangan topik c. argumentasi d. deskripsi 27. deskripsi c. Perhatikan kerangka karangan berikut. otobiografi 274 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . deskripsi impresionistis e. argumentasi 28. (1) Teknologi sudah diketahui. eksposisi c. (4) Itu yang terjadi di Amerika Serikat. kerangka karangan imajinatif d. narasi e. dan lain lagi di Indonesia. Di bawah ini bentuk karangan ekspositoris. disiplin berarti peraturan yang dibuat untuk diri sendiri yang tidak bertentangan dengan peraturan umum. Kerangka karangan di atas termasuk berbentuk a. Bangun dan melakukan sesuatu tepat pada waktunya. kecuali a. tetapi belum dimanfaatkan (2) Turbin yang berputar akan mengalirkan energi listrik sebesar 60 megawatt (3) Uap panas itu disalurkan ke turbin. kerangka karangan ide pokok c. Pengembangan paragraf di atas menggunakan pola a. kerangka karangan kalimat b. narasi faktual d.25. kerangka karangan naratif 26.

d. c.c. maksudnya adalh berikut ini. 31. Ringkasan tidak perlu mengikuti urutan isi sumber aslinya. Ikhtisar merupakan pengajuan berisi pandangan pembuat ikhtisar. e. Penulis ringkasan setelah mencatat gagasan pokok. e. membaca naskah asli b. 32. Di bawah ini pernyataan yang berkaitan dengan ikhtisar ialah a. membuat reproduksi e. Ringkasan berisi hal-hal pokok dari karangan panjang. memahami sudut pandang d. Ringkasan merupakan suatu penyajian singkat dan suatu karangan aslinya. maksudnya a. Ikhtisar tidak perlu mempertahankan urutan isi karangan asli. menghapal beberapa kalimatnya e. c. menulis kembali naskah drama b. Ikhtisar pada prinsipnya sama dengan ringkasan. kecuali a. e. Ikhtisar berarti memangkas/ b. menyusun kembali karangan singkat berdasarkan gagasan yang diperoleh Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 275 . mencatat gagasan pokok d. akan melakukan reproduksi. yang bukan merupakan cara membuat ringkasan yang baik adalah a. menggunakan kalimat tunggal daripada kalimat majemuk. Ringkasan berasal dari kata precis yang artinya memotong. d. 30. Hal yang perlu dilakukan oleh pembuat ringkasan ialah membaca naskah asli secara keseluruhan. b. menggunakan interpreterasi pengarang c. menangkap gagasan pokoknya 33. mendapatkan kesan umum b. d. kecuali a. Ringkasan berbeda dengan ikhtisar. menangkap maksud pengarang c. roman kisah perjalanan peristiwa kejahatan 29. Ikhtisar tetap mempertahankan urutan isi wacana aslinya. Di bawah ini pernyataan yang berkaitan dengan ringkasan.

deduktif akibat-sebab 37. deduktif sebab-akibat e. Ia tertidur ketika kebakaran terjadi. e. analogi d. Ia tidur pulas ditengah kebakaran. 35. Penyajian simpulan yang berawal dengan fakta berupa akibat dan diakhiri dengan uraian berupa akibat-akibatnya disebut a. generalisasi c. e. Ia tidur pulas dan tetangganya terbakar. Membuat kerangka karangan Menyusun karangan dari kerangka yang dibuat Mencatat ide-ide pokok naskah asli 34. generalisasi c. deduktif sebab-akibat e. analogi d. deduktif sebab-akibat e.c. Rumahnya terbakar saat ia tidur. silogisme b. Ketika rumah tetangganya terbakar. c. Penyajian simpulan secara umum yang bersumber dari fakta dan data hasil pengamatan dan survei disebut a. ia sedang tertidur pulas. Pola simpulan yang dimulai dengan mengungkapkan fakta-fakta berupa sebab dan diakhiri dengan pernyataan akibat disebut a. d. b. silogisme b. Kalimat singkat dari kalimat majemuk di atas adalah a. generalisasi c. analogi d. deduktif akibat-sebab 38. d. Tetangganya terbakar tetapi ia tertidur pulas. Simpulan yang disajikan dari perbandingan dua hal yang memiliki berbagai kesamaan disebut a. induktif : sebab-akibat 276 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . deduktif akibat-sebab 36. silogisme b.

c. generalisasi 40. Tuti harus berdoa. Pola simpulan yang dimulai dengan pengungkapan berupa akibatakibat dan diakhiri dengan peristiwa yang menjadi sebab disebut a. Jelaskan pengertian wacana deskripsi.Tuti ingin sukses. Simpulannya adalah a. Tuti harus sukses. Buatlah tiga contoh ungkapan pembuka dalam percakapan nonformal. induktif : sebab-akibat b. . Jawablah soal-soal di bawah ini dengan tepat dan benar! Buatlah tiga contoh ungkapan salam pembuka dalam percakapan formal.Semua orang yang ingin sukses harus belajar dan berdoa. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 277 . induktif : akibat-sebab c. Sebutkan yang termasuk pola penyajian deduktif. c. Tuti harus belajar. e. 5. Apa perbedaan ringkasan dan ikhtisar? 10. Sebutkan unsur-unsur diskusi. d. e. 3. 2. b. Tuti akan sukses karena belajar. . Pertimbangan apa yang harus dikemukakan agar pendapat kita diterima? 6. Jelaskan pengertian laporan. deduktif : akibat-sebab e. Tuti harus belajar dan berdoa. Sebutkan jenis-jenis diskusi. deduktif : sebab-akibat d. Untuk apa seseorang melakukan negosiasi? 7. 1. 8. d. II. induktif : akibat-sebab deduktif : sebab-akibat deduktif : akibat-sebab generalisasi 39. 9. 4.b.

). J. Jakarta: Diksi Insan Mulis. Jakarta: Limas. Belajar Mengemukakan Pendapat.2004. Komposisi Bahasa Indonesia. Agustus 2005 Komaruddin. Erien dan Atih Supriatih. Tahun XXXI-Edisi 05-2007. Provinsi DKI Jakarta. A.D. 505. Edisi Mei. Jakarta: Pusat Bahasa Depdiknas. Strategi Sukses UAN SMA / MAN Bahasa Indonesia. Tim MGMP Bahasa Indonesia SMK DKI Jakarta. Dendy (ed. 2005. (ed. 10 Juni 2007. Kumpulan Drama Remaja. 18 November 2007. 2004. November 2006. Rumadi. Januari 2003. Jakarta: Grasindo. 2006.). (ed.. Panduan Kreatif Bahasa Indonesia.DAFTAR PUSTAKA Berita Kota. Puisi Rakyat Merdeka.). 528. Intisari. Jakarta: Grasindo. 01/2005. Yogyakarta: Andi. Media Kominfo Mandikdasmen. Buku Praktis Bahasa Indonesia 1 dan 2.2003. Media Jaya. 2007. 24 November 2007. 2005. Kompas. Kompas. 2003. Sugono. Januari 2008 Dewanto. 2005. Jakarta: Dinas Dikmenti Sub Dinas Pendidikan SMK. Jakarta: Erlangga. Nugroho. Kamus Sinonim-Antonim Bahasa Indonesia. Media Akademika. Lahmudin. 278 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . EYD Plus. Juli 2007 Intisari. No. Majalah Hobi Ikan + Mancing. Republika. Agus dan Rustamaji. Priyantono. Bandung: Yrama Wijaya Finoza. Parera. Modul Bahasa Indonesia. 02 Desember 2007. 2003. No.L. Redaksi Lima Adi Sekawan. Murbandono Hs. No. Jakarta: Yudhistira Kompas.

Tim Pengurus Primagama. Ed. --------------2006. Yogyakarta: LP2IP Gajah Mada. Tim Redaksi. 2006. Kiat Sukses Ujian Nasional 2007 SMK. Bahasa Indonesia untuk SMK Tataran Semenjana I B. Edisi 05. 2006. Wira Usaha dan Keuangan. Satu Bahasa Bahasa Indonesia. 049/12/Th. Klaten: Saka Mitra Kompetensi. Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 279 . Bahasa Indonesia untuk SMK Tataran Madia Jilid. Jakarta : PT. Desember 2007. Jakarta: Yudhistira. II A dan II B. Yogyakarta: LP2IP Gajah Mada. Modul Bahasa Indonesia. Galaxy Puspa Mega. Tim Bahasa. Kelas 2 dan 3 SMK. 2005. Wira Usaha dan Keuangan. Modul Bahasa Indonesia untuk SMK Tingkat XI. Tim Bahasa dan Sastra Indonesia. VII. 2007. Jakarta : Balai Pustaka Tunas. Tim Bahasa dan Sastra Indonesia SMK. Kamus Besar Bahasa Indonesia. 17-30 November 2007. April 2007.Tim LP2IP. 2003. VI. Ed. 057/20/Th. 2005 Pelajaran Bahasa dan Sastra Indonesia. Jakarta: Yudhistira Tim Penyusun. Yogyakarta: Andi. 2006.

Urutan tingkatan atau jenjang jabatan (pangkat kedudukan). khalayan. Kata yang berlawanan makna dengan kata lain. pada masa kini. masuk akal. penerapan. 280 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI . Percekcokan. perselisihan. bersifat pembaharuan (kreasi baru). Orang yang bertindak sebagai penengah. Dorongan yang timbul pada diri seseorang secara sadar atau tidak sadar untuk melakukan suatu tindakan dengan tujuan tertentu. Hubungan antara makna spesifik dan makna generik atau antara anggota taksonomi dan nama taksonomi. kelompok sosial tertentu. Bersifat deduksi. Perubahan bunyi konsonan akibat pengaruh konsonan yang berdekatan. adat. Bersifat (secara) induksi. Kumpulan konsep bersistem yang dijadikan asas pendapat (kejadian) yang memberikan arah dan tujuan untuk kelangsungan hidup. niskala. Bersifat memperkenalkan sesuatu yang baru. Riwayat hidup (seseorang) yang ditulis oleh orang lain. benar menurut penalaran. Pelaksanaan. dewasa ini. pertentangan. Variasi bahasa yang berbeda-beda menurut pemakai (bahasa dari suatu daerah tertentu. Bersifat menjangkau secara luas. Pada waktu yang sama. sewaktu. atau kurun waktu tertentu). Rekaan. tidak berdasarkan kenyataan. tidak berbentuk. Sesuai dengan logika. Gabungan dua kata atau lebih yang bersifat nonpredikatif. semasa. mujarad. Perintah atau arahan (untuk melakukan suatu pekerjaan atau melaksanakan suatu tugas). Sesuatu yang dilembagakan oleh undang-undang.GLOSARIUM GlOSARIUM abstrak antonim asimilasi biografi deduktif dialek ektensif fiksi frasa generalisasi hierarki hiponim ideologi implementatif induktif inovatif institusi instruksi konflik kontemporer logis moderator motivasi Tidak terwujud. atau kebiasaan. Perihal membentuk gagasan atau simpulan umum dari suatu kejadian dan hal.

Perbuatan mewakili. Orang yang bertugas membuat notula (catatan rapat). kebiasaan. reaksi. Menurut pikiran dan pertimbangan yang logia. Bentuk bahasa yang maknanya mirip dengan atau sama dengan bentuk bahasa lain. topik valid verba voting Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 281 . muradif. dan simpulan. Bersifat atau bersikap menenggang (menghargai. Kait-mengait. kata kerja. membolehkan) pendirian ( pendapat. Mengenai keadaan yang sebenarnya tanpa dipengaruhi pendapat atau pandangan pribadi. kata bilangan. kepercayaan. atau keadaan. jawaban. Kata yang menggambarkan proses. berguna secara langsung. keadaan diwakili. Pokok pembicaraan di diskusi. apa yang mewakili. Pengambilan karangan (pendapat) orang lain dan menjadikannya seolah-olah karangan (pendapat) sendiri. bersangkut-paut. cara berpikir atau menarik simpulan yang terdiri atas premis umum. dan karangan.numeralia notulis objektif plagiat proposal prosedur rasional relevan representasi respon retorika revisi silogisme simposium sinonim solidaritas toleran Kata (frasa) yang menunjukkan bilangan atau kuantitas. dan kelakuan) yang berbeda atau bertentangan dengan pendirian sendiri. Rencana yang dituangkan dalam bentuk rancangan kerja. Peninjauan (pemeriksaan) kembali untuk perbaikan Bentuk. perwakilan. Sifat (perasaan) solider. Keputusan dengan pengambilan suara terbanyak. Pertemuan dengan beberapa pembicara yang mengemukakan pidato singkat tentang topik tertentu atau tentang beberapa aspek dari topik yang sama. Tanggapan. membiarkan. Keterampilan berbahasa secara efektif. perbuatan. pandangan. ceramah. menurut pikiran yang sehat. premis khusus. perasaan setia kawan antara sesama anggota yang diperlukan. Tahap kegiatan untuk menyelesaikan suatu aktivitas. sifat satu rasa (senasib). cocok dengan akal. Menurut cara yang semestinya.

Rafiq AIDS aktif anakan analitis animator antarmakna antiklimaks antonim Asian Games B bagan bangkit batik BBM bengkel biodiesel biografi buah naga C Cisolok D dampak deduktif denah deskripsi dialog dialog diskusi diskusi panel disposisi dokumentasi E edelweisj efektif ekonomi eksekutif eksperimen eksploitasi eksposisi ekspositoris ekspresif ekstensif epidemi 100 2 160 113 176 13 74 236 74 250 9 155 131 186 155 186 224 220 208 172 16 10 206 118 137 134 134 50 204 227 223 172 212 210 256 234 206 204 5 2 F faktual fokus formal formulir frasa G gagasan gagasan utama gasohol gaya bahasa gebyar global grafik grafik garis grafik lingkaran H hiponim HIV I idiomatik ikhtisar impresionis Indeks induktif informal informasi intensif intonasi izin bangunan J jadwal jadwal kerja jago dayung K kalimat tanya tersamar kamus karir kata benda kata dasar kata kerja kata keterangan kata sifat kata tugas kata turunan kelas kata 232 192 205 204 78 176 253 186 63 130 172 6 7 7 76 3 73 252 230 kls XI 16 205 93 5 137 233 32 33 251 97 77 26 66 68 64 65 65 67 70 63 keparalelan kerangka topik khasiat khayal KIR klarifikasi klasifikasi klausa kompos konferensi kongres konotatif kredit kronologis L logis M manual Marlioboro mas koki matriks memo mimik mini market moderator modifikasi N narasi narkoba nasi kucing negosiasi nonverbal notulis O objek oposisi OSIS OSIS otobiografi P pakem pamijahan parafrasa patok pemrasaran pengumuman 83 223 220 224 192 96 63 5 221 134 134 72 42 122 176 51 202 112 11 48 137 155 177 155 206 2 202 188 4 175 232 75 32 189 224 130 112 114 202 174 47 282 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI .INDEKS A A.

percakapan perintah peta pola contoh pola gilir pola penyajian pola proses program program kerja proporsional proposal prosa proses psikomotorik puskemas R reproduksi respon retorik ringkasan ritual S sampah plastik santun sarasehan seminar setting 156 44 9 121 132 206 121 93 189 192 32 116 4 191 255 253 31 95 252 62 62 190 134 134 118 simposium simpulan sinonim sistematis skema surat T tabel tabulampot tahapan teks tema Tulung Agung U ungkapan usaha V verbal visual volume voting W wacana wacana 134 177.178 74 176 254 45 233 222 135 254 225 112 163 154 11 11 221 178 115 222 Bahasa Indonesia SMK/MAK Setara Tingkat Madya Kelas XI 283 .